Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|072090
Gene name
Locationscaffold_4:1647080..1648323
Strand+
Gene length (bp)1243
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11790 Glyco_hydro_cc Glycosyl hydrolase catalytic core 1.8E-63 105 338

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09788|ASL1_SCHPO Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asl1 PE=1 SV=1 167 339 9.0E-24

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|072090
MAVTKLLNLLAISCLAIVASFGPVPVSALSVESVHHARRDHHVLAAKKRGNSSKRCKPRSTTPAPSPSPTTSKKP
APKPTSSKDVAPPSPTPPSGGGDSGARKVGIAFTGGDESAITQFWSWKTQFYYTWSPWCIDAADKVGFQCCRMLW
GFKQIDDFTKNARPGHGNCAMGPNEPNEPSQSNMSPQDAAGLWKQYLEPLHDNGYTLISPACTNAPSGKTWMQDF
FKACDGCHVDRLAVHFYGTDAQDLIDYVEDMHATFGKQVWVTEFACQDFSGGQQSNQQQVTEFMQKVTAYMDHTD
KVGQYFAFGALTNMGNVNTKNQLLNPSGSGLTALGKLYIGE*
Coding >AgabiH97|072090
ATGGCAGTCACCAAATTACTCAACCTCCTCGCCATTTCCTGCCTTGCCATCGTCGCATCTTTCGGCCCTGTCCCG
GTTTCAGCCCTCTCCGTTGAATCGGTCCACCATGCGCGTCGCGATCACCACGTTTTAGCTGCAAAGAAACGTGGT
AATTCTTCCAAGCGATGCAAGCCCCGTTCCACCACCCCTGCACCCAGCCCTTCCCCTACCACTTCGAAGAAGCCG
GCACCCAAGCCCACTTCGTCCAAAGATGTTGCTCCCCCTAGCCCAACCCCACCTAGTGGCGGTGGAGACAGTGGC
GCTCGCAAAGTCGGTATTGCTTTTACAGGGGGCGATGAGAGTGCTATCACACAATTCTGGTCCTGGAAAACTCAA
TTTTATTACACTTGGAGCCCCTGGTGCATTGATGCCGCTGACAAAGTCGGCTTCCAATGCTGTCGCATGTTGTGG
GGCTTCAAGCAGATCGACGACTTCACCAAGAATGCTCGGCCTGGTCATGGCAATTGTGCCATGGGTCCGAATGAG
CCCAACGAACCCAGCCAATCCAATATGAGTCCTCAAGACGCCGCTGGCCTCTGGAAACAATACCTAGAACCTCTT
CATGATAATGGATACACTCTGATTAGCCCTGCTTGTACGAATGCTCCTTCCGGCAAGACTTGGATGCAAGACTTC
TTCAAGGCCTGTGATGGCTGTCACGTCGATCGTCTGGCGGTACACTTCTACGGGACTGATGCGCAGGATCTTATT
GACTACGTCGAAGACATGCATGCCACCTTCGGCAAGCAGGTTTGGGTTACCGAGTTTGCCTGCCAAGACTTCTCT
GGTGGTCAACAAAGTAATCAGCAACAGGTCACTGAATTCATGCAGAAAGTTACTGCGTACATGGATCACACTGAT
AAAGTCGGCCAATACTTCGCGTTTGGTGCCTTGACAAACATGGGCAACGTGAACACGAAAAATCAGTTATTGAAT
CCTAGTGGCAGCGGACTCACGGCCCTTGGTAAACTCTATATCGGAGAGTAG
Transcript >AgabiH97|072090
ATGGCAGTCACCAAATTACTCAACCTCCTCGCCATTTCCTGCCTTGCCATCGTCGCATCTTTCGGCCCTGTCCCG
GTTTCAGCCCTCTCCGTTGAATCGGTCCACCATGCGCGTCGCGATCACCACGTTTTAGCTGCAAAGAAACGTGGT
AATTCTTCCAAGCGATGCAAGCCCCGTTCCACCACCCCTGCACCCAGCCCTTCCCCTACCACTTCGAAGAAGCCG
GCACCCAAGCCCACTTCGTCCAAAGATGTTGCTCCCCCTAGCCCAACCCCACCTAGTGGCGGTGGAGACAGTGGC
GCTCGCAAAGTCGGTATTGCTTTTACAGGGGGCGATGAGAGTGCTATCACACAATTCTGGTCCTGGAAAACTCAA
TTTTATTACACTTGGAGCCCCTGGTGCATTGATGCCGCTGACAAAGTCGGCTTCCAATGCTGTCGCATGTTGTGG
GGCTTCAAGCAGATCGACGACTTCACCAAGAATGCTCGGCCTGGTCATGGCAATTGTGCCATGGGTCCGAATGAG
CCCAACGAACCCAGCCAATCCAATATGAGTCCTCAAGACGCCGCTGGCCTCTGGAAACAATACCTAGAACCTCTT
CATGATAATGGATACACTCTGATTAGCCCTGCTTGTACGAATGCTCCTTCCGGCAAGACTTGGATGCAAGACTTC
TTCAAGGCCTGTGATGGCTGTCACGTCGATCGTCTGGCGGTACACTTCTACGGGACTGATGCGCAGGATCTTATT
GACTACGTCGAAGACATGCATGCCACCTTCGGCAAGCAGGTTTGGGTTACCGAGTTTGCCTGCCAAGACTTCTCT
GGTGGTCAACAAAGTAATCAGCAACAGGTCACTGAATTCATGCAGAAAGTTACTGCGTACATGGATCACACTGAT
AAAGTCGGCCAATACTTCGCGTTTGGTGCCTTGACAAACATGGGCAACGTGAACACGAAAAATCAGTTATTGAAT
CCTAGTGGCAGCGGACTCACGGCCCTTGGTAAACTCTATATCGGAGAGTAG
Gene >AgabiH97|072090
ATGGCAGTCACCAAATTACTCAACCTCCTCGCCATTTCCTGCCTTGCCATCGTCGCATCTTTCGGCCCTGTCCCG
GTTTCAGCCCTCTCCGTTGAATCGGTCCACCATGCGCGTCGCGATCACCACGTTTTAGCTGCAAAGAAACGTGGT
AATTCTTCCAAGCGATGCAAGCCCCGTTCCACCACCCCTGCACCCAGCCCTTCCCCTACCACTTCGAAGAAGCCG
GCACCCAAGCCCACTTCGTCCAAAGATGTTGCTCCCCCTAGCCCAACCCCACCTAGTGGCGGTGGAGACAGTGGC
GCTCGCAAAGTCGGTATTGCTTTTACAGGGGGCGATGAGAGTGCTATCACACAATTCTGGTCCTGGAAAACTCAA
TTGTAGGTGTTCCAAACTTTGATAGATGTGCTCGTCGAAGTCTTAACCTTGCTCTTCAGTTATTACACTTGGAGC
CCCTGGTGCATTGATGCCGCTGACAAAGTCGGCTTCCAATGCTGTCGCATGTTGTGGGGCTTCAAGCAGATCGAC
GACTTCACCAAGAATGCTCGGCCTGGTCATGGCAATTGTGCCATGGGTCCGAATGAGTATGTGTTGTGTTTTGAC
ACCTTGATCGAGTCTCATTGTATCTCGCAGGCCCAACGAACCCAGCCAATCCAATATGAGTCCTCAAGACGCCGC
TGGCCTCTGGAAACAATACCTAGAACCTCTTCATGATAATGGATACACTCTGATTAGCCCTGCTTGTACGAATGC
TCCTTCCGGCAAGACTTGGATGCAAGACTTCTTCAAGGCCTGTGATGGCTGTCACGTATGCTTTTTTTACATCCG
TCTCTTGCAAAATTCACTCAGAGACTGTTTTAACAGGTCGATCGTCTGGCGGTACACTTCTACGGGACTGATGCG
CAGGATCTTATTGACTACGTCGAAGACATGCATGCCACCTTCGGCAAGCAGGTTTGGGTTACCGAGTTTGCCTGC
CAAGACTTCTCTGGTGGTCAACAAAGTAATCAGCAACAGGTCACTGAATTCATGCAGAAAGTTACTGCGTACATG
GATCACACTGATAAAGTCGGCCAATACTTCGCGTTTGGTGAGTATAATTCTTGAACTAGAAAATAGCTACGGTTG
TTGACTTTTTTCTTCAGGTGCCTTGACAAACATGGGCAACGTGAACACGAAAAATCAGTTATTGAATCCTAGTGG
CAGCGGACTCACGGCCCTTGGTAAACTCTATATCGGAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail