Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071900
Gene name
Locationscaffold_4:1608499..1609238
Strand+
Gene length (bp)739
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01592 NifU_N NifU-like N terminal domain 3.8E-52 32 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CFQ0|ISU1_YARLI Iron sulfur cluster assembly protein 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ISU1 PE=3 SV=1 1 154 6.0E-72
sp|Q6CRQ9|ISU1_KLULA Iron sulfur cluster assembly protein 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ISU1 PE=3 SV=1 12 154 4.0E-68
sp|Q03020|ISU1_YEAST Iron sulfur cluster assembly protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU1 PE=1 SV=1 7 154 4.0E-68
sp|Q6BGU0|ISU1_DEBHA Iron sulfur cluster assembly protein 1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ISU1 PE=3 SV=1 14 156 1.0E-67
sp|Q9UTC6|ISU1_SCHPO Iron sulfur cluster assembly protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isu1 PE=1 SV=1 25 159 3.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CFQ0|ISU1_YARLI Iron sulfur cluster assembly protein 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ISU1 PE=3 SV=1 1 154 6.0E-72
sp|Q6CRQ9|ISU1_KLULA Iron sulfur cluster assembly protein 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ISU1 PE=3 SV=1 12 154 4.0E-68
sp|Q03020|ISU1_YEAST Iron sulfur cluster assembly protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU1 PE=1 SV=1 7 154 4.0E-68
sp|Q6BGU0|ISU1_DEBHA Iron sulfur cluster assembly protein 1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ISU1 PE=3 SV=1 14 156 1.0E-67
sp|Q9UTC6|ISU1_SCHPO Iron sulfur cluster assembly protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isu1 PE=1 SV=1 25 159 3.0E-66
sp|Q75C07|ISU1_ASHGO Iron sulfur cluster assembly protein 1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ISU1 PE=3 SV=1 15 154 2.0E-64
sp|Q12056|ISU2_YEAST Iron sulfur cluster assembly protein 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU2 PE=1 SV=1 32 154 8.0E-64
sp|Q57074|ISCU_HAEIN Iron-sulfur cluster assembly scaffold protein IscU OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=iscU PE=1 SV=2 32 154 1.0E-63
sp|Q6FJY3|ISU1_CANGA Iron sulfur cluster assembly protein 1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ISU1 PE=3 SV=1 32 154 1.0E-63
sp|Q9D7P6|ISCU_MOUSE Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Mus musculus GN=Iscu PE=1 SV=1 2 154 4.0E-62
sp|Q9H1K1|ISCU_HUMAN Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Homo sapiens GN=ISCU PE=1 SV=2 2 154 6.0E-62
sp|P0ACD7|ISCU_SHIFL Iron-sulfur cluster assembly scaffold protein IscU OS=Shigella flexneri GN=iscU PE=3 SV=1 32 154 7.0E-62
sp|P0ACD6|ISCU_ECO57 Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli O157:H7 GN=iscU PE=1 SV=1 32 154 7.0E-62
sp|P0ACD5|ISCU_ECOL6 Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=iscU PE=3 SV=1 32 154 7.0E-62
sp|P0ACD4|ISCU_ECOLI Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli (strain K12) GN=iscU PE=1 SV=1 32 154 7.0E-62
sp|Q9ZD61|ISCU_RICPR Iron-sulfur cluster assembly scaffold protein IscU OS=Rickettsia prowazekii (strain Madrid E) GN=iscU PE=3 SV=1 32 154 1.0E-61
sp|O49627|ISU1_ARATH Iron-sulfur cluster assembly protein 1 OS=Arabidopsis thaliana GN=ISU1 PE=2 SV=1 32 154 3.0E-60
sp|O31270|ISCU_AZOVI Iron-sulfur cluster assembly scaffold protein IscU OS=Azotobacter vinelandii GN=iscU PE=1 SV=1 32 154 1.0E-58
sp|O81433|ISU3_ARATH Iron-sulfur cluster assembly protein 3 OS=Arabidopsis thaliana GN=ISU3 PE=2 SV=1 1 170 4.0E-57
sp|O51885|ISCU_BUCAP Iron-sulfur cluster assembly scaffold protein IscU OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=iscU PE=3 SV=1 32 154 4.0E-56
sp|Q89A18|ISCU_BUCBP Iron-sulfur cluster assembly scaffold protein IscU OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nifU PE=3 SV=1 32 154 5.0E-56
sp|B0YLW7|ISU1_TRAHO Iron sulfur cluster assembly protein 1 OS=Trachipleistophora hominis GN=ISU1 PE=3 SV=1 32 154 3.0E-55
sp|P57658|ISCU_BUCAI Iron-sulfur cluster assembly scaffold protein IscU OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=iscU PE=3 SV=1 32 155 4.0E-55
sp|Q9MAB6|ISU2_ARATH Iron-sulfur cluster assembly protein 2 OS=Arabidopsis thaliana GN=ISU2 PE=2 SV=1 32 154 2.0E-54
sp|Q8SSM2|ISU1_ENCCU Iron sulfur cluster assembly protein 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ISU1 PE=3 SV=1 32 154 8.0E-52
sp|P0DMG2|ISCU2_ARCFU Iron-sulfur cluster assembly scaffold protein IscU 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscU2 PE=1 SV=1 32 153 2.0E-30
sp|P0DMG1|ISCU1_ARCFU Iron-sulfur cluster assembly scaffold protein IscU 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=iscU1 PE=3 SV=1 32 153 2.0E-30
sp|O67045|ISCU_AQUAE Iron-sulfur cluster assembly scaffold protein IscU OS=Aquifex aeolicus (strain VF5) GN=iscU PE=1 SV=1 32 154 7.0E-30
sp|P05340|NIFU_AZOVI Nitrogen fixation protein NifU OS=Azotobacter vinelandii GN=nifU PE=3 SV=2 32 157 1.0E-29
sp|P05343|NIFU_KLEPN Nitrogen fixation protein NifU OS=Klebsiella pneumoniae GN=nifU PE=3 SV=2 32 155 2.0E-27
sp|P20628|NIFU_NOSS1 Nitrogen fixation protein NifU OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nifU PE=3 SV=1 32 151 3.0E-27
sp|Q43885|NIFU_TRIAZ Nitrogen fixation protein NifU OS=Trichormus azollae GN=nifU PE=3 SV=1 32 151 7.0E-27
sp|P23121|NIFU_AZOCH Nitrogen fixation protein NifU OS=Azotobacter chroococcum mcd 1 GN=nifU PE=3 SV=1 32 155 6.0E-26
sp|Q43909|NIFU_AZOBR Nitrogen fixation protein NifU OS=Azospirillum brasilense GN=nifU PE=3 SV=2 32 157 3.0E-21
sp|Q1AWB1|MNMA_RUBXD Bifunctional protein NifU/MnmA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=nifU/mnmA PE=3 SV=1 32 154 1.0E-15
sp|O32163|SUFU_BACSU Zinc-dependent sulfurtransferase SufU OS=Bacillus subtilis (strain 168) GN=sufU PE=1 SV=1 32 147 5.0E-10
sp|Q9X192|ISCU_THEMA Iron-sulfur cluster assembly scaffold protein IscU OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=iscU PE=3 SV=1 65 148 2.0E-07
sp|Q9A1G2|ISCU_STRP1 Iron-sulfur cluster assembly scaffold protein IscU OS=Streptococcus pyogenes serotype M1 GN=iscU PE=1 SV=1 32 163 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016226 iron-sulfur cluster assembly Yes
GO:0005506 iron ion binding Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0008150 biological_process No
GO:0031163 metallo-sulfur cluster assembly No
GO:0006790 sulfur compound metabolic process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0051540 metal cluster binding No
GO:0071840 cellular component organization or biogenesis No
GO:0022607 cellular component assembly No
GO:0008152 metabolic process No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0016043 cellular component organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071900
MFRAAISRPLFAAARPTARRVSARPPVTACYYHEKVISHYEKPRNVGSLPKNDTDVGTGLVGAPACGDVMKLQIR
VDDNGIISDVKFKTFGCGSAIASSSYMTERVKGLSLDDAGKIKNTEIAKELCLPPVKLHCSMLAEDAIRSAIRDY
RSKRFIDVAAGKDASSLPASA*
Coding >AgabiH97|071900
ATGTTTCGCGCTGCAATCTCACGTCCTCTCTTCGCTGCTGCTCGCCCGACGGCCCGACGTGTCTCTGCGAGACCG
CCTGTTACTGCTTGCTATTATCACGAGAAAGTGATTTCTCATTATGAGAAACCTCGAAATGTGGGATCTCTCCCC
AAGAATGACACTGATGTTGGCACAGGCCTTGTCGGGGCACCTGCCTGCGGTGATGTCATGAAACTCCAGATCCGT
GTGGACGACAACGGAATTATTTCAGACGTCAAGTTTAAGACGTTTGGTTGCGGAAGTGCTATCGCGTCAAGTTCA
TATATGACCGAGCGCGTCAAAGGTTTAAGCCTGGATGACGCAGGCAAAATCAAAAACACCGAAATTGCAAAGGAG
CTCTGTCTACCTCCTGTGAAGCTACACTGTTCAATGTTGGCAGAAGACGCCATTCGATCGGCTATCCGAGACTAT
CGGTCTAAACGTTTCATTGACGTTGCGGCAGGAAAGGATGCTTCGTCACTGCCGGCATCGGCTTGA
Transcript >AgabiH97|071900
ATGTTTCGCGCTGCAATCTCACGTCCTCTCTTCGCTGCTGCTCGCCCGACGGCCCGACGTGTCTCTGCGAGACCG
CCTGTTACTGCTTGCTATTATCACGAGAAAGTGATTTCTCATTATGAGAAACCTCGAAATGTGGGATCTCTCCCC
AAGAATGACACTGATGTTGGCACAGGCCTTGTCGGGGCACCTGCCTGCGGTGATGTCATGAAACTCCAGATCCGT
GTGGACGACAACGGAATTATTTCAGACGTCAAGTTTAAGACGTTTGGTTGCGGAAGTGCTATCGCGTCAAGTTCA
TATATGACCGAGCGCGTCAAAGGTTTAAGCCTGGATGACGCAGGCAAAATCAAAAACACCGAAATTGCAAAGGAG
CTCTGTCTACCTCCTGTGAAGCTACACTGTTCAATGTTGGCAGAAGACGCCATTCGATCGGCTATCCGAGACTAT
CGGTCTAAACGTTTCATTGACGTTGCGGCAGGAAAGGATGCTTCGTCACTGCCGGCATCGGCTTGA
Gene >AgabiH97|071900
ATGTTTCGCGCTGCAATCTCACGTCCTCTCTTCGCTGCTGCTCGCCCGACGGCCCGACGTGTCTCTGCGAGACCG
CCTGTTACTGCTTGCTATTATCACGAGAAAGTGATTTCTCATTATGAGAAACCTCGAAATGTGGGCTCTAAAACT
GGTCATCTATGAAACCCCCTTATCTGATATGCGATTCTCAACCTTTTAAGGTGGGATCTCTCCCCAAGAATGACA
CTGATGTTGGCACAGGCCTTGTCGGGGCACCTGCGTAAGTTTTCTCACTGAGCTGCGTTGCGTCTGTGCAAGCCT
GACCACCGGCGCTTTAGCTGCGGTGATGTCATGAAACTCCAGATCCGTGTGGACGACAACGGAATTATTTCAGAC
GTCAAGTTTAAGACGTTTGGTTGCGGAAGTGCTATCGCGTCAAGTTCATATATGACCGAGCGCGTCAAAGGTTTA
AGCCTGGATGACGCAGGCAAAATCAAAAACACCGAAATTGCAAAGGAGCTCTGTCTACCTCCTGTGAAGCTACAC
TGTTCAAGTACGTGATCTCGCCAACCGCTTTTCATGCCTTGTTTCTGACTATGACACAGTGTTGGCAGAAGACGC
CATTCGATCGGCTATCCGAGACTATCGGTCTAAACGTCAGAAGCTAGCCCAGTCATCCGACCTAGCTAAAACAAA
TCCAACAGGTTTCATTGACGTTGCGGCAGGAAAGGATGCTTCGTCACTGCCGGCATCGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail