Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071840
Gene name
Locationscaffold_4:1598419..1601083
Strand-
Gene length (bp)2664
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-31 77 443

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 7 525 7.0E-89
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 20 525 1.0E-75
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 57 527 7.0E-74
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 1 527 1.0E-73
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 33 525 2.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 7 525 7.0E-89
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 20 525 1.0E-75
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 57 527 7.0E-74
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 1 527 1.0E-73
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 33 525 2.0E-71
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 39 525 4.0E-66
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 7 525 2.0E-64
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 51 525 1.0E-56
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 69 525 1.0E-50
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 21 525 2.0E-42
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 4 527 6.0E-39
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 38 527 7.0E-34
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 49 525 3.0E-33
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 54 500 2.0E-32
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 54 499 3.0E-20
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 70 308 6.0E-14
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 51 362 7.0E-14
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 46 362 9.0E-13
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 44 266 2.0E-12
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 61 486 1.0E-10
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 71 273 5.0E-08
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 70 300 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 108 125 17
3 138 157 19
4 162 184 22
5 197 219 22
6 229 251 22
7 297 319 22
8 334 356 22
9 363 385 22
10 391 413 22
11 425 447 22
12 457 479 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071840
MAAQPLDIKYDEPEAKDVRSLQSGSILDYAAQHKGIDAEVAEFLAQSSNVESRTIDEATNKRLRWLIHKRILLVM
VVTYFAQTLDKGTINFASIMGILEDTNLKGQEYAWLTTCVYIAILAWEFPTNRLIQRLPIAKYLGFSVMAWGAVL
ACTAACKNFVGLIIVRTLLGIFECVCQPAFVFLSTMWYTRDEQALVIGSFYSMNGFQQCVGGLLAYGIAHIKDAA
IKNWQVLFTLYGCVTFVWGLFILYWMPDSPMHAKCFSLEDRLLMAERVRKNETGIQNKTFKMYQVVEAILDPAVW
AVTMISFTNALPTGGLGAFSNLIIKAFGYTVLQTYLLAIAQGVIIMVFLFSAAGLSRRYGQRLVFAFIYTLPNVA
GTIVFLAVPTTPHTKVGLLLAFYCMQGFGAVAVLNLAIMSGNVAGRTKQVIASSLVFIAWAVGNAIGPQVFRDND
GPRYVKAFVVHIVVYGVQMVTIVLLRLYLMRRNALKRRAQAITPGETSNEDTGENLTHKHAFDDLTDKENPDFRY
VY*
Coding >AgabiH97|071840
ATGGCCGCTCAACCTTTGGACATAAAATACGACGAGCCCGAGGCAAAGGACGTTCGTTCTCTCCAAAGCGGCTCT
ATATTAGACTATGCAGCTCAACATAAGGGTATTGACGCAGAGGTCGCTGAATTCTTAGCCCAATCGTCCAATGTA
GAGTCGAGGACCATCGATGAAGCAACTAATAAACGACTTCGATGGTTGATACATAAACGTATACTGCTCGTCATG
GTTGTTACATACTTTGCCCAAACTTTGGATAAAGGGACTATAAACTTTGCATCCATCATGGGGATACTCGAGGAT
ACGAATCTGAAGGGCCAAGAATATGCGTGGCTGACAACTTGCGTCTATATTGCTATCTTGGCTTGGGAGTTCCCA
ACCAATAGATTGATACAACGGTTGCCGATTGCGAAATACCTAGGTTTCAGCGTTATGGCCTGGGGTGCTGTTCTA
GCATGTACAGCAGCATGTAAGAACTTTGTCGGCCTTATCATAGTCCGCACTCTACTTGGCATCTTCGAGTGTGTT
TGTCAACCAGCATTTGTCTTCTTGTCAACGATGTGGTATACGAGAGACGAACAGGCGCTTGTCATTGGATCTTTT
TACTCTATGAATGGGTTCCAGCAATGCGTGGGGGGTCTCCTAGCATATGGAATCGCTCATATCAAAGATGCGGCG
ATTAAGAATTGGCAGGTTCTTTTCACTCTCTACGGTTGTGTTACTTTCGTCTGGGGCCTTTTTATCTTGTATTGG
ATGCCCGATAGTCCAATGCATGCCAAATGTTTTTCACTCGAAGACCGGCTGCTTATGGCAGAGAGAGTTCGAAAG
AATGAAACCGGTATTCAGAACAAGACTTTTAAGATGTACCAAGTCGTGGAGGCTATACTGGATCCAGCCGTCTGG
GCAGTCACCATGATATCTTTTACGAATGCACTTCCAACAGGAGGTTTAGGTGCATTCTCAAACCTCATCATTAAA
GCTTTTGGTTATACGGTTCTGCAAACTTATCTACTTGCTATCGCCCAAGGTGTTATTATCATGGTTTTCCTTTTC
TCTGCCGCGGGTCTGTCTAGACGATATGGTCAAAGATTGGTATTCGCTTTTATATATACGCTGCCAAATGTTGCA
GGAACCATCGTGTTCCTTGCCGTCCCAACAACCCCACATACCAAAGTTGGTCTTCTTCTGGCCTTTTATTGTATG
CAAGGCTTTGGTGCTGTCGCTGTCCTCAACCTTGCGATCATGTCAGGAAATGTTGCAGGCAGGACCAAACAGGTC
ATTGCATCCAGTCTTGTCTTCATTGCTTGGGCTGTCGGTAATGCCATCGGACCCCAAGTATTCAGGGACAACGAT
GGACCACGATATGTTAAGGCTTTCGTCGTCCACATTGTTGTATATGGCGTCCAGATGGTCACTATTGTCCTTTTG
CGGCTTTACTTGATGAGACGAAATGCTCTGAAGCGACGCGCTCAAGCTATAACACCCGGCGAAACCAGCAATGAA
GACACCGGCGAGAACCTCACACATAAGCATGCCTTTGACGATTTGACCGACAAAGAAAACCCAGACTTCCGATAC
GTATATTAA
Transcript >AgabiH97|071840
ATGGCCGCTCAACCTTTGGACATAAAATACGACGAGCCCGAGGCAAAGGACGTTCGTTCTCTCCAAAGCGGCTCT
ATATTAGACTATGCAGCTCAACATAAGGGTATTGACGCAGAGGTCGCTGAATTCTTAGCCCAATCGTCCAATGTA
GAGTCGAGGACCATCGATGAAGCAACTAATAAACGACTTCGATGGTTGATACATAAACGTATACTGCTCGTCATG
GTTGTTACATACTTTGCCCAAACTTTGGATAAAGGGACTATAAACTTTGCATCCATCATGGGGATACTCGAGGAT
ACGAATCTGAAGGGCCAAGAATATGCGTGGCTGACAACTTGCGTCTATATTGCTATCTTGGCTTGGGAGTTCCCA
ACCAATAGATTGATACAACGGTTGCCGATTGCGAAATACCTAGGTTTCAGCGTTATGGCCTGGGGTGCTGTTCTA
GCATGTACAGCAGCATGTAAGAACTTTGTCGGCCTTATCATAGTCCGCACTCTACTTGGCATCTTCGAGTGTGTT
TGTCAACCAGCATTTGTCTTCTTGTCAACGATGTGGTATACGAGAGACGAACAGGCGCTTGTCATTGGATCTTTT
TACTCTATGAATGGGTTCCAGCAATGCGTGGGGGGTCTCCTAGCATATGGAATCGCTCATATCAAAGATGCGGCG
ATTAAGAATTGGCAGGTTCTTTTCACTCTCTACGGTTGTGTTACTTTCGTCTGGGGCCTTTTTATCTTGTATTGG
ATGCCCGATAGTCCAATGCATGCCAAATGTTTTTCACTCGAAGACCGGCTGCTTATGGCAGAGAGAGTTCGAAAG
AATGAAACCGGTATTCAGAACAAGACTTTTAAGATGTACCAAGTCGTGGAGGCTATACTGGATCCAGCCGTCTGG
GCAGTCACCATGATATCTTTTACGAATGCACTTCCAACAGGAGGTTTAGGTGCATTCTCAAACCTCATCATTAAA
GCTTTTGGTTATACGGTTCTGCAAACTTATCTACTTGCTATCGCCCAAGGTGTTATTATCATGGTTTTCCTTTTC
TCTGCCGCGGGTCTGTCTAGACGATATGGTCAAAGATTGGTATTCGCTTTTATATATACGCTGCCAAATGTTGCA
GGAACCATCGTGTTCCTTGCCGTCCCAACAACCCCACATACCAAAGTTGGTCTTCTTCTGGCCTTTTATTGTATG
CAAGGCTTTGGTGCTGTCGCTGTCCTCAACCTTGCGATCATGTCAGGAAATGTTGCAGGCAGGACCAAACAGGTC
ATTGCATCCAGTCTTGTCTTCATTGCTTGGGCTGTCGGTAATGCCATCGGACCCCAAGTATTCAGGGACAACGAT
GGACCACGATATGTTAAGGCTTTCGTCGTCCACATTGTTGTATATGGCGTCCAGATGGTCACTATTGTCCTTTTG
CGGCTTTACTTGATGAGACGAAATGCTCTGAAGCGACGCGCTCAAGCTATAACACCCGGCGAAACCAGCAATGAA
GACACCGGCGAGAACCTCACACATAAGCATGCCTTTGACGATTTGACCGACAAAGAAAACCCAGACTTCCGATAC
GTATATTAA
Gene >AgabiH97|071840
ATGGCCGCTCAACCTTTGGACATAAAATACGACGAGCCCGAGGCAAAGGACGTTCGTTCTCTCCAAAGCGGCTCT
ATATTAGACTATGCAGGTATTCAAGCCAAAAATGTCTTGACGTTATAGAGGAATCTTACCTGGCTTTCTTAGCTC
AACATAAGGGTATTGACGCAGAGGTCGCTGAATTCTTAGCCCAATCGTCCAATGTAGAGTCGAGGACCATCGATG
AAGCAACTAATAAACGACTTCGATGGTTGATACATAAACGTATACTGGTCTGTTGCGTCTCATCCGAGTCGTCGT
CTCAAAGATACATGGCTCATCTATTCTACTAAGCTCGTCATGGTTGTTACATACTGTCAGTGGATTTATTTAGCT
TTAAAGTTCGTCCTAACGTCCTTCTAGTTGCCCAAACTTTGGATAAAGGGTATTTTCAAATTATTATTGTCTTGC
GGTGACATGCTCAGCCATCGACGTAGGACTATAAACTTTGCATCCATCATGGGGATACTCGAGGATACGAATCTG
AAGGGCCAAGAATATGCGTGGCTGACAACTTGCGGTAAGTCAAATATATTCCGCCCGTTCCCTCCTGATGTTCAA
ACCTTTCTGTAGTCTATATTGCTATGTAGGTTCACTCGCTTCGAAAAGGTAGTAATGTTGACCCTCACTGAACGA
TTTGTAGCTTGGCTTGGGAGTTCCCAACCAATAGATTGATACAACGGTTGCCGATTGCGAAATACCTAGGTTTCA
GGTGAGTCTGGTTATTTGTTTTCCCGGGAGCACTCAAATAACTCTATGCAGCGTTATGGCCTGGGGTGCTGTTCT
AGCATGTACAGCAGCATGTAAGAACTTTGTCGGCCTTATCATAGTCCGCACTCTACTTGGCATCTTCGAGTGTGT
TTGTCAACCAGCATTTGTCTTCTTGTACGTATGAGTCAATTTAGCTCGAGGGCGACCCCAGTGACAGTCATTACA
GGTCAACGATGTGGTATACGAGAGACGAACAGGCGCTTGTCATTGGATCTTTTTACTCTATGAATGGGTTCCAGC
AATGCGTGGGGGGTCTCCTAGCATATGGAATCGCTCATATCAAAGATGCGGCGATTAAGAATTGGCAGGTTCTTT
TCACTGTGTGTATTTTCCCGCAAGTTCTTGGTGTGGCTGCTCAGGCGCTCAACGTCCACAGCTCTACGGTTGTGT
TACTTTCGTCTGGGGCCTTTTTATCTTGTATTGGATGCCCGATAGTCCAATGCATGCCAAATGTTTTTCACTCGA
AGACCGGCTGCTTATGGCAGAGAGAGTTCGAAAGAATGAAACCGGTATTCAGAACAAGACTTTTAAGGTGTGGTC
CTCTCATCAATGCATAAATGCAGTAAGGAAAAACTCATACGGCGTTGTCTGCAGATGTACCAAGTCGGTGAGTTT
ATATCAACAAAGTGCAACGTCATTGAGGTCTAATTGAGCTGTAGTGGAGGCTATACTGGATCCAGCCGTCTGGGC
AGTCACCATGATATCTTTTACGAATGCACTTCCAACAGGAGGTTTAGGTGCATTCTCAAACCTCATCATTAAAGC
TTTTGTGGGTGTGGCTTTCTAGTTCAGTCGTACAAAGAAATCTAAATGCATTTAAGGGTTATACGGTTCTGCAAA
CTTATCTACTTGCTATCGCCCAAGGTGAGATAAAAATTTATTGTCATTGGTATAAGAATTAATCACTTTTCTGTC
ATTTGTGAAACAGGTGTTATTATCATGGTTTTCCTTTTCTCTGCCGCGGGTCTGTCTAGACGATATGGTCAAAGA
TTGGTATTCGCTTTTGTAAGTGTGGGGTATTCAACAAAGGTTGTAGCAGTGCTGAAGAGTTCCACCTACCAGATA
TATACGCTGCCAAATGTTGCAGGAACCATCGTGTTCCTTGCCGTCCCAACAACCCCACATACCAAAGTTGGTCTT
CTTCTGGCCTTTTAGTAAGTCACATAAACTAGAACGTATCGTCGGCCTAGCTGAATGAATATCGTAGTTGTATGC
AAGGCTTTGGTGCTGTCGCTGTCCTCAACCTTGCGATCATGTCAGGAAATGTTGCAGGCGTACGTAAATGGTTCC
TTCAAAACAAAACTATCTCTCAGCCGTTATCAACAGAGGACCAAACAGGTCATTGCATCCAGTCTTGTCTTCATG
TAAGTGTTCTTGTCAAAAATTTCAGGACGTGTATTGAATGTGTACAGTGCTTGGGCTGTCGGTAATGCCATCGGA
CCCCAAGGTAGATTCCGAGTGACATAAACATGCGAACAACATTACTGATACTTGTGCAGTATTCAGGGACAACGA
TGGACCACGATATGTTAAGGCTTTCGTCGTCCACATTGTTGTATATGGCGTCCAGATGGTCACTATTGTCCTTTT
GCGGCTTTACTTGATGAGACGAAATGCTCTGAAGCGACGCGCTCAAGCTATAACACCCGGCGAAACCAGCAATGA
AGACACCGTGGGTAACGTCAGTTTTTCATGTTAATCCTGTTCTAATATTGTGAAATGCAGGGCGAGAACCTCACA
CATAAGCATGCCTTTGACGATTTGACCGACAAAGAAAACCCAGACTGTAAGCATAGCTATTTCAATTACAAACAC
TAATTGACTAGGACGATGTTAGTCCGATACGTATATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail