Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071980
Gene name
Locationscaffold_4:1623903..1624978
Strand+
Gene length (bp)1075
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09335 SNARE_assoc SNARE associated Golgi protein 7.9E-11 104 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7EFY0|TVP38_SCLS1 Golgi apparatus membrane protein tvp38 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tvp38 PE=3 SV=1 50 254 3.0E-14
sp|A6RIB9|TVP38_BOTFB Golgi apparatus membrane protein tvp38 OS=Botryotinia fuckeliana (strain B05.10) GN=tvp38 PE=3 SV=1 53 267 4.0E-14
sp|Q2UUJ9|TVP38_ASPOR Golgi apparatus membrane protein tvp38 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tvp38 PE=3 SV=2 5 264 4.0E-13
sp|A2Q9P2|TVP38_ASPNC Golgi apparatus membrane protein tvp38 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tvp38 PE=3 SV=2 61 297 2.0E-12
sp|A8NX72|TVP38_COPC7 Golgi apparatus membrane protein TVP38 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TVP38 PE=3 SV=1 8 296 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7EFY0|TVP38_SCLS1 Golgi apparatus membrane protein tvp38 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tvp38 PE=3 SV=1 50 254 3.0E-14
sp|A6RIB9|TVP38_BOTFB Golgi apparatus membrane protein tvp38 OS=Botryotinia fuckeliana (strain B05.10) GN=tvp38 PE=3 SV=1 53 267 4.0E-14
sp|Q2UUJ9|TVP38_ASPOR Golgi apparatus membrane protein tvp38 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tvp38 PE=3 SV=2 5 264 4.0E-13
sp|A2Q9P2|TVP38_ASPNC Golgi apparatus membrane protein tvp38 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tvp38 PE=3 SV=2 61 297 2.0E-12
sp|A8NX72|TVP38_COPC7 Golgi apparatus membrane protein TVP38 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TVP38 PE=3 SV=1 8 296 3.0E-12
sp|B0Y4Q5|TVP38_ASPFC Golgi apparatus membrane protein tvp38 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tvp38 PE=3 SV=1 62 280 4.0E-12
sp|Q4WQJ2|TVP38_ASPFU Golgi apparatus membrane protein tvp38 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tvp38 PE=3 SV=1 62 280 4.0E-12
sp|Q6BQJ1|TVP38_DEBHA Golgi apparatus membrane protein TVP38 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TVP38 PE=3 SV=1 50 227 7.0E-12
sp|A1CIM4|TVP38_ASPCL Golgi apparatus membrane protein tvp38 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tvp38 PE=3 SV=1 56 223 7.0E-12
sp|A1CW44|TVP38_NEOFI Golgi apparatus membrane protein tvp38 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tvp38 PE=3 SV=1 63 280 2.0E-11
sp|A5DH87|TVP38_PICGU Golgi apparatus membrane protein TVP38 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TVP38 PE=3 SV=2 87 235 3.0E-11
sp|Q0CT01|TVP38_ASPTN Golgi apparatus membrane protein tvp38 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tvp38 PE=3 SV=1 50 244 8.0E-11
sp|Q5B7A1|TVP38_EMENI Golgi apparatus membrane protein tvp38 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tvp38 PE=3 SV=1 62 286 3.0E-10
sp|Q6FTI0|TVP38_CANGA Golgi apparatus membrane protein TVP38 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TVP38 PE=3 SV=1 47 263 5.0E-07
sp|P36164|TVP38_YEAST Golgi apparatus membrane protein TVP38 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TVP38 PE=1 SV=1 81 224 2.0E-06
sp|A7A047|TVP38_YEAS7 Golgi apparatus membrane protein TVP38 OS=Saccharomyces cerevisiae (strain YJM789) GN=TVP38 PE=3 SV=1 81 224 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 86 108 22
3 118 140 22
4 201 223 22
5 243 265 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071980
MDDLHAGSVDEKPGHPRPTLPPARAPANTPYTRPRSLRISKLARSWLPIILYAFTSIAFVVAFTLYKSELFQFLD
ELSFWLRSHEYGHAILFFLIFLTTIPPVPLYSTLITLSGYTFGTWTGAAISYFSALSGALFVFIVSRSLLRDSIT
GWLDYYPTIKRVVRAIEKRPKLLFLIRLAPYPYNVMNSLLAASPSLTLHTYTVCTALSLFKVIIHAGLGASIHSF
RDYHTQSDAEEDQGADMAARMWTAAGILLCILILVYLAIVARRAVDQELDDEPSEDTEEAVPVSLLGPPPSDDLE
MGRSMAESPFRTHHLISVEAPS*
Coding >AgabiH97|071980
ATGGACGATCTCCACGCTGGCTCTGTGGACGAAAAACCCGGCCACCCCCGCCCGACGCTCCCGCCCGCCCGCGCA
CCAGCAAACACCCCCTACACCCGCCCCCGCAGCCTGCGCATATCCAAGCTTGCCAGGTCTTGGTTGCCTATCATT
CTCTACGCTTTCACCAGCATCGCTTTCGTCGTCGCTTTCACGCTCTACAAGTCTGAGCTCTTCCAATTCCTCGAT
GAACTGTCTTTTTGGCTCCGATCACATGAATACGGCCATGCCATCCTCTTTTTCCTCATTTTCTTGACCACTATT
CCTCCCGTTCCCCTCTACTCTACACTCATTACATTATCAGGATATACCTTTGGTACTTGGACCGGCGCTGCCATC
TCTTATTTCTCCGCCCTTTCAGGCGCTCTCTTTGTATTCATAGTCTCCCGTTCTCTCCTTCGCGACTCTATTACC
GGATGGCTCGATTATTACCCAACCATCAAACGTGTCGTACGCGCCATCGAAAAGCGTCCCAAACTTCTCTTCCTT
ATCCGCCTCGCTCCTTATCCCTATAATGTCATGAATTCCCTCCTCGCTGCTTCTCCCAGCCTTACTCTTCATACT
TATACTGTTTGCACCGCACTCTCTTTATTCAAGGTCATCATCCATGCAGGCCTTGGCGCTTCTATACATTCTTTC
AGGGATTACCATACCCAGTCCGATGCCGAAGAGGATCAAGGCGCAGATATGGCTGCAAGAATGTGGACGGCCGCC
GGCATTCTTCTCTGTATCTTGATTCTCGTCTACCTCGCTATCGTCGCCCGAAGAGCCGTCGACCAAGAGCTTGAC
GATGAACCCAGTGAAGACACAGAAGAGGCTGTGCCTGTGTCGTTGTTGGGTCCCCCACCCTCCGATGATCTCGAG
ATGGGTCGCTCCATGGCAGAGTCGCCTTTCCGGACACATCATCTGATTTCTGTAGAGGCCCCCTCATGA
Transcript >AgabiH97|071980
ATGGACGATCTCCACGCTGGCTCTGTGGACGAAAAACCCGGCCACCCCCGCCCGACGCTCCCGCCCGCCCGCGCA
CCAGCAAACACCCCCTACACCCGCCCCCGCAGCCTGCGCATATCCAAGCTTGCCAGGTCTTGGTTGCCTATCATT
CTCTACGCTTTCACCAGCATCGCTTTCGTCGTCGCTTTCACGCTCTACAAGTCTGAGCTCTTCCAATTCCTCGAT
GAACTGTCTTTTTGGCTCCGATCACATGAATACGGCCATGCCATCCTCTTTTTCCTCATTTTCTTGACCACTATT
CCTCCCGTTCCCCTCTACTCTACACTCATTACATTATCAGGATATACCTTTGGTACTTGGACCGGCGCTGCCATC
TCTTATTTCTCCGCCCTTTCAGGCGCTCTCTTTGTATTCATAGTCTCCCGTTCTCTCCTTCGCGACTCTATTACC
GGATGGCTCGATTATTACCCAACCATCAAACGTGTCGTACGCGCCATCGAAAAGCGTCCCAAACTTCTCTTCCTT
ATCCGCCTCGCTCCTTATCCCTATAATGTCATGAATTCCCTCCTCGCTGCTTCTCCCAGCCTTACTCTTCATACT
TATACTGTTTGCACCGCACTCTCTTTATTCAAGGTCATCATCCATGCAGGCCTTGGCGCTTCTATACATTCTTTC
AGGGATTACCATACCCAGTCCGATGCCGAAGAGGATCAAGGCGCAGATATGGCTGCAAGAATGTGGACGGCCGCC
GGCATTCTTCTCTGTATCTTGATTCTCGTCTACCTCGCTATCGTCGCCCGAAGAGCCGTCGACCAAGAGCTTGAC
GATGAACCCAGTGAAGACACAGAAGAGGCTGTGCCTGTGTCGTTGTTGGGTCCCCCACCCTCCGATGATCTCGAG
ATGGGTCGCTCCATGGCAGAGTCGCCTTTCCGGACACATCATCTGATTTCTGTAGAGGCCCCCTCATGA
Gene >AgabiH97|071980
ATGGACGATCTCCACGCTGGCTCTGTGGACGAAAAACCCGGCCACCCCCGCCCGACGCTCCCGCCCGCCCGCGCA
CCAGCAAACACCCCCTACACCCGCCCCCGCAGCCTGCGCATATCCAAGCTTGCCAGGTCTTGGTTGCCTATCATT
CTCTACGCTTTCACCAGCATCGCTTTCGTCGTCGCTTTCACGCTCTACAAGTCTGAGCTCTTCCAATGTGCGTCC
CCACCTCTTTGCCGATCTCGCCTATCGCTCACTTTTTTTTTTCCAGTCCTCGATGAACTGTCTTTTTGGCTCCGA
TCACATGAATACGGCCATGCCATCCTCTTTTTCCTCATTTTCTTGACCACTATTCGTAAGCATTTCTTCTCTTCA
TTCATCCGGTCCACCAGCTAATCACCTTTTAGCTCCCGTTCCCCTCTACTCTACACTCATTACATTATCAGGATA
TACCTTTGGTACTTGGACCGGCGCTGCCATCTCTTATTTCTCCGCCCTTTCAGGCGCTCTCTTTGTATTCATAGT
CTCCCGTTCTCTCCTTCGCGACTCTATTACCGGATGGCTCGATTATTACCCAACCATCAAACGTGTCGTACGCGC
CATCGAAAAGCGTCCCAAACTTCTCTTCCTTATCCGCCTCGCTCCTTATCCCTATAATGTCATGAATTCCCTCCT
CGCTGCTTCTCCCAGCCTTACTCTTCATACTTATACTGTTTGCACCGCACTCTCTTTATTCAAGGTCATCATCCA
TGCAGGCCTTGGCGCTTCTATACATTCTTTCAGGGATTACCATACCCAGTCCGATGCCGAAGAGGATCAAGGCGC
AGATATGGCTGCAAGAATGTGGACGGCCGCCGGCATTCTTCTCTGTATCTTGATTCTCGTCTACCTCGCTATCGT
CGCCCGAAGAGCCGTCGACCAAGAGCTTGACGATGAACCCAGTGAAGACACAGAAGAGGCTGTGCCTGTGTCGTT
GTTGGGTCCCCCACCCTCCGATGATCTCGAGATGGGTCGCTCCATGGCAGAGTCGCCTTTCCGGACACATCATCT
GATTTCTGTAGAGGCCCCCTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail