Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072340
Gene name
Locationscaffold_4:1699469..1699956
Strand-
Gene length (bp)487
Transcript length (bp)219
Coding sequence length (bp)219
Protein length (aa) 73

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08520 DUF1748 Fungal protein of unknown function (DUF1748) 3.2E-27 2 70

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2V2P4|YI156_YEAST Uncharacterized protein YIL156W-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL156W-B PE=3 SV=1 1 71 1.0E-20
sp|Q10167|YAUE_SCHPO Uncharacterized protein C26A3.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26A3.14c PE=4 SV=1 2 70 1.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072340
MLGKLVHIGFDAVLISAFLAGLKRTTGLTPALAQVPNKDIRQFLRSYLEFGEYIFDFAVVIFGRSPFFERQR*
Coding >AgabiH97|072340
ATGCTTGGGAAACTGGTACACATTGGCTTCGATGCCGTTCTCATTAGCGCTTTTCTCGCCGGACTGAAACGCACA
ACTGGCCTCACACCCGCTCTGGCCCAAGTCCCTAACAAGGACATCCGTCAATTTCTGCGCAGCTACCTCGAATTC
GGCGAATACATCTTCGACTTTGCGGTTGTTATCTTCGGCCGTTCACCCTTCTTCGAGAGACAGCGATGA
Transcript >AgabiH97|072340
ATGCTTGGGAAACTGGTACACATTGGCTTCGATGCCGTTCTCATTAGCGCTTTTCTCGCCGGACTGAAACGCACA
ACTGGCCTCACACCCGCTCTGGCCCAAGTCCCTAACAAGGACATCCGTCAATTTCTGCGCAGCTACCTCGAATTC
GGCGAATACATCTTCGACTTTGCGGTTGTTATCTTCGGCCGTTCACCCTTCTTCGAGAGACAGCGATGA
Gene >AgabiH97|072340
ATGCTTGGGAAACTGGGTTCGACCGCTCTCTCCCTTGGTGGGATCTACCTGCTCACTCGCGCCTCTCTAGTACAC
ATTGGCTTCGATGCCGTTCTCATTAGCGCTTTTCTCGCCGGACTGAAACGCACAACTGGCCTCACGTACGCACAC
GCATCTCGCAACTCAATCTGTCGACTCACACCATGATTCAGACCCGCTCTGGCCCAAGTCCCTAACAAGGACATC
CGTCGTACGCGACCTGTATCTATCATTCTGACTTCTCACCCACGAACTATGTTTCAGAATTTCTGCGCAGCTACC
TCGAATTCGGTCTGTTGTTTCTACCGTCGACTTTGCTTGCCATTCCCTCGTTCTCATTCTTACGTGTAGGCGAAT
ACATCTTCGACTTTGCGGTTGTTATCTTCGGCGTACGTCCATTCGTGTGGCTCATGCTACTCGCAAACTCACGTC
ACCCCAGCGTTCACCCTTCTTCGAGAGACAGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail