Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071720
Gene name
Locationscaffold_4:1576521..1578811
Strand+
Gene length (bp)2290
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 8.9E-107 314 595
PF10348 DUF2427 Domain of unknown function (DUF2427) 1.1E-12 85 174

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 65 601 3.0E-60
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 288 606 1.0E-41
sp|P53584|YTP1_YEAST Protein YTP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTP1 PE=1 SV=1 287 598 2.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 91 113 22
3 126 145 19
4 160 182 22
5 346 368 22
6 414 433 19
7 501 523 22
8 538 560 22
9 572 594 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071720
MFLRNSILLFLALPALLHSAASSQALDLRDSNNISQNILPRHGTHPQHSHAQPVVELNETEVLEHHSPTPPSYYT
IDWEEPEHATERHPGLIVSHALFMGLAFFIALPLGIVLRSSAHAARGIAMASFYGLSALGCAASSLYTKLTPNMY
QGSVHGKQGYIILLLVVLSSAVDILAAIRRFISFVRDNEPKSPVKFWRWVVLNKEIGHLRSGPEYTSLVMEEPEE
KFGSNTMSRESSDEADLQETAQWANDVQNHRRNFSMASDRTACGSRSPTHSDSTLQDAKHGRNTKAQSLTLRVGN
VVLTVLERSLVVAGFAQVLTGIAVYTGGCRENYLNGCLAHLIKGGIFWCYGLLTFARFLGSFAEFGWAWNQVPRG
DPYSAEFVESFIIFLYGITNTWMERFGASPGDPFTTKEIQHIGIAVMFWFAGLLGMGIESKRIRKWLAASIFSPG
ANNSNLPEETITEPSSYKASFNPFPALVIGVTGSAMAAHFQTYLFQVQIHALWGNLLVAFAVLRCMTYFFVWLGP
PRSILPSRPPTEAIGSFFLACGGLVFIFSTEEVTLAAMRRGRDDVMMFLNVAVAITCLAFCWTLLVVGFKGWMKS
RRHNGVTYRTAA*
Coding >AgabiH97|071720
ATGTTTCTCAGAAACTCCATCCTCCTCTTTCTTGCTCTCCCCGCCTTGCTCCACTCAGCCGCATCATCCCAGGCA
CTCGATTTGAGAGATTCCAATAATATATCTCAAAATATCCTGCCCCGGCATGGTACTCACCCCCAACACTCACAT
GCGCAACCCGTCGTCGAGCTCAACGAAACGGAGGTCCTCGAGCACCATTCCCCAACACCCCCTTCCTACTATACT
ATTGACTGGGAGGAACCAGAACATGCGACGGAAAGACATCCGGGCCTCATCGTGTCCCATGCCCTCTTCATGGGC
CTCGCATTCTTCATCGCACTTCCCCTAGGCATCGTGCTACGCTCGTCAGCTCATGCAGCGCGTGGAATCGCGATG
GCATCCTTTTACGGTCTTTCAGCTCTTGGTTGCGCTGCCAGCAGCTTGTACACTAAGCTTACGCCGAACATGTAC
CAAGGATCTGTCCACGGTAAACAAGGTTATATCATATTGCTATTGGTCGTTCTATCATCAGCAGTCGATATTCTG
GCCGCCATTCGACGCTTCATCTCCTTCGTTCGCGATAACGAGCCGAAATCGCCCGTGAAATTTTGGAGATGGGTT
GTTCTAAATAAAGAGATCGGTCACTTGCGGAGCGGTCCCGAGTACACTAGTTTGGTCATGGAAGAGCCAGAGGAA
AAGTTCGGTTCGAACACAATGTCTCGGGAATCTTCCGATGAAGCGGATCTACAGGAGACGGCTCAATGGGCAAAC
GATGTGCAGAACCACCGACGGAATTTTTCTATGGCTTCGGATAGGACAGCCTGTGGTTCTCGATCGCCAACCCAT
TCGGACTCAACCCTACAGGATGCCAAGCATGGGCGCAATACAAAAGCCCAAAGCCTAACATTACGTGTTGGCAAT
GTTGTCCTTACGGTTCTAGAACGTTCTCTTGTTGTAGCTGGCTTCGCCCAGGTGCTGACAGGTATAGCTGTTTAC
ACGGGCGGTTGTCGTGAAAATTATCTAAATGGCTGTTTAGCTCATCTTATCAAGGGTGGCATATTTTGGTGCTAT
GGGCTATTAACTTTTGCTCGTTTCCTTGGATCTTTTGCCGAGTTTGGCTGGGCATGGAACCAGGTGCCCAGAGGC
GACCCTTACTCGGCTGAATTTGTGGAATCTTTCATCATCTTCCTTTATGGCATCACCAACACATGGATGGAACGG
TTCGGTGCGAGCCCAGGTGACCCATTTACAACAAAAGAGATTCAACATATCGGTATTGCAGTCATGTTCTGGTTT
GCTGGTCTGCTTGGGATGGGTATCGAGTCCAAACGTATTCGCAAGTGGTTGGCAGCGTCTATATTCAGTCCCGGG
GCGAATAATTCGAATCTTCCCGAAGAAACGATTACAGAGCCCTCCAGTTATAAAGCTAGTTTCAATCCCTTCCCA
GCTCTTGTGATCGGGGTCACAGGGTCAGCCATGGCCGCGCATTTCCAAACATATTTGTTCCAAGTTCAGATTCAT
GCTCTCTGGGGCAACCTTCTAGTTGCCTTTGCTGTATTGAGATGCATGACTTACTTCTTCGTTTGGCTCGGCCCT
CCTCGTTCAATTCTTCCCTCGCGACCTCCTACCGAGGCTATTGGTAGTTTCTTCCTCGCGTGCGGTGGTTTGGTT
TTCATCTTCTCTACCGAAGAAGTTACGCTTGCTGCGATGCGTCGTGGTAGAGATGATGTTATGATGTTCCTGAAT
GTTGCGGTTGCTATAACTTGCCTAGCTTTCTGCTGGACCCTTCTTGTCGTCGGTTTCAAGGGATGGATGAAATCC
AGGCGGCACAATGGAGTGACCTATAGGACCGCTGCTTGA
Transcript >AgabiH97|071720
ATGTTTCTCAGAAACTCCATCCTCCTCTTTCTTGCTCTCCCCGCCTTGCTCCACTCAGCCGCATCATCCCAGGCA
CTCGATTTGAGAGATTCCAATAATATATCTCAAAATATCCTGCCCCGGCATGGTACTCACCCCCAACACTCACAT
GCGCAACCCGTCGTCGAGCTCAACGAAACGGAGGTCCTCGAGCACCATTCCCCAACACCCCCTTCCTACTATACT
ATTGACTGGGAGGAACCAGAACATGCGACGGAAAGACATCCGGGCCTCATCGTGTCCCATGCCCTCTTCATGGGC
CTCGCATTCTTCATCGCACTTCCCCTAGGCATCGTGCTACGCTCGTCAGCTCATGCAGCGCGTGGAATCGCGATG
GCATCCTTTTACGGTCTTTCAGCTCTTGGTTGCGCTGCCAGCAGCTTGTACACTAAGCTTACGCCGAACATGTAC
CAAGGATCTGTCCACGGTAAACAAGGTTATATCATATTGCTATTGGTCGTTCTATCATCAGCAGTCGATATTCTG
GCCGCCATTCGACGCTTCATCTCCTTCGTTCGCGATAACGAGCCGAAATCGCCCGTGAAATTTTGGAGATGGGTT
GTTCTAAATAAAGAGATCGGTCACTTGCGGAGCGGTCCCGAGTACACTAGTTTGGTCATGGAAGAGCCAGAGGAA
AAGTTCGGTTCGAACACAATGTCTCGGGAATCTTCCGATGAAGCGGATCTACAGGAGACGGCTCAATGGGCAAAC
GATGTGCAGAACCACCGACGGAATTTTTCTATGGCTTCGGATAGGACAGCCTGTGGTTCTCGATCGCCAACCCAT
TCGGACTCAACCCTACAGGATGCCAAGCATGGGCGCAATACAAAAGCCCAAAGCCTAACATTACGTGTTGGCAAT
GTTGTCCTTACGGTTCTAGAACGTTCTCTTGTTGTAGCTGGCTTCGCCCAGGTGCTGACAGGTATAGCTGTTTAC
ACGGGCGGTTGTCGTGAAAATTATCTAAATGGCTGTTTAGCTCATCTTATCAAGGGTGGCATATTTTGGTGCTAT
GGGCTATTAACTTTTGCTCGTTTCCTTGGATCTTTTGCCGAGTTTGGCTGGGCATGGAACCAGGTGCCCAGAGGC
GACCCTTACTCGGCTGAATTTGTGGAATCTTTCATCATCTTCCTTTATGGCATCACCAACACATGGATGGAACGG
TTCGGTGCGAGCCCAGGTGACCCATTTACAACAAAAGAGATTCAACATATCGGTATTGCAGTCATGTTCTGGTTT
GCTGGTCTGCTTGGGATGGGTATCGAGTCCAAACGTATTCGCAAGTGGTTGGCAGCGTCTATATTCAGTCCCGGG
GCGAATAATTCGAATCTTCCCGAAGAAACGATTACAGAGCCCTCCAGTTATAAAGCTAGTTTCAATCCCTTCCCA
GCTCTTGTGATCGGGGTCACAGGGTCAGCCATGGCCGCGCATTTCCAAACATATTTGTTCCAAGTTCAGATTCAT
GCTCTCTGGGGCAACCTTCTAGTTGCCTTTGCTGTATTGAGATGCATGACTTACTTCTTCGTTTGGCTCGGCCCT
CCTCGTTCAATTCTTCCCTCGCGACCTCCTACCGAGGCTATTGGTAGTTTCTTCCTCGCGTGCGGTGGTTTGGTT
TTCATCTTCTCTACCGAAGAAGTTACGCTTGCTGCGATGCGTCGTGGTAGAGATGATGTTATGATGTTCCTGAAT
GTTGCGGTTGCTATAACTTGCCTAGCTTTCTGCTGGACCCTTCTTGTCGTCGGTTTCAAGGGATGGATGAAATCC
AGGCGGCACAATGGAGTGACCTATAGGACCGCTGCTTGA
Gene >AgabiH97|071720
ATGTTTCTCAGAAACTCCATCCTCCTCTTTCTTGCTCTCCCCGCCTTGCTCCACTCAGCCGCATCATCCCAGGCA
CTCGATTTGAGAGATTCCAATAATATATCTCAAAATATCCTGCCCCGGCATGGTACTCACCCCCAACACTCACAT
GCGCAACCCGTCGTCGAGCTCAACGAAACGGAGGTCCTCGAGCACCATTCCCCAACACCCCCTTCCTACTATACT
ATTGACTGGGAGGAACCAGAACATGCGACGGAAAGACATCCGGGCCTCATCGTGTCCCATGCCCTCTTCATGGGC
CTCGCATTCTTCATCGCACTTCCCCTAGGTGAGGGCGTCGGCCTCTTACCTCGACACCGCGTTGACGCCCTCCGT
GACAGGCATCGTGCTACGCTCGTCAGCTCATGCAGCGCGTGGAATCGCGATGGCATCCTTTTACGGTCTTTCAGC
TCTTGGTTGCGCTGCCAGCAGCTTGTACACTAAGCTTACGCCGAACATGTTCGTACGCAGGATGTATCGCCTTTG
CCGAGTCAGACTGACATCATGTTCCCCTTTAGGTACCAAGGTTAGTTATTGATCCCCTATCATTTCTGCAGTTCC
TAACCCGATGGCTTGAAGGATCTGTCCACGGTAAACAAGGTTATATCATATTGCTATTGGTCGTTCTATCATCAG
CAGTCGATATTCTGGCCGCCATTCGACGCTTCATCTCCTTCGTTCGCGATAACGAGCCGAAATCGCCCGTGAAAT
TTTGGAGATGGGTTGTTCTAAATAAAGAGATCGGTCACTTGCGGAGCGGTCCCGAGTACACTAGTTTGGTCATGG
AAGAGCCAGAGGAAAAGTTCGGTTCGAACACAATGTCTCGGGAATCTTCCGATGAAGCGGATCTACAGGAGACGG
CTCAATGGGCAAACGATGTGCAGAACCACCGACGGAATTTTTCTATGGCTTCGGATAGGACAGCCTGTGGTTCTC
GATCGCCAACCCATTCGGACTCAACCCTACAGGATGCCAAGCATGGGCGCAATACAAAAGCCCAAAGCCTAACAT
TACGTGTTGGCAATGTTGTCCTTACGGTTCTAGAACGTTCTCTTGTTGTAGCTGGCTTCGCCCAGGTGCTGACAG
GTATAGCTGTTTACACGGGTCCGTCTGTTTTGACTTGATTCCAGTCCTCCTCCCTCTTACCCCTTTTTTTGGTGT
TTTCAAAGGCGGTTGTCGTGAAAATTATCTAAATGGCTGTTTAGCTCATCTTATCAGTAAGTCTAACCTCTTCTT
TATATATACCTTTTTTCGCATTCTTACTGTCGTCTGAACTCACTATCAGAGGGTGGCATATTTTGGTGCTATGGG
CTATTAACTTTTGCTCGTTTCCTTGGATCTTTTGCCGAGTTTGGCTGGGCATGGAACCAGGTGCCCAGAGGCGAC
CCTTACTCGGCTGAATTTGTGGAATCTTTCATCATCTTCCTTTATGGCATCACCAACACATGGATGGAACGGTTC
GGTGCGAGCCCAGGTGACCCATTTACAACAAAAGAGATTCAACATATCGGTATTGCAGTGGGTAGTGTCAAGATC
ATCCATATAGAAGGTACTCATGACGGTTAGGTCATGTTCTGGTTTGCTGGTCTGCTTGGGATGGGTATCGAGTCC
AAACGTATTCGCAAGTGGTTGGCAGCGTCTATATTCAGTCCCGGGGCGAATAATTCGAATCTTCCCGAAGAAACG
ATTACAGAGCCCTCCAGTTATAAAGCTAGTTTCAATCCCTTCCCAGCTCTTGTGATCGGGGTCACAGGGTCAGCC
ATGGCCGCGCATTTCCAAACATATTTGTTCCAAGTACGCCCTTTTATGCTTGGAAGTTCAGTATGGATGTATTCA
ATTCGTTTATAGGTTCAGATTCATGCTCTCTGGGGCAACCTTCTAGTTGCCTTTGCTGTATTGAGATGCATGACT
TACTTCTTCGTTTGGCTCGGCCCTCCTCGTTCAATTCTTCCCTCGCGACCTCCTACCGAGGCTATTGGTAGTTTC
TTCCTCGCGTGCGGTGGTTTGGTTTTCATCTTCTCTACCGAAGAAGTTACGCTTGCTGCGATGCGTCGTGGTAGA
GATGGTGGGTTTATATTTGTCAATCTAGTCAAATGTAGTGCTAACCATACTCCTAGATGTTATGATGTTCCTGAA
TGTTGCGGTTGCTATAACTTGCCTAGCTTTCTGCTGGACCCTTCTTGTCGTCGGTTTCAAGGGATGGATGAAATC
CAGGCGGCACAATGGAGTGACCTATAGGACCGCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail