Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072130
Gene name
Locationscaffold_4:1652661..1654765
Strand+
Gene length (bp)2104
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 3.9E-27 174 369
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 1.7E-07 196 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E3QQU9|LAP1_COLGM Leucine aminopeptidase 1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LAP1 PE=3 SV=1 5 383 1.0E-105
sp|B2WMR5|LAP1_PYRTR Leucine aminopeptidase 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=lap1 PE=3 SV=1 42 383 2.0E-104
sp|F0X8C8|LAP1_GROCL Leucine aminopeptidase 1 OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=LAP1 PE=3 SV=1 1 383 4.0E-104
sp|B2B3P6|LAP1_PODAN Leucine aminopeptidase 1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=LAP1 PE=3 SV=1 45 383 2.0E-103
sp|Q0U6L1|LAP1_PHANO Leucine aminopeptidase 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LAP1 PE=3 SV=1 42 383 3.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E3QQU9|LAP1_COLGM Leucine aminopeptidase 1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LAP1 PE=3 SV=1 5 383 1.0E-105
sp|B2WMR5|LAP1_PYRTR Leucine aminopeptidase 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=lap1 PE=3 SV=1 42 383 2.0E-104
sp|F0X8C8|LAP1_GROCL Leucine aminopeptidase 1 OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=LAP1 PE=3 SV=1 1 383 4.0E-104
sp|B2B3P6|LAP1_PODAN Leucine aminopeptidase 1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=LAP1 PE=3 SV=1 45 383 2.0E-103
sp|Q0U6L1|LAP1_PHANO Leucine aminopeptidase 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LAP1 PE=3 SV=1 42 383 3.0E-103
sp|E4ZHQ5|LAP1_LEPMJ Leucine aminopeptidase 1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LAP1 PE=3 SV=1 7 383 9.0E-103
sp|E3S6P9|LAP1_PYRTT Leucine aminopeptidase 1 OS=Pyrenophora teres f. teres (strain 0-1) GN=lap1 PE=3 SV=1 42 383 1.0E-102
sp|A4R640|LAP1_MAGO7 Leucine aminopeptidase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LAP1 PE=3 SV=1 1 383 1.0E-102
sp|Q7RYC8|LAP1_NEUCR Leucine aminopeptidase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lap1 PE=3 SV=1 20 383 2.0E-102
sp|B6H3H1|LAP1_PENRW Leucine aminopeptidase 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lap1 PE=3 SV=1 11 383 3.0E-101
sp|Q5AXE5|LAP1_EMENI Leucine aminopeptidase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lap1 PE=3 SV=1 10 382 4.0E-99
sp|C7Z6W1|LAP1_NECH7 Leucine aminopeptidase 1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LAP1 PE=3 SV=1 44 383 4.0E-99
sp|E9F277|LAP1_METRA Leucine aminopeptidase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=LAP1 PE=3 SV=1 44 383 4.0E-99
sp|Q2H1T8|LAP1_CHAGB Leucine aminopeptidase 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LAP1 PE=3 SV=1 40 383 8.0E-99
sp|E9DUF4|LAP1_METAQ Leucine aminopeptidase 1 OS=Metarhizium acridum (strain CQMa 102) GN=LAP1 PE=3 SV=1 44 383 3.0E-98
sp|E9DBV9|LAP1_COCPS Leucine aminopeptidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=LAP1 PE=3 SV=1 44 383 3.0E-98
sp|A4V8W0|LAP1_TRIHA Leucine aminopeptidase 1 OS=Trichoderma harzianum GN=lap1 PE=2 SV=1 37 382 7.0E-98
sp|C5P552|LAP1_COCP7 Leucine aminopeptidase 1 OS=Coccidioides posadasii (strain C735) GN=LAP1 PE=3 SV=1 24 383 9.0E-98
sp|A7ETG2|LAP1_SCLS1 Leucine aminopeptidase 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lap1 PE=3 SV=1 44 383 2.0E-97
sp|A1C948|LAP1_ASPCL Leucine aminopeptidase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lap1 PE=3 SV=1 44 382 1.0E-96
sp|C4JLL1|LAP1_UNCRE Leucine aminopeptidase 1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=LAP1 PE=3 SV=1 26 383 2.0E-95
sp|A2R2G1|LAP1_ASPNC Leucine aminopeptidase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lap1 PE=3 SV=1 44 382 4.0E-95
sp|Q2PIT3|LAP1_ASPOR Leucine aminopeptidase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lap1 PE=3 SV=1 44 383 2.0E-94
sp|B8NYX1|LAP1_ASPFN Leucine aminopeptidase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lap1 PE=3 SV=1 44 383 2.0E-94
sp|Q4W9P4|LAP1_ASPFU Leucine aminopeptidase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lap1 PE=3 SV=2 1 383 2.0E-94
sp|Q5VJG6|LAP1_ASPFM Leucine aminopeptidase 1 OS=Neosartorya fumigata GN=lap1 PE=3 SV=1 1 383 2.0E-94
sp|B0YED6|LAP1_ASPFC Leucine aminopeptidase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lap1 PE=3 SV=2 1 383 2.0E-94
sp|C5JX80|LAP1_AJEDS Leucine aminopeptidase 1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=LAP1 PE=3 SV=1 36 383 1.0E-93
sp|C5GRP9|LAP1_AJEDR Leucine aminopeptidase 1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=LAP1 PE=3 SV=1 36 383 2.0E-93
sp|A1D9K5|LAP1_NEOFI Leucine aminopeptidase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lap1 PE=3 SV=1 1 383 4.0E-93
sp|C1HC91|LAP1_PARBA Leucine aminopeptidase 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=LAP1 PE=3 SV=1 4 383 3.0E-87
sp|C0SJ49|LAP1_PARBP Leucine aminopeptidase 1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=LAP1 PE=3 SV=1 38 383 8.0E-87
sp|C0NVM2|LAP1_AJECG Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=LAP1 PE=3 SV=1 6 383 1.0E-86
sp|A6REE0|LAP1_AJECN Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=LAP1 PE=3 SV=1 4 383 4.0E-86
sp|C1GMY8|LAP1_PARBD Leucine aminopeptidase 1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=LAP1 PE=3 SV=1 38 383 4.0E-86
sp|Q04033|YD415_YEAST Probable aminopeptidase YDR415C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR415C PE=3 SV=1 43 386 6.0E-84
sp|C6HH71|LAP1_AJECH Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain H143) GN=LAP1 PE=3 SV=1 6 383 8.0E-84
sp|F0URV0|LAP1_AJEC8 Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain H88) GN=LAP1 PE=3 SV=1 6 383 8.0E-84
sp|Q2U1F3|LAPA_ASPOR Leucine aminopeptidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lapA PE=1 SV=1 42 382 1.0E-83
sp|D4B528|LAP1_ARTBC Probable leucine aminopeptidase 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=LAP1 PE=1 SV=1 7 383 8.0E-82
sp|D4DHE3|LAP1_TRIVH Probable leucine aminopeptidase 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=LAP1 PE=3 SV=1 7 383 9.0E-82
sp|B6V870|LAP1_TRITO Probable leucine aminopeptidase 1 OS=Trichophyton tonsurans GN=LAP1 PE=3 SV=2 7 383 7.0E-81
sp|A7UI11|LAP1_TRIEQ Leucine aminopeptidase 1 OS=Trichophyton equinum GN=LAP1 PE=3 SV=1 7 383 7.0E-81
sp|E4V655|LAP1_ARTGP Leucine aminopeptidase 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=LAP1 PE=3 SV=1 7 382 1.0E-80
sp|C5FFM0|LAP1_ARTOC Leucine aminopeptidase 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LAP1 PE=3 SV=1 44 382 2.0E-79
sp|Q8J2N2|LAP1_ASPSO Leucine aminopeptidase 1 OS=Aspergillus sojae GN=lap1 PE=1 SV=1 42 382 5.0E-79
sp|Q5QHG5|LAP1_TRIRU Leucine aminopeptidase 1 OS=Trichophyton rubrum GN=LAP1 PE=1 SV=1 7 383 7.0E-79
sp|C5G0A8|LAP3_ARTOC Probable leucine aminopeptidase MCYG_08380 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_08380 PE=3 SV=1 44 382 3.0E-75
sp|C5FNB5|LAP5_ARTOC Probable leucine aminopeptidase MCYG_04170 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04170 PE=3 SV=1 44 382 4.0E-74
sp|D4DF09|LAP3_TRIVH Probable leucine aminopeptidase TRV_05750 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05750 PE=3 SV=2 40 383 9.0E-72
sp|D4B4V2|LAP3_ARTBC Probable leucine aminopeptidase ARB_03492 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03492 PE=3 SV=1 40 383 2.0E-71
sp|C5FLR8|LAP4_ARTOC Probable leucine aminopeptidase MCYG_03459 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_03459 PE=3 SV=1 44 382 1.0E-70
sp|D4AZ23|LAP4_ARTBC Probable leucine aminopeptidase ARB_01443 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01443 PE=3 SV=1 44 382 2.0E-65
sp|D4AWL0|LAP5_ARTBC Probable leucine aminopeptidase ARB_00576 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00576 PE=3 SV=1 44 382 6.0E-65
sp|D4DDS4|LAP4_TRIVH Probable leucine aminopeptidase TRV_05286 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05286 PE=3 SV=1 44 382 1.0E-64
sp|P0CH60|LAP5_TRIVH Probable leucine aminopeptidase TRV_02148.1 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02148.1 PE=3 SV=1 44 382 3.0E-64
sp|Q01693|AMPX_VIBPR Bacterial leucyl aminopeptidase OS=Vibrio proteolyticus PE=1 SV=1 117 386 1.0E-47
sp|E5R501|M28P3_LEPMJ Probable zinc metalloprotease Lema_P049800 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P049800 PE=3 SV=1 96 299 1.0E-11
sp|E3S5D4|M28P3_PYRTT Probable zinc metalloprotease PTT_17836 OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_17836 PE=3 SV=1 104 311 8.0E-10
sp|B2W572|M28P3_PYRTR Probable zinc metalloprotease PTRG_04772 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_04772 PE=3 SV=1 104 311 1.0E-09
sp|Q0UNS4|M28P3_PHANO Probable zinc metalloprotease SNOG_06590 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_06590 PE=3 SV=2 104 311 2.0E-09
sp|P37302|APE3_YEAST Aminopeptidase Y OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE3 PE=1 SV=1 171 276 5.0E-08
sp|D4AWC9|LAP2_ARTBC Probable leucine aminopeptidase 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=LAP2 PE=1 SV=1 159 252 2.0E-07
sp|A7UI10|LAP2_TRITO Leucine aminopeptidase 2 OS=Trichophyton tonsurans GN=LAP2 PE=3 SV=1 158 252 3.0E-07
sp|D4D3D1|LAP2_TRIVH Probable leucine aminopeptidase 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=LAP2 PE=3 SV=1 159 252 3.0E-07
sp|Q02PA2|LAP_PSEAB Aminopeptidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lap PE=1 SV=1 184 262 3.0E-07
sp|Q9HZQ8|LAP_PSEAE Aminopeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lap PE=1 SV=1 184 262 3.0E-07
sp|Q5QHG6|LAP2_TRIRU Leucine aminopeptidase 2 OS=Trichophyton rubrum GN=LAP2 PE=1 SV=1 158 252 3.0E-07
sp|A7UI09|LAP2_TRIEQ Leucine aminopeptidase 2 OS=Trichophyton equinum GN=LAP2 PE=3 SV=1 158 252 3.0E-07
sp|C5FTZ6|LAP2_ARTOC Leucine aminopeptidase 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LAP2 PE=3 SV=1 184 252 6.0E-07
sp|P81715|LIE1_STREX Leupeptin-inactivating enzyme 1 OS=Streptomyces exfoliatus GN=lieA PE=1 SV=2 184 334 8.0E-07
sp|C5FP82|M28P2_ARTOC Probable zinc metalloprotease MCYG_04217 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04217 PE=3 SV=1 182 284 1.0E-06
sp|P80561|APX_STRGG Aminopeptidase S OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=SGR_5809 PE=1 SV=2 184 334 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072130
MKSLASLLSLLALVASGVIALPHESQTTFEVHPGFDLDLGAQRLVELEGHQRIWMSELEKIQAKARGAKFFDVTE
TEDLGSLNNLNMEPTAFYSLKATERVFPILKTLSTKGPRENLEKFSGFRTRYYRSDTGKQSQQWLLRKIQEITSK
YASESLKEIIAIKEFPHSWGQNTIITRVNGSSTDDDSVVVIGAHQDSTNLWPFLPAPGADDDGSGTVTILEAYRA
LVAADFRPIHTVEFHWYSAEEGGLLGSQAVARHYEQNGAHVLGMSQFDMTAWVKRGTREEVGIITDFVDTNLTEF
NKKLVTTYLDIPYVETKCGYACSDHASWRKAGYPSTFTIESSFENSNKNIHSANDRIDISDEFSFDHMLEFSKLA
VAFAVELGGWTESK*
Coding >AgabiH97|072130
ATGAAGTCCCTTGCTAGCCTCCTGTCCCTCCTCGCACTCGTCGCTTCCGGCGTAATAGCTCTGCCACATGAGTCC
CAGACTACCTTCGAGGTTCACCCAGGGTTCGACCTTGATTTGGGCGCCCAACGCCTCGTCGAATTGGAAGGTCAC
CAACGTATCTGGATGTCCGAGCTTGAGAAGATCCAGGCCAAGGCTCGTGGCGCTAAATTCTTCGACGTCACCGAA
ACTGAAGATTTGGGCTCATTGAACAACCTCAATATGGAGCCAACTGCATTTTATTCCTTGAAAGCAACGGAAAGG
GTGTTCCCTATCCTGAAGACCTTGTCCACCAAGGGACCCCGGGAAAACCTCGAGAAATTTTCAGGTTTTCGCACC
AGGTATTATCGAAGTGATACTGGCAAGCAGAGTCAACAGTGGTTACTTAGGAAAATACAAGAGATCACTTCAAAA
TACGCGTCTGAATCTTTAAAGGAAATTATTGCCATAAAAGAGTTCCCGCATTCGTGGGGCCAAAACACCATTATA
ACTCGAGTCAATGGCTCATCCACGGACGATGATAGTGTGGTGGTGATTGGTGCTCACCAAGATAGTACCAATCTT
TGGCCCTTCCTCCCTGCTCCCGGTGCTGATGACGATGGATCTGGCACTGTTACGATCTTGGAAGCGTACCGTGCT
CTTGTTGCGGCTGATTTCCGGCCCATCCACACCGTGGAGTTCCACTGGTACTCAGCTGAGGAAGGAGGTCTCTTA
GGATCGCAGGCCGTCGCCAGGCATTATGAACAGAATGGTGCCCATGTTTTGGGCATGAGCCAGTTTGATATGACT
GCCTGGGTTAAGCGTGGGACTCGCGAAGAAGTCGGAATAATCACCGATTTTGTTGACACAAACCTTACCGAATTT
AATAAGAAGCTCGTGACAACTTATCTTGATATTCCATATGTTGAGACCAAATGCGGTTATGCATGCAGTGACCAT
GCCTCGTGGAGAAAGGCAGGATACCCCTCAACTTTTACCATCGAAAGTTCTTTCGAGAATTCGAACAAGAACATT
CACTCCGCGAATGACCGGATCGACATTTCCGACGAGTTCAGCTTTGATCATATGCTGGAGTTTTCTAAACTTGCC
GTCGCTTTTGCAGTGGAGTTGGGTGGGTGGACGGAGTCTAAATAA
Transcript >AgabiH97|072130
ATGAAGTCCCTTGCTAGCCTCCTGTCCCTCCTCGCACTCGTCGCTTCCGGCGTAATAGCTCTGCCACATGAGTCC
CAGACTACCTTCGAGGTTCACCCAGGGTTCGACCTTGATTTGGGCGCCCAACGCCTCGTCGAATTGGAAGGTCAC
CAACGTATCTGGATGTCCGAGCTTGAGAAGATCCAGGCCAAGGCTCGTGGCGCTAAATTCTTCGACGTCACCGAA
ACTGAAGATTTGGGCTCATTGAACAACCTCAATATGGAGCCAACTGCATTTTATTCCTTGAAAGCAACGGAAAGG
GTGTTCCCTATCCTGAAGACCTTGTCCACCAAGGGACCCCGGGAAAACCTCGAGAAATTTTCAGGTTTTCGCACC
AGGTATTATCGAAGTGATACTGGCAAGCAGAGTCAACAGTGGTTACTTAGGAAAATACAAGAGATCACTTCAAAA
TACGCGTCTGAATCTTTAAAGGAAATTATTGCCATAAAAGAGTTCCCGCATTCGTGGGGCCAAAACACCATTATA
ACTCGAGTCAATGGCTCATCCACGGACGATGATAGTGTGGTGGTGATTGGTGCTCACCAAGATAGTACCAATCTT
TGGCCCTTCCTCCCTGCTCCCGGTGCTGATGACGATGGATCTGGCACTGTTACGATCTTGGAAGCGTACCGTGCT
CTTGTTGCGGCTGATTTCCGGCCCATCCACACCGTGGAGTTCCACTGGTACTCAGCTGAGGAAGGAGGTCTCTTA
GGATCGCAGGCCGTCGCCAGGCATTATGAACAGAATGGTGCCCATGTTTTGGGCATGAGCCAGTTTGATATGACT
GCCTGGGTTAAGCGTGGGACTCGCGAAGAAGTCGGAATAATCACCGATTTTGTTGACACAAACCTTACCGAATTT
AATAAGAAGCTCGTGACAACTTATCTTGATATTCCATATGTTGAGACCAAATGCGGTTATGCATGCAGTGACCAT
GCCTCGTGGAGAAAGGCAGGATACCCCTCAACTTTTACCATCGAAAGTTCTTTCGAGAATTCGAACAAGAACATT
CACTCCGCGAATGACCGGATCGACATTTCCGACGAGTTCAGCTTTGATCATATGCTGGAGTTTTCTAAACTTGCC
GTCGCTTTTGCAGTGGAGTTGGGTGGGTGGACGGAGTCTAAATAA
Gene >AgabiH97|072130
ATGAAGTCCCTTGCTAGCCTCCTGTCCCTCCTCGCACTCGTCGCTTCCGGCGTAATAGCTCTGCCACATGAGTCC
CAGACTACCTTCGAGGTTCACCCAGGGTTCGACCTTGATTTGGGCGCCCAACGCCTCGTCGAATTGGAAGGTCAC
CAACGTATCTGGATGTCCGAGCTTGAGAAGGTATACATATTGATTCCACAATGCCGTTGCGTACAGCATTTTAAC
GACGGCCAAAGATCCAGGCCAAGGCTCGTGGCGCTAAATTCTTCGACGTGTACGGAATACAATTGTCAACGGCTT
TTTATTCTAACACCCATTCAGCACCGAAACTGAAGATTTGGGCTCATTGAACAACCTCAATATGGAGCCAAGTGA
GCCATCATGGCTATGTTATATTTTACTGTGCTTCATGCTGCCTGGCAGCTGCATTTTATTCCTTGAAAGCAACGG
AAAGGGTGTTCCCTATCCTGAAGACCTTGTCCACCAAGGGACCCCGGGAAAACCTCGAGAAATTTTCAGGTTTTC
GCACCAGGTGTAAGTCTCACACATGGTCTTCTCTACTTAGCTTAACAATGCGATTCAGATTATCGAAGTGATGTG
AGGCTTCTTTCTCTTATCGGCTTGTCACTCGAACTAAATCACTGTTCTTCCAGACTGGCAAGCAGAGTCAACAGT
GGTTACTTAGGAAAATACAAGAGGTATTGACTGTCCGATGCTAAAGAATATATCTCATATCTCATGTGTTGCAGA
TCACTTCAAAATACGCGTCTGAATCTTTAAAGGAAATTATTGCCATAAAAGAGTTCCCGCATTCGTGGGGCCAAA
ACACCATTGTATGCGAATCGTCCTGATACCGTCTCATTATTAACGAATGGCAGATAACTCGAGTCAATGGCTCAT
CCACGGACGATGATAGTGTGGTGGTGATTGGTGCTCACCAAGATAGGTAAGGATTGAAGTCAATGTCGGAAGGTT
ATCACACCTGACACTTCATATCAGTACCAATCTTTGGCCCTTCCTCCCTGCTCCCGGTGAGTCAACTCTTTAGAT
ATCCGTACATTTCTGACCCCAAAACATCAAGGTGCTGATGGTATAGTTACCCCGGATGCGTAATTGCTTATTCTG
AAACTCAATTAACAGACGATGGATCTGGCACTGTTACGATCTTGGAAGCGTACCGTGCTCTTGTTGCGGCTGATT
TCCGGCCCATCCACACCGTGGAGTTCCACTGGTACTCAGCTGAGGTTTGCATCCATAATTACCGCATTGTCGAAT
ATTGCGTTACCTAGCTTTTTTTCTTTTTGCCAGGAAGGAGGTCTCTTAGGATCGCAGGCCGTCGCCAGGCATTAT
GAACAGAATGGTGCCCATGTTTTGGGCATGAGCCAGGTAATACAAGCAGTCACATCTTTTATCATTGTATGGCTT
ATGTTGGCATAGTTTGATATGACTGCCTGGGTTAAGGTTCGTAACGCCATCCAATTTCTCTGTTTCGACATTGAG
TTATTTGGGGCAGCGTGGGACTCGCGAAGAAGTCGGAATAATCACCGATTTTGTTGACACAAAGTAGGTCTTTTG
CCTTTATTTTTTGTTGCCGGTGTATTCATTCCATCATGATCATCAGCCTTACCGAATTTAATAAGAAGCTCGTGA
CAACTTATCTTGATATTCCATATGTTGAGGTAAGGTCCACGTTTTTAGTAGGCTAAATTTAAATGGGCATACGTA
GACCAAATGCGGTTATGCATGCAGTGACCAGTAAGTTCCCCTTGATTTTGTCCCTGGCACGAGCTTGATAACCAA
TTATTTCAGTGCCTCGTGGAGAAAGGCAGGATACCCCTCAACTTTTACCATCGGCAAGTAGTAGTTCGCTTCTAG
CGAAGCGTGTCGTTTACCTGCTTGCAGAAAGTTCTTTCGAGAATTCGAACAAGAACATTCACTCCGCGAATGAGT
GAGTCCCTAATTAATCGTTGGCAACTGCTTTCCCCTGATGTTATTAAGCCGGATCGACATTTCCGACGAGTTCAG
CTTTGATCATATGCTGGAGTTTTCTAAACTTGCCGTCGCTTTTGCAGTGGAGTTGGGTGGGTGGACGGAGTCTAA
ATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail