Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072270
Gene name
Locationscaffold_4:1689020..1690580
Strand-
Gene length (bp)1560
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11786 Aft1_HRA Aft1 HRA domain 1.2E-22 104 190
PF00170 bZIP_1 bZIP transcription factor 3.0E-10 377 433
PF07716 bZIP_2 Basic region leucine zipper 1.6E-05 379 432

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52890|ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf1 PE=1 SV=1 372 469 1.0E-20
sp|Q00969|ATF2_RAT Cyclic AMP-dependent transcription factor ATF-2 OS=Rattus norvegicus GN=Atf2 PE=1 SV=2 374 445 1.0E-10
sp|P16951|ATF2_MOUSE Cyclic AMP-dependent transcription factor ATF-2 OS=Mus musculus GN=Atf2 PE=1 SV=2 374 445 1.0E-10
sp|P15336|ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens GN=ATF2 PE=1 SV=4 377 445 2.0E-10
sp|Q8K1L0|CREB5_MOUSE Cyclic AMP-responsive element-binding protein 5 OS=Mus musculus GN=Creb5 PE=2 SV=3 363 445 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52890|ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf1 PE=1 SV=1 372 469 1.0E-20
sp|Q00969|ATF2_RAT Cyclic AMP-dependent transcription factor ATF-2 OS=Rattus norvegicus GN=Atf2 PE=1 SV=2 374 445 1.0E-10
sp|P16951|ATF2_MOUSE Cyclic AMP-dependent transcription factor ATF-2 OS=Mus musculus GN=Atf2 PE=1 SV=2 374 445 1.0E-10
sp|P15336|ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens GN=ATF2 PE=1 SV=4 377 445 2.0E-10
sp|Q8K1L0|CREB5_MOUSE Cyclic AMP-responsive element-binding protein 5 OS=Mus musculus GN=Creb5 PE=2 SV=3 363 445 3.0E-10
sp|O93602|ATF2_CHICK Cyclic AMP-dependent transcription factor ATF-2 OS=Gallus gallus GN=ATF2 PE=2 SV=1 374 445 3.0E-10
sp|Q02930|CREB5_HUMAN Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens GN=CREB5 PE=1 SV=3 363 445 4.0E-10
sp|Q8R0S1|ATF7_MOUSE Cyclic AMP-dependent transcription factor ATF-7 OS=Mus musculus GN=Atf7 PE=2 SV=1 374 445 1.0E-09
sp|Q5R9C9|ATF7_PONAB Cyclic AMP-dependent transcription factor ATF-7 OS=Pongo abelii GN=ATF7 PE=2 SV=1 374 445 1.0E-09
sp|P17544|ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens GN=ATF7 PE=1 SV=2 374 445 1.0E-09
sp|Q59VR1|SKO1_CANAL Transcriptional regulator SKO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKO1 PE=1 SV=1 375 433 8.0E-08
sp|Q09771|ATF31_SCHPO Transcription factor atf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf31 PE=3 SV=1 386 446 2.0E-07
sp|P78962|ATF21_SCHPO Transcription factor atf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf21 PE=3 SV=1 374 433 1.0E-06
sp|Q09926|PCR1_SCHPO Transcription factor pcr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcr1 PE=1 SV=1 371 452 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0019222 regulation of metabolic process No
GO:0140110 transcription regulator activity No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072270
MSPKSPSRSPPPDPSRPQPQPRHTRTDFNLEHNPFEQSFRSSSNVRNSSPPRDSAQPAADSNDAPPSDPERSKSR
SSDDPATHRSQSPRPVLPPLASISSPADQSYPWGYNHASVNSLRSGPLSPAMLTGPQQQSDQPQHMPFDPATFRS
GLTPRTGLTPRTGLTPGTGLTPLVAGSVPYPASPNTATLMAIMNNSGVSNNGPTITPNTLNAIAGALNSTQSTSN
SYPPHQQDPNNPALNATSTAANGLFLLSQAHQELTKREQAQARAGGNPPPNNVNGSAVQQNGKRGNGLKRKSHDN
ASPSPSAVSFSQPAPNKPGKRTRSAAVPRRKESERGFSEGIEDDDDNDDMDDMDMEEMDNSHPPPPRKGPKKPET
EEEKRRNFLERNRQAALKCRQRKKAWLAQLQAKVEYLSNENERLTSALVSSREEISRLSALVGGAGVVPIGVGVN
GVGVNNVGVSGPGVQPVSMNVSLPGKSGGPPVASVGSAAGGRSGSGYGY*
Coding >AgabiH97|072270
ATGTCTCCGAAAAGCCCATCCAGGTCTCCGCCCCCGGACCCTTCTCGCCCCCAGCCCCAGCCCCGCCACACCCGC
ACCGACTTCAACCTCGAGCACAACCCCTTTGAGCAGTCTTTTCGCTCGTCTTCCAACGTCCGCAATTCGTCCCCG
CCCCGCGACTCTGCCCAGCCCGCCGCCGACTCCAACGACGCACCCCCCAGCGACCCCGAGCGTTCCAAGTCCCGC
TCCTCCGACGATCCCGCCACCCACCGCAGCCAGTCCCCACGCCCCGTCCTTCCCCCGCTCGCCTCCATCTCGTCC
CCCGCTGACCAGTCCTATCCATGGGGCTACAATCACGCCTCCGTCAACTCCCTCCGCTCAGGGCCCCTCTCCCCT
GCCATGCTCACTGGGCCCCAACAACAGAGCGATCAGCCCCAACATATGCCTTTTGACCCCGCGACCTTCCGCTCT
GGCCTCACCCCCCGCACTGGCCTCACTCCCCGCACGGGTCTTACCCCCGGCACTGGCTTGACTCCTCTTGTCGCC
GGTTCAGTTCCCTATCCCGCCTCCCCTAATACAGCTACCCTCATGGCTATCATGAACAATTCGGGGGTTTCCAAT
AACGGCCCCACCATCACCCCTAACACCCTCAATGCCATCGCCGGTGCCCTCAACTCAACCCAATCAACATCTAAT
TCATACCCTCCGCATCAGCAGGATCCAAACAATCCCGCCCTAAATGCTACAAGCACGGCTGCCAATGGCCTCTTT
CTTTTATCTCAAGCACACCAAGAACTTACTAAGCGAGAACAGGCTCAAGCACGCGCCGGCGGTAACCCACCCCCC
AATAATGTCAATGGTTCTGCAGTACAACAGAACGGCAAGAGGGGCAATGGCTTGAAACGCAAGTCTCATGATAAT
GCCTCTCCATCACCTTCCGCCGTATCCTTTTCCCAACCAGCACCAAACAAACCTGGAAAACGGACCCGATCCGCG
GCTGTACCCCGCCGAAAGGAAAGTGAACGCGGATTTTCAGAAGGCATTGAAGACGACGATGACAATGATGACATG
GATGACATGGACATGGAAGAAATGGACAATTCTCATCCCCCTCCTCCCCGTAAAGGTCCGAAAAAACCTGAAACG
GAGGAGGAAAAGCGGCGTAATTTCCTGGAGCGCAATAGACAAGCTGCCCTCAAATGCCGGCAACGTAAAAAGGCC
TGGCTCGCACAACTCCAGGCCAAGGTTGAATACCTTAGCAATGAAAATGAGAGACTCACCTCTGCCCTCGTTTCT
TCAAGAGAGGAAATATCTCGTCTCTCTGCTCTCGTTGGGGGTGCTGGTGTTGTCCCAATCGGTGTTGGCGTCAAC
GGTGTTGGAGTGAACAACGTTGGTGTATCCGGTCCCGGCGTCCAACCTGTGAGCATGAACGTCAGTCTTCCAGGC
AAGTCTGGTGGTCCTCCCGTCGCAAGTGTAGGCTCTGCCGCTGGTGGTCGCTCCGGTAGTGGCTATGGGTATTGA
Transcript >AgabiH97|072270
ATGTCTCCGAAAAGCCCATCCAGGTCTCCGCCCCCGGACCCTTCTCGCCCCCAGCCCCAGCCCCGCCACACCCGC
ACCGACTTCAACCTCGAGCACAACCCCTTTGAGCAGTCTTTTCGCTCGTCTTCCAACGTCCGCAATTCGTCCCCG
CCCCGCGACTCTGCCCAGCCCGCCGCCGACTCCAACGACGCACCCCCCAGCGACCCCGAGCGTTCCAAGTCCCGC
TCCTCCGACGATCCCGCCACCCACCGCAGCCAGTCCCCACGCCCCGTCCTTCCCCCGCTCGCCTCCATCTCGTCC
CCCGCTGACCAGTCCTATCCATGGGGCTACAATCACGCCTCCGTCAACTCCCTCCGCTCAGGGCCCCTCTCCCCT
GCCATGCTCACTGGGCCCCAACAACAGAGCGATCAGCCCCAACATATGCCTTTTGACCCCGCGACCTTCCGCTCT
GGCCTCACCCCCCGCACTGGCCTCACTCCCCGCACGGGTCTTACCCCCGGCACTGGCTTGACTCCTCTTGTCGCC
GGTTCAGTTCCCTATCCCGCCTCCCCTAATACAGCTACCCTCATGGCTATCATGAACAATTCGGGGGTTTCCAAT
AACGGCCCCACCATCACCCCTAACACCCTCAATGCCATCGCCGGTGCCCTCAACTCAACCCAATCAACATCTAAT
TCATACCCTCCGCATCAGCAGGATCCAAACAATCCCGCCCTAAATGCTACAAGCACGGCTGCCAATGGCCTCTTT
CTTTTATCTCAAGCACACCAAGAACTTACTAAGCGAGAACAGGCTCAAGCACGCGCCGGCGGTAACCCACCCCCC
AATAATGTCAATGGTTCTGCAGTACAACAGAACGGCAAGAGGGGCAATGGCTTGAAACGCAAGTCTCATGATAAT
GCCTCTCCATCACCTTCCGCCGTATCCTTTTCCCAACCAGCACCAAACAAACCTGGAAAACGGACCCGATCCGCG
GCTGTACCCCGCCGAAAGGAAAGTGAACGCGGATTTTCAGAAGGCATTGAAGACGACGATGACAATGATGACATG
GATGACATGGACATGGAAGAAATGGACAATTCTCATCCCCCTCCTCCCCGTAAAGGTCCGAAAAAACCTGAAACG
GAGGAGGAAAAGCGGCGTAATTTCCTGGAGCGCAATAGACAAGCTGCCCTCAAATGCCGGCAACGTAAAAAGGCC
TGGCTCGCACAACTCCAGGCCAAGGTTGAATACCTTAGCAATGAAAATGAGAGACTCACCTCTGCCCTCGTTTCT
TCAAGAGAGGAAATATCTCGTCTCTCTGCTCTCGTTGGGGGTGCTGGTGTTGTCCCAATCGGTGTTGGCGTCAAC
GGTGTTGGAGTGAACAACGTTGGTGTATCCGGTCCCGGCGTCCAACCTGTGAGCATGAACGTCAGTCTTCCAGGC
AAGTCTGGTGGTCCTCCCGTCGCAAGTGTAGGCTCTGCCGCTGGTGGTCGCTCCGGTAGTGGCTATGGGTATTGA
Gene >AgabiH97|072270
ATGTCTCCGAAAAGCCCATCCAGGTCTCCGCCCCCGGACCCTTCTCGCCCCCAGCCCCAGCCCCGCCACACCCGC
ACCGACTTCAACCTCGAGCACAACCCCTTTGAGCAGTCTTTTCGCTCGTCTTCCAACGTCCGCAATTCGTCCCCG
CCCCGCGACTCTGCCCAGCCCGCCGCCGACTCCAACGACGCACCCCCCAGCGACCCCGAGCGTTCCAAGTCCCGC
TCCTCCGACGATCCCGCCACCCACCGCAGCCAGTCCCCACGCCCCGTCCTTCCCCCGCTCGCCTCCATCTCGTCC
CCCGCTGACCAGTCCTATCCATGGGGCTACAATCACGCCTCCGTCAACTCCCTCCGCTCAGGGCCCCTCTCCCCT
GCCATGCTCACTGGGCCCCAACAACAGAGCGATCAGCCCCAACATATGCCTTTTGACCCCGCGACCTTCCGCTCT
GGCCTCACCCCCCGCACTGGCCTCACTCCCCGCACGGGTCTTACCCCCGGCACTGGCTTGACTCCTCTTGTCGCC
GGTTCAGTTCCCTATCCCGCCTCCCCTAATACAGCTACCCTCATGGCTATCATGAACAATTCGGGGGTTTCCAAT
AACGGCCCCACCATCACCCCTAACACCCTCAATGCCATCGCCGGTGCCCTCAACTCAACCCAATCAACATCTAAT
TCATACCCTCCGCATCAGCAGGATCCAAACAATCCCGCCCTAAATGCTACAAGCACGGCTGCCAATGGCCTCTTT
CTTTTATCTCAAGCACACCAAGAACTTACTAAGCGAGAACAGGCTCAAGCACGCGCCGGCGGTAACCCACCCCCC
AATAATGTCAATGGTTCTGCAGTACAACAGAACGGCAAGAGGGGCAATGGCTTGAAACGCAAGTCTCATGATAAT
GCCTCTCCATCACCTTCCGCCGTATCCTTTTCCCAACCAGCACCAAACAAACCTGGAAAACGGACCCGATCCGCG
GCTGTACCCCGCCGAAAGGAAAGTGAACGCGGATTTTCAGAAGGCATTGAAGACGACGATGACAATGATGACATG
GATGACATGGACATGGAAGAAATGGACAATTCTCATCCCCCTCCTCCCCGTAAAGGTCCGAAAAAACCTGAAACG
GAGGAGGAAAAGCGGCGTAATTTCCTGGAGCGCAATAGACAAGGTGAGGTTGATTCCTCTATATCACCGCCCTCA
TCGATAGCTTATTGATTATCCACATCAGCTGCCCTCAAATGCCGGCAACGTAAAAAGGCCTGGCTCGCACAACTC
CAGGCCAAGGTTGAATACCTTAGCAATGAAAATGAGAGACTCACCTCTGCCCTCGTTTCTTCAAGAGAGGAAATA
TCTCGTCTCTCTGCTCTCGTTGGGGGTGCTGGTGTTGTCCCAATCGGTGTTGGCGTCAACGGTGTTGGAGTGAAC
AACGTTGGTGTATCCGGTCCCGGCGTCCAACCTGTGAGCATGAACGTCAGTCTTCCAGGCAAGTCTGGTGGTCCT
CCCGTCGCAAGTGTAGGCTCTGCCGCTGGTGGTCGCTCCGGTAGTGGCTATGGGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail