Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071690
Gene name
Locationscaffold_4:1569836..1571241
Strand+
Gene length (bp)1405
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00027 cNMP_binding Cyclic nucleotide-binding domain 2.1E-17 225 317
PF00027 cNMP_binding Cyclic nucleotide-binding domain 1.5E-17 356 436
PF02197 RIIa Regulatory subunit of type II PKA R-subunit 2.6E-09 8 40

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86ZN7|KAPR_HYPAT cAMP-dependent protein kinase regulatory subunit OS=Hypocrea atroviridis GN=pkar1 PE=3 SV=1 8 443 2.0E-79
sp|Q6CPK7|KAPR_KLULA cAMP-dependent protein kinase regulatory subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PKAR PE=3 SV=1 1 444 3.0E-77
sp|Q96UX3|KAPR_ASPFU cAMP-dependent protein kinase regulatory subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pkaR PE=3 SV=1 158 443 4.0E-75
sp|Q9C196|KAPR_ASPNG cAMP-dependent protein kinase regulatory subunit OS=Aspergillus niger GN=pkaR PE=3 SV=1 142 443 1.0E-74
sp|Q75AM2|KAPR_ASHGO cAMP-dependent protein kinase regulatory subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKAR PE=3 SV=1 7 443 7.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86ZN7|KAPR_HYPAT cAMP-dependent protein kinase regulatory subunit OS=Hypocrea atroviridis GN=pkar1 PE=3 SV=1 8 443 2.0E-79
sp|Q6CPK7|KAPR_KLULA cAMP-dependent protein kinase regulatory subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PKAR PE=3 SV=1 1 444 3.0E-77
sp|Q96UX3|KAPR_ASPFU cAMP-dependent protein kinase regulatory subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pkaR PE=3 SV=1 158 443 4.0E-75
sp|Q9C196|KAPR_ASPNG cAMP-dependent protein kinase regulatory subunit OS=Aspergillus niger GN=pkaR PE=3 SV=1 142 443 1.0E-74
sp|Q75AM2|KAPR_ASHGO cAMP-dependent protein kinase regulatory subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKAR PE=3 SV=1 7 443 7.0E-74
sp|P31320|KAPR_BLAEM cAMP-dependent protein kinase regulatory subunit OS=Blastocladiella emersonii GN=PKAR PE=2 SV=1 157 447 1.0E-72
sp|Q6C2X0|KAPR_YARLI cAMP-dependent protein kinase regulatory subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PKAR PE=3 SV=1 11 446 2.0E-72
sp|O59922|KAPR_EMENI cAMP-dependent protein kinase regulatory subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pkaR PE=3 SV=1 158 443 5.0E-72
sp|O14448|KAPR_MAGO7 cAMP-dependent protein kinase regulatory subunit OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SUM1 PE=1 SV=1 163 443 3.0E-71
sp|Q01386|KAPR_NEUCR cAMP-dependent protein kinase regulatory subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mcb PE=3 SV=1 89 443 4.0E-71
sp|Q9C1C2|KAPR_COLOR cAMP-dependent protein kinase regulatory subunit OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PKAR PE=3 SV=1 84 443 2.0E-70
sp|Q6FQL6|KAPR_CANGA cAMP-dependent protein kinase regulatory subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PKAR PE=3 SV=1 20 444 8.0E-70
sp|Q6BZG7|KAPR_DEBHA cAMP-dependent protein kinase regulatory subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PKAR PE=3 SV=2 11 446 3.0E-69
sp|P49605|KAPR_USTMA cAMP-dependent protein kinase regulatory subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PKAR PE=3 SV=2 2 449 5.0E-69
sp|P07278|KAPR_YEAST cAMP-dependent protein kinase regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCY1 PE=1 SV=4 14 444 2.0E-68
sp|Q8TF77|KAPR_MUCCL cAMP-dependent protein kinase regulatory subunit OS=Mucor circinelloides f. lusitanicus GN=pkar PE=3 SV=1 4 444 5.0E-68
sp|Q9HEP7|KAPR_BLUGR cAMP-dependent protein kinase regulatory subunit OS=Blumeria graminis GN=pkar PE=3 SV=1 165 443 2.0E-66
sp|P13861|KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens GN=PRKAR2A PE=1 SV=2 163 449 2.0E-60
sp|P12368|KAP2_RAT cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Rattus norvegicus GN=Prkar2a PE=1 SV=3 155 449 3.0E-60
sp|P36600|KAPR_SCHPO cAMP-dependent protein kinase regulatory subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cgs1 PE=1 SV=2 156 443 6.0E-60
sp|P00515|KAP2_BOVIN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus GN=PRKAR2A PE=1 SV=2 142 449 1.0E-59
sp|Q9HEW1|KAPR_CANAL cAMP-dependent protein kinase regulatory subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCY1 PE=3 SV=1 8 446 2.0E-59
sp|P31322|KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus GN=PRKAR2B PE=2 SV=2 163 444 2.0E-59
sp|P81900|KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster GN=Pka-R2 PE=1 SV=2 165 444 5.0E-59
sp|P12369|KAP3_RAT cAMP-dependent protein kinase type II-beta regulatory subunit OS=Rattus norvegicus GN=Prkar2b PE=1 SV=3 163 444 6.0E-59
sp|P31323|KAP3_HUMAN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens GN=PRKAR2B PE=1 SV=3 163 444 7.0E-59
sp|P12367|KAP2_MOUSE cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus GN=Prkar2a PE=1 SV=2 155 449 1.0E-58
sp|P31324|KAP3_MOUSE cAMP-dependent protein kinase type II-beta regulatory subunit OS=Mus musculus GN=Prkar2b PE=1 SV=3 163 444 2.0E-58
sp|Q26619|KAPR_STRPU cAMP-dependent protein kinase type II regulatory subunit OS=Strongylocentrotus purpuratus PE=2 SV=1 163 449 4.0E-58
sp|P30625|KAPR_CAEEL cAMP-dependent protein kinase regulatory subunit OS=Caenorhabditis elegans GN=kin-2 PE=1 SV=3 165 444 7.0E-56
sp|P00514|KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus GN=PRKAR1A PE=1 SV=2 157 444 5.0E-53
sp|Q9DBC7|KAP0_MOUSE cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus GN=Prkar1a PE=1 SV=3 157 444 8.0E-53
sp|P09456|KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus GN=Prkar1a PE=1 SV=2 157 444 9.0E-53
sp|Q5REL1|KAP0_PONAB cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Pongo abelii GN=PRKAR1A PE=2 SV=2 157 444 9.0E-53
sp|P10644|KAP0_HUMAN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens GN=PRKAR1A PE=1 SV=1 157 444 9.0E-53
sp|P16905|KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster GN=Pka-R1 PE=2 SV=2 150 444 1.0E-52
sp|P05987|KAPR_DICDI cAMP-dependent protein kinase regulatory subunit OS=Dictyostelium discoideum GN=pkaR PE=1 SV=1 159 443 2.0E-52
sp|P07802|KAP0_PIG cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Sus scrofa GN=PRKAR1A PE=1 SV=2 157 444 4.0E-52
sp|P31319|KAPR_APLCA cAMP-dependent protein kinase regulatory subunit OS=Aplysia californica PE=2 SV=2 165 444 1.0E-51
sp|Q5ZM91|KAP0_CHICK cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Gallus gallus GN=PRKAR1A PE=2 SV=1 164 444 1.0E-51
sp|P81377|KAP1_RAT cAMP-dependent protein kinase type I-beta regulatory subunit OS=Rattus norvegicus GN=Prkar1b PE=2 SV=2 148 444 5.0E-51
sp|P12849|KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus GN=Prkar1b PE=1 SV=2 148 444 6.0E-51
sp|P31321|KAP1_HUMAN cAMP-dependent protein kinase type I-beta regulatory subunit OS=Homo sapiens GN=PRKAR1B PE=1 SV=4 157 444 9.0E-51
sp|O42794|KAPR_COLTR cAMP-dependent protein kinase regulatory subunit OS=Colletotrichum trifolii GN=PKAR PE=3 SV=1 123 443 9.0E-43
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 5 447 2.0E-37
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 165 442 4.0E-36
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 152 445 6.0E-36
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 166 447 4.0E-30
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 166 447 3.0E-29
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 166 447 1.0E-28
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 195 447 2.0E-28
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 195 447 2.0E-28
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 195 447 3.0E-28
sp|Q9SL76|P2C19_ARATH Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein OS=Arabidopsis thaliana GN=At2g20050/At2g20040 PE=2 SV=2 185 449 1.0E-27
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 187 449 1.0E-26
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 193 447 2.0E-26
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 223 449 3.0E-21
sp|P05207|KAP2_PIG cAMP-dependent protein kinase type II-alpha regulatory subunit (Fragment) OS=Sus scrofa GN=PRKAR2A PE=1 SV=1 121 289 9.0E-16
sp|P86244|KAP0_MESAU cAMP-dependent protein kinase type I-alpha regulatory subunit (Fragments) OS=Mesocricetus auratus GN=PRKAR1A PE=1 SV=1 327 413 6.0E-13
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 332 449 7.0E-08
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 332 449 8.0E-08
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 199 320 2.0E-07
sp|Q8MLZ3|PDE5_DICDI cGMP-dependent 3',5'-cGMP phosphodiesterase A OS=Dictyostelium discoideum GN=pdeD PE=1 SV=1 197 424 2.0E-07
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 332 449 6.0E-07
sp|O70507|HCN4_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Mus musculus GN=Hcn4 PE=1 SV=2 331 436 1.0E-06
sp|P9WM61|Y104_MYCTU Uncharacterized protein Rv0104 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0104 PE=4 SV=1 219 330 9.0E-06
sp|P9WM60|Y104_MYCTO Uncharacterized protein MT0113 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0113 PE=4 SV=1 219 330 9.0E-06
sp|Q98GN8|CNGK1_RHILO Cyclic nucleotide-gated potassium channel mll3241 OS=Rhizobium loti (strain MAFF303099) GN=mll3241 PE=1 SV=1 331 435 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071690
MSTFDSLIADLTRDMQRVQPKDALQFCANWFQSRLEEQRARTRDILSQRSNHLNVSQELYADAHSSGKRSTSPFT
PPLSTPTAMHRSPMRASIANSPFGALNVPGNALLQAAVPNPTFRMGPQEQPPTSPLSSTLSPFNRFDTITPAEID
PNDLLHPPNSAIFQRRTSVSAESIDVDAYPDAVPPVFPKTPEQVEKIRDIVRKLFIFRGLAEDQEKAVLDAMQER
FIKKGDILIRQGDVGDAFYVIQSGKLHVFIKDDRPPAGEVHPVLGRKVAECPAGSSVGELALLYGHPRAASALAM
EDSHLWSLDRMTFRTIVLKLAHRRRMMYEGFLSGVELLSSLDAQQRSKIADALNREVYQAGTTVVVEGDPGQDKF
FLIEDGEAIVTQQNKEINRLKKGDYFGELSLLHEKPRAASVVAKSKLVVAALDAAAFRRLLGPLKDLMEEKYRH*
Coding >AgabiH97|071690
ATGTCTACTTTCGATTCTCTCATTGCGGACCTGACTCGTGATATGCAGCGCGTTCAGCCCAAGGACGCTCTCCAG
TTCTGTGCCAACTGGTTCCAATCCCGGTTAGAGGAACAGAGGGCAAGAACTCGAGATATCCTCTCCCAGCGATCC
AACCATCTCAACGTTTCGCAAGAACTTTACGCTGACGCACATTCCAGCGGCAAGAGGAGCACTTCACCATTCACA
CCGCCGCTGTCAACACCCACTGCAATGCATCGGTCACCTATGAGAGCCAGCATCGCTAACAGTCCATTTGGAGCT
CTGAATGTTCCGGGAAACGCCCTACTGCAAGCAGCTGTTCCTAATCCAACCTTCAGAATGGGACCGCAGGAGCAA
CCACCAACATCACCTCTTTCATCGACTCTTTCTCCCTTCAATCGCTTTGATACCATTACTCCAGCGGAAATTGAT
CCCAATGACCTCTTACACCCTCCCAATTCTGCTATCTTCCAACGCCGCACTTCCGTTTCTGCGGAGTCCATCGAC
GTTGATGCATACCCTGATGCTGTTCCACCTGTCTTCCCAAAAACGCCAGAACAGGTGGAAAAAATCAGAGATATA
GTTAGAAAGCTCTTCATCTTTCGTGGTCTCGCGGAAGATCAAGAAAAAGCGGTACTTGATGCAATGCAGGAGCGA
TTCATTAAAAAGGGCGATATACTCATACGACAAGGGGACGTGGGAGATGCTTTTTACGTAATTCAGTCGGGAAAA
CTCCATGTGTTCATCAAAGACGACAGACCTCCTGCAGGCGAAGTTCACCCCGTGTTGGGTAGGAAAGTTGCAGAA
TGTCCAGCTGGAAGTTCTGTCGGTGAACTTGCTTTGCTTTATGGACATCCTCGTGCAGCTAGCGCCCTCGCAATG
GAGGACTCTCATCTTTGGTCCCTCGATCGTATGACGTTCCGCACCATTGTGCTAAAGCTGGCCCACAGGCGTCGA
ATGATGTACGAAGGATTTTTGAGCGGCGTCGAGTTGTTATCATCCCTTGATGCGCAGCAGCGGAGCAAAATTGCA
GATGCTCTTAATAGAGAAGTTTACCAGGCTGGGACGACTGTGGTGGTGGAGGGGGACCCTGGACAGGACAAGTTC
TTTTTGATTGAGGATGGGGAAGCCATCGTCACTCAACAAAACAAAGAGATTAACCGCCTCAAAAAAGGAGACTAC
TTCGGAGAACTCTCCTTGCTTCATGAAAAACCCCGTGCCGCGTCTGTGGTGGCGAAAAGCAAACTGGTAGTGGCT
GCTCTGGATGCGGCTGCTTTCCGGCGTCTACTTGGACCTTTGAAAGACCTCATGGAAGAAAAATATCGCCATTAA
Transcript >AgabiH97|071690
ATGTCTACTTTCGATTCTCTCATTGCGGACCTGACTCGTGATATGCAGCGCGTTCAGCCCAAGGACGCTCTCCAG
TTCTGTGCCAACTGGTTCCAATCCCGGTTAGAGGAACAGAGGGCAAGAACTCGAGATATCCTCTCCCAGCGATCC
AACCATCTCAACGTTTCGCAAGAACTTTACGCTGACGCACATTCCAGCGGCAAGAGGAGCACTTCACCATTCACA
CCGCCGCTGTCAACACCCACTGCAATGCATCGGTCACCTATGAGAGCCAGCATCGCTAACAGTCCATTTGGAGCT
CTGAATGTTCCGGGAAACGCCCTACTGCAAGCAGCTGTTCCTAATCCAACCTTCAGAATGGGACCGCAGGAGCAA
CCACCAACATCACCTCTTTCATCGACTCTTTCTCCCTTCAATCGCTTTGATACCATTACTCCAGCGGAAATTGAT
CCCAATGACCTCTTACACCCTCCCAATTCTGCTATCTTCCAACGCCGCACTTCCGTTTCTGCGGAGTCCATCGAC
GTTGATGCATACCCTGATGCTGTTCCACCTGTCTTCCCAAAAACGCCAGAACAGGTGGAAAAAATCAGAGATATA
GTTAGAAAGCTCTTCATCTTTCGTGGTCTCGCGGAAGATCAAGAAAAAGCGGTACTTGATGCAATGCAGGAGCGA
TTCATTAAAAAGGGCGATATACTCATACGACAAGGGGACGTGGGAGATGCTTTTTACGTAATTCAGTCGGGAAAA
CTCCATGTGTTCATCAAAGACGACAGACCTCCTGCAGGCGAAGTTCACCCCGTGTTGGGTAGGAAAGTTGCAGAA
TGTCCAGCTGGAAGTTCTGTCGGTGAACTTGCTTTGCTTTATGGACATCCTCGTGCAGCTAGCGCCCTCGCAATG
GAGGACTCTCATCTTTGGTCCCTCGATCGTATGACGTTCCGCACCATTGTGCTAAAGCTGGCCCACAGGCGTCGA
ATGATGTACGAAGGATTTTTGAGCGGCGTCGAGTTGTTATCATCCCTTGATGCGCAGCAGCGGAGCAAAATTGCA
GATGCTCTTAATAGAGAAGTTTACCAGGCTGGGACGACTGTGGTGGTGGAGGGGGACCCTGGACAGGACAAGTTC
TTTTTGATTGAGGATGGGGAAGCCATCGTCACTCAACAAAACAAAGAGATTAACCGCCTCAAAAAAGGAGACTAC
TTCGGAGAACTCTCCTTGCTTCATGAAAAACCCCGTGCCGCGTCTGTGGTGGCGAAAAGCAAACTGGTAGTGGCT
GCTCTGGATGCGGCTGCTTTCCGGCGTCTACTTGGACCTTTGAAAGACCTCATGGAAGAAAAATATCGCCATTAA
Gene >AgabiH97|071690
ATGTCTACTTTCGATTCTCTCATTGCGGACCTGACTCGTGATATGCAGCGCGTTCAGCCCAAGGACGCTCTCCAG
TTCTGTGCCAACTGGTTCCAATCCCGGTTAGAGGAACAGAGGGCAAGAACTCGAGATATCCTCTCCCAGCGATCC
AACCATCTCAACGTTTCGCAAGAACTTTACGCTGACGCACATTCCAGCGGCAAGAGGAGCACTTCACCATTCACA
CCGCCGCTGTCAACACCCACTGCAATGCATCGGTCACCTATGAGAGCCAGCATCGCTAACAGTCCATTTGGAGCT
CTGAATGTTCCGGGAAACGCCCTACTGCAAGCAGCTGTTCCTAATCCAACCTTCAGAATGGGACCGCAGGAGCAA
CCACCAACATCACCTCTTTCATCGACTCTTTCTCCCTTCAATCGCTTTGATACCATTACTCCAGCGGAAATTGAT
CCCAATGACCTCTTACACCCTCCCAATTCTGCTATCTTCCAACGCCGCACTTCCGTTTCTGCGGAGTCCATCGAC
GTTGATGCATACCCTGATGCTGTTCCACCTGTCTTCCCAAAAACGCCAGAACAGGTGGAAAAAATCAGAGATATA
GTTAGAAAGCTCTTCATCTTTCGTGGTCTCGCGGAAGATCAAGAAAAAGCGGTACTTGATGCAATGCAGGAGCGA
TTCATTAAAAAGGGCGATATACTCATACGACAAGGGGACGTGGGAGATGCTTTTTACGTAATTCAGTCGGGAAAA
CTCCATGTGTTCATCAAAGACGACAGACCTCCTGCAGGCGAAGTTCACCCCGTGTTGGGTAGGAAAGTTGCAGAA
TGTCCAGCTGGAAGTTCTGTCGGTGAACTTGCTTTGCTTTATGGACATCCTCGTGCAGCTAGCGCCCTCGCAATG
GAGGACTCTCATCTTTGGTCCCTCGATCGTATGACGTTCCGCACCATTGTGCTAAAGCTGGCCCACAGGCGTCGA
ATGATGTACGAAGGATTTTTGAGCGGCGTCGAGTTGTTATCATCCCTTGATGCGCAGCAGCGGAGCAAAATTGCA
GATGCTCTTAATAGAGAAGTTTACCAGGCTGGGACGACTGTGGTGGTGGAGGGGGACCCTGGACAGGACAAGTTC
TTTTTGATTGAGGATGGGGAAGCCATCGTCACTCAACAAAACAAAGAGATTAACCGCCTCAAAAAAGGAGACTAC
TTCGGAGGTGAGATCACTTTATCACCCGATACCATTATACCTGCTAAAGTTACAATTTCCAGAACTCTCCTTGCT
TCATGAAAAACCCCGTGCCGCGTCTGTGGTGGCGAAAAGCAAACTGGTAGTGGCTGCTCTGGATGCGGCTGCTTT
CCGGCGTCTACTTGGACCTTTGAAAGACCTCATGGAAGAAAAATATCGCCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail