Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071780
Gene name
Locationscaffold_4:1588970..1590512
Strand-
Gene length (bp)1542
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 1.9E-16 7 137
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 4.5E-07 150 424

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39353|YJHC_ECOLI Uncharacterized oxidoreductase YjhC OS=Escherichia coli (strain K12) GN=yjhC PE=3 SV=2 5 224 9.0E-12
sp|Q2I8V6|AFR_ENSAD 1,5-anhydro-D-fructose reductase OS=Ensifer adhaerens GN=afr PE=1 SV=1 75 204 2.0E-08
sp|Q6M0B9|UGNO_METMP UDP-N-acetylglucosamine 3-dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0352 PE=1 SV=1 5 210 3.0E-08
sp|A7ZAH5|IOLG_BACMF Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=iolG PE=3 SV=1 5 204 6.0E-08
sp|O34371|YTET_BACSU Putative oxidoreductase YteT OS=Bacillus subtilis (strain 168) GN=yteT PE=2 SV=1 81 383 7.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39353|YJHC_ECOLI Uncharacterized oxidoreductase YjhC OS=Escherichia coli (strain K12) GN=yjhC PE=3 SV=2 5 224 9.0E-12
sp|Q2I8V6|AFR_ENSAD 1,5-anhydro-D-fructose reductase OS=Ensifer adhaerens GN=afr PE=1 SV=1 75 204 2.0E-08
sp|Q6M0B9|UGNO_METMP UDP-N-acetylglucosamine 3-dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0352 PE=1 SV=1 5 210 3.0E-08
sp|A7ZAH5|IOLG_BACMF Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=iolG PE=3 SV=1 5 204 6.0E-08
sp|O34371|YTET_BACSU Putative oxidoreductase YteT OS=Bacillus subtilis (strain 168) GN=yteT PE=2 SV=1 81 383 7.0E-08
sp|Q54728|Y1686_STRPN Uncharacterized oxidoreductase SP_1686 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_1686 PE=3 SV=2 53 161 1.0E-07
sp|O07564|NTDC_BACSU Glucose-6-phosphate 3-dehydrogenase OS=Bacillus subtilis (strain 168) GN=ntdC PE=1 SV=2 80 210 8.0E-07
sp|A9BZG3|IOLG_DELAS Inositol 2-dehydrogenase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=iolG PE=3 SV=1 5 168 2.0E-06
sp|B2VJP4|IOLG_ERWT9 Inositol 2-dehydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=iolG PE=3 SV=1 5 159 4.0E-06
sp|A1JSK7|IOLG_YERE8 Inositol 2-dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=iolG PE=3 SV=1 5 204 7.0E-06
sp|A6THJ2|IOLG_KLEP7 Inositol 2-dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=iolG PE=3 SV=2 5 158 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071780
MPEPLTLAIVGCGQRGKSYAEYALQNPRDCKVVAIAEPRPGAQRYFTDRHHIDPSLVFTTWQDLHAASAETITTV
GRRLADAVIIAVQDQMHPEVTLAFAEQGYHILCEKPMAITPQGCILMERAVKKANIIFGMGHVLRYTKYFQAISE
IIQNKSLGELVNINHVEPVGHFHFAHSYVRGNWNTEEASSFALMTKCCHDIDLICHFFSSTTPSRVSSFGSLTHF
RRSKKPREAGDVKRCLECPLQYDGGCPYSATTIYLDSLKSGNRSWPVSVLVDDIPDIENITEALKTGPYGVCVYE
SPNDVCDHQVVNFEFANGTTASLTMVAFSSAICERQTRMHFSHGEIIGDMNTFTVKDFRTGVLREHSFPHAGGHG
GGDIGLMETFVKAVKERNQELLGTSIDEVVKTHMTVFAAEASRKEGRVIDCAEYEKAVKEDFEKNKLV*
Coding >AgabiH97|071780
ATGCCAGAGCCACTTACCCTCGCCATCGTCGGCTGCGGCCAGCGTGGAAAGAGTTATGCCGAGTACGCTCTTCAG
AACCCACGCGACTGCAAGGTCGTGGCCATAGCCGAGCCAAGGCCCGGGGCTCAGCGCTACTTTACCGATCGTCAT
CACATCGACCCCTCTCTCGTATTCACCACCTGGCAGGACCTCCATGCTGCTTCTGCTGAAACTATCACCACCGTT
GGCAGACGACTAGCTGATGCTGTTATCATTGCTGTACAAGATCAAATGCATCCAGAGGTTACCCTAGCCTTTGCT
GAACAAGGCTACCATATTCTCTGCGAGAAACCCATGGCGATCACTCCTCAAGGATGCATTCTCATGGAACGAGCA
GTCAAGAAGGCCAACATCATTTTTGGCATGGGCCATGTACTACGATACACCAAGTATTTCCAGGCGATTTCTGAG
ATCATTCAAAACAAATCTCTGGGTGAACTTGTGAACATCAATCACGTAGAACCAGTGGGTCATTTCCACTTTGCG
CATTCATACGTGCGCGGAAACTGGAACACCGAAGAGGCGAGTTCCTTCGCATTAATGACGAAGTGCTGCCACGAC
ATCGATCTAATTTGCCACTTCTTCTCGTCAACTACTCCTTCTCGAGTTTCGTCGTTTGGCTCTCTCACCCACTTC
CGCCGCTCAAAGAAACCTCGCGAGGCTGGCGATGTCAAACGTTGTCTTGAATGCCCTTTACAATATGACGGTGGC
TGCCCTTACAGCGCAACAACGATTTATCTCGACTCTCTCAAGTCAGGTAATAGGAGTTGGCCAGTCAGCGTACTC
GTGGATGACATTCCCGACATTGAAAACATTACGGAGGCCCTGAAAACAGGACCATACGGTGTGTGCGTGTATGAA
AGCCCAAACGACGTTTGCGATCATCAAGTGGTCAACTTTGAGTTTGCCAATGGTACCACAGCCTCTCTCACAATG
GTTGCCTTTAGCTCGGCCATCTGTGAGCGTCAAACTCGCATGCACTTTTCGCATGGTGAAATCATTGGAGACATG
AATACGTTCACTGTCAAAGATTTCAGAACGGGTGTGTTGAGGGAACATTCTTTCCCCCATGCTGGTGGCCATGGA
GGTGGCGACATTGGTTTGATGGAAACATTTGTCAAGGCGGTCAAAGAGCGTAATCAGGAATTGCTAGGGACATCG
ATTGATGAAGTGGTCAAGACCCATATGACTGTCTTTGCTGCTGAAGCAAGTCGGAAGGAAGGAAGAGTAATTGAC
TGTGCCGAATATGAAAAAGCAGTCAAAGAGGACTTTGAAAAGAATAAATTGGTTTGA
Transcript >AgabiH97|071780
ATGCCAGAGCCACTTACCCTCGCCATCGTCGGCTGCGGCCAGCGTGGAAAGAGTTATGCCGAGTACGCTCTTCAG
AACCCACGCGACTGCAAGGTCGTGGCCATAGCCGAGCCAAGGCCCGGGGCTCAGCGCTACTTTACCGATCGTCAT
CACATCGACCCCTCTCTCGTATTCACCACCTGGCAGGACCTCCATGCTGCTTCTGCTGAAACTATCACCACCGTT
GGCAGACGACTAGCTGATGCTGTTATCATTGCTGTACAAGATCAAATGCATCCAGAGGTTACCCTAGCCTTTGCT
GAACAAGGCTACCATATTCTCTGCGAGAAACCCATGGCGATCACTCCTCAAGGATGCATTCTCATGGAACGAGCA
GTCAAGAAGGCCAACATCATTTTTGGCATGGGCCATGTACTACGATACACCAAGTATTTCCAGGCGATTTCTGAG
ATCATTCAAAACAAATCTCTGGGTGAACTTGTGAACATCAATCACGTAGAACCAGTGGGTCATTTCCACTTTGCG
CATTCATACGTGCGCGGAAACTGGAACACCGAAGAGGCGAGTTCCTTCGCATTAATGACGAAGTGCTGCCACGAC
ATCGATCTAATTTGCCACTTCTTCTCGTCAACTACTCCTTCTCGAGTTTCGTCGTTTGGCTCTCTCACCCACTTC
CGCCGCTCAAAGAAACCTCGCGAGGCTGGCGATGTCAAACGTTGTCTTGAATGCCCTTTACAATATGACGGTGGC
TGCCCTTACAGCGCAACAACGATTTATCTCGACTCTCTCAAGTCAGGTAATAGGAGTTGGCCAGTCAGCGTACTC
GTGGATGACATTCCCGACATTGAAAACATTACGGAGGCCCTGAAAACAGGACCATACGGTGTGTGCGTGTATGAA
AGCCCAAACGACGTTTGCGATCATCAAGTGGTCAACTTTGAGTTTGCCAATGGTACCACAGCCTCTCTCACAATG
GTTGCCTTTAGCTCGGCCATCTGTGAGCGTCAAACTCGCATGCACTTTTCGCATGGTGAAATCATTGGAGACATG
AATACGTTCACTGTCAAAGATTTCAGAACGGGTGTGTTGAGGGAACATTCTTTCCCCCATGCTGGTGGCCATGGA
GGTGGCGACATTGGTTTGATGGAAACATTTGTCAAGGCGGTCAAAGAGCGTAATCAGGAATTGCTAGGGACATCG
ATTGATGAAGTGGTCAAGACCCATATGACTGTCTTTGCTGCTGAAGCAAGTCGGAAGGAAGGAAGAGTAATTGAC
TGTGCCGAATATGAAAAAGCAGTCAAAGAGGACTTTGAAAAGAATAAATTGGTTTGA
Gene >AgabiH97|071780
ATGCCAGAGCCACTTACCCTCGCCATCGTCGGCTGCGGCCAGCGTGGAAAGGTATATCTGCCGCTACGTCCCCTG
GTCGACACTCATCCTCTTCCCGTCGCAGAGTTATGCCGAGTACGCTCTTCAGAACCCACGCGACTGCAAGGTCGT
GGCCATAGCCGAGCCAAGGCCCGGGGCTCAGCGCTACTTTACCGATCGTCATCACATCGACCCCTCTCTCGTATT
CACCACCTGGCAGGACCTCCATGCTGCTTCTGCTGAAACTATCACCACCGTTGGCAGACGACTAGCTGATGCTGT
TATCATTGCTGTACAAGATCAAATGCATCCAGAGGTTACCCTAGCCTTTGCTGAACAAGGCTACCATATTCTCTG
CGAGAAACCCATGGCGATCACTCCTCAAGGATGCATTCTCATGGAACGAGCAGTCAAGAAGGCCAACATCATTTT
TGGCATGGGCCATGGTAATCAACCCGAACTCACTGCCGATGCTTGGCGGCTAAAAATCCCTTTCTAGTACTACGA
TACACCAAGTATTTCCAGGCGATTTCTGAGATCATTCAAAACAAATCTCTGGGTGAACTTGTGAACATCAATCAC
GTAGAACCAGTGGGTCATTTCCACTTTGCGCATTCATACGTGCGCGGAAACTGGAACACCGAAGAGGCGAGTTCC
TTCGCATTAATGACGAAGTGCTGCCAGTGCGTCATCATCGCGTTTTACCATACTTGTGTCTGATGATACCATTCA
GCGACATCGATCTAATTTGCCACTTCTTCTCGTCAACTACTCCTTCTCGAGTTTCGTCGTTTGGCTCTCTCACCC
ACTTCCGCCGCTCAAAGAAACCTCGCGAGGCTGGCGATGTCAAACGTTGTCTTGAATGCCCTTTACAATATGACG
GTGGCTGCCCTTACAGCGCAACAACGAGTAATGAACCTCCATTATCAGCGCGACTTGCCATGATATTAATCAACA
ATAACAGTTTATCTCGACTCTCTCAAGTCAGGTAATAGGAGTTGGCCAGTCAGCGTACTCGTGGATGACATTCCC
GACATTGAAAACATTACGGAGGCCCTGAAAACAGGACCATACGGTGTGTGCGTGTATGAAAGCCCAAACGACGTT
TGCGATCATCAAGTGGTCAACTTTGAGTTTGCCAATGGTACCACAGCCTCTCTCACAATGGTTGCCTTTAGCTCG
GCCATCTGTGAGCGTCAAACTCGCATGCACTTTTCGCATGGTGAAATCATTGGAGACATGAATACGTTCACTGTC
AAAGATTTCAGAACGGGTGTGTTGAGGGAACATTCTTTCCCCCATGCTGGTGGCCATGGAGGTGGCGACATTGGT
TTGATGGAAACATTTGTCAAGGCGGTCAAAGAGCGTAATCAGGAATTGCTAGGGACATCGATTGATGAAGTGGTC
AAGACCCATATGACTGTCTTTGCTGCTGAAGCAAGTCGGAAGGAAGGAAGAGTAATTGACTGTGCCGAATATGAA
AAAGCAGTCAAAGAGGACTTTGAAAAGAATAAATTGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail