Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071670
Gene name
Locationscaffold_4:1566769..1568001
Strand+
Gene length (bp)1232
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 4.0E-18 88 309
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 2.8E-14 2 61

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42896|YBQ3_SCHPO Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC115.03 PE=3 SV=1 5 248 6.0E-61
sp|O13991|YEG9_SCHPO Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.09c PE=2 SV=3 6 308 1.0E-59
sp|O32223|IOLW_BACSU scyllo-inositol 2-dehydrogenase (NADP(+)) OS=Bacillus subtilis (strain 168) GN=iolW PE=1 SV=1 1 310 4.0E-53
sp|P77376|YDGJ_ECOLI Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) GN=ydgJ PE=3 SV=2 1 310 1.0E-52
sp|P46853|YHHX_ECOLI Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) GN=yhhX PE=1 SV=1 3 296 6.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42896|YBQ3_SCHPO Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC115.03 PE=3 SV=1 5 248 6.0E-61
sp|O13991|YEG9_SCHPO Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.09c PE=2 SV=3 6 308 1.0E-59
sp|O32223|IOLW_BACSU scyllo-inositol 2-dehydrogenase (NADP(+)) OS=Bacillus subtilis (strain 168) GN=iolW PE=1 SV=1 1 310 4.0E-53
sp|P77376|YDGJ_ECOLI Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) GN=ydgJ PE=3 SV=2 1 310 1.0E-52
sp|P46853|YHHX_ECOLI Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) GN=yhhX PE=1 SV=1 3 296 6.0E-47
sp|O05265|YULF_BACSU Uncharacterized oxidoreductase YulF OS=Bacillus subtilis (strain 168) GN=yulF PE=3 SV=2 1 142 4.0E-08
sp|P74041|Y816_SYNY3 Uncharacterized oxidoreductase sll0816 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0816 PE=3 SV=1 7 58 1.0E-06
sp|O68965|MI2D_RHIME Inositol 2-dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=idhA PE=1 SV=2 10 79 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071670
MSNAVSIELIIVGTPSDTHYDFAKAALLAGKHVLVEKPVTPNTNQARELYDIAKSRKLVLYAYQNRRWDADFLAL
KKLLSLPETSPQSIGSVLEFESHYDRYRTQLKGNWKDEARPATGLTYDLGSHLIDQCLSLLGRPDKITGFVQNIR
GIGSPDVNDWFTIHLHYSKSPSRPYPVTAILRASILSARSSQLRYVVRGSRGTYIKYGVDVQEDQLKAMPTPETI
FEAGFGKEPESLWGTVENVHNDGVTFSKAIWPSDAAGCYVELFKNLAAAIREGAELSVPWKDAQTVIELIELAHQ
SSEEGRTLTVPPVM*
Coding >AgabiH97|071670
ATGTCAAACGCCGTTTCGATCGAACTCATTATTGTAGGCACACCCAGTGACACTCACTATGATTTCGCAAAAGCG
GCTCTTCTGGCTGGAAAACACGTACTTGTGGAAAAGCCTGTCACCCCTAATACTAATCAGGCTCGAGAACTTTAT
GACATCGCCAAATCGAGAAAGTTAGTCCTCTACGCCTATCAGAACCGACGATGGGATGCAGATTTCCTGGCCCTC
AAAAAACTCCTTTCGCTTCCGGAGACATCGCCCCAGTCCATTGGATCAGTCCTTGAATTTGAATCCCATTACGAT
CGATACCGCACCCAGTTGAAGGGAAACTGGAAAGATGAAGCAAGACCCGCGACAGGCCTCACATACGACCTAGGG
TCACATCTTATCGACCAATGCCTTTCCCTCCTCGGACGCCCCGATAAAATCACGGGCTTCGTCCAGAATATAAGA
GGAATCGGAAGTCCGGATGTGAATGACTGGTTCACCATCCATCTTCACTACTCCAAAAGTCCTAGCCGACCGTAT
CCTGTTACCGCCATTTTGAGGGCGAGCATCCTTTCTGCTCGGTCCTCGCAACTGCGATACGTCGTTCGAGGAAGC
CGGGGCACTTACATCAAGTACGGTGTTGATGTCCAAGAAGATCAACTAAAAGCGATGCCGACGCCTGAGACCATC
TTCGAAGCTGGTTTTGGAAAAGAACCAGAGTCTTTGTGGGGCACGGTAGAGAATGTGCACAATGATGGCGTGACG
TTCAGCAAAGCAATATGGCCGTCGGACGCGGCTGGTTGTTACGTTGAACTGTTCAAGAATCTAGCAGCAGCCATA
AGGGAGGGTGCGGAGCTGTCCGTGCCCTGGAAGGATGCGCAGACAGTGATTGAGTTGATTGAGCTCGCCCATCAA
AGCTCGGAGGAGGGAAGGACGCTTACTGTCCCGCCGGTCATGTGA
Transcript >AgabiH97|071670
ATGTCAAACGCCGTTTCGATCGAACTCATTATTGTAGGCACACCCAGTGACACTCACTATGATTTCGCAAAAGCG
GCTCTTCTGGCTGGAAAACACGTACTTGTGGAAAAGCCTGTCACCCCTAATACTAATCAGGCTCGAGAACTTTAT
GACATCGCCAAATCGAGAAAGTTAGTCCTCTACGCCTATCAGAACCGACGATGGGATGCAGATTTCCTGGCCCTC
AAAAAACTCCTTTCGCTTCCGGAGACATCGCCCCAGTCCATTGGATCAGTCCTTGAATTTGAATCCCATTACGAT
CGATACCGCACCCAGTTGAAGGGAAACTGGAAAGATGAAGCAAGACCCGCGACAGGCCTCACATACGACCTAGGG
TCACATCTTATCGACCAATGCCTTTCCCTCCTCGGACGCCCCGATAAAATCACGGGCTTCGTCCAGAATATAAGA
GGAATCGGAAGTCCGGATGTGAATGACTGGTTCACCATCCATCTTCACTACTCCAAAAGTCCTAGCCGACCGTAT
CCTGTTACCGCCATTTTGAGGGCGAGCATCCTTTCTGCTCGGTCCTCGCAACTGCGATACGTCGTTCGAGGAAGC
CGGGGCACTTACATCAAGTACGGTGTTGATGTCCAAGAAGATCAACTAAAAGCGATGCCGACGCCTGAGACCATC
TTCGAAGCTGGTTTTGGAAAAGAACCAGAGTCTTTGTGGGGCACGGTAGAGAATGTGCACAATGATGGCGTGACG
TTCAGCAAAGCAATATGGCCGTCGGACGCGGCTGGTTGTTACGTTGAACTGTTCAAGAATCTAGCAGCAGCCATA
AGGGAGGGTGCGGAGCTGTCCGTGCCCTGGAAGGATGCGCAGACAGTGATTGAGTTGATTGAGCTCGCCCATCAA
AGCTCGGAGGAGGGAAGGACGCTTACTGTCCCGCCGGTCATGTGA
Gene >AgabiH97|071670
ATGTCAAACGCCGTTTCGGTACAACTGTCAAGATTCATAGAAGCTTCGACGCTATAATCGCAGATTCAGAGATCG
AACTCATTATTGTAGGCACACCCAGTGACACTCACTATGATTTCGCAAAAGCGGCTCTTCTGGCTGGAAAACACG
GTGAGACGAATTTCTGTAATCAACAATGTAATCTGACGCTCCTTTTTGTTTCTTCTTCCTCAGTACTTGTGGAAA
AGCCTGTCACCCCTAATACTAATCAGGCTCGAGAACTTTATGACATCGCCAAATCGAGAAAGTTAGTCCTCTACG
CCTATCAGAACCGACGATGGGATGCAGATTTCCTGGCCCTCAAAAAACTCCTTTCGCTTCCGGAGACATCGCCCC
AGTCCATTGGATCAGTCCTTGAATTTGAATCCCAGTTAGCCATTCAAACTTTGAATACCCAGGCCTGTATTGATG
TCATCCACAGTTACGATCGATACCGCACCCAGTTGAAGGGAAACTGGAAAGATGAAGCAAGACCCGCGACAGGCC
TCACATACGACCTAGGGTCACATCTTATCGACCAATGCCTTTCCCTCCTCGGACGCCCCGATAAAATCACGGGCT
TCGTCCAGAATATAAGAGGAATCGGAAGTCCGGATGTGAATGACTGGGTAAGCAGGTTGACGGAGCATTTTCGAA
GTTCTTCCACCGGGTGTGCTCATGACATTTCTCCGATTGTTAGTTCACCATCCATCTTCACTACTCCAAAAGTCC
TAGCCGACCGTATCCTGTTACCGCCATTTTGAGGGCGAGCATCCTTTCTGCTCGGTCCTCGCAACTGCGATACGT
CGTTCGAGGAAGCCGGGGCACTTACATCAAGTACGGTGTTGATGTCCAAGAAGATCAACTAAAAGCGATGCCGAC
GCCTGAGACCATCTTCGAAGCTGGTTTTGGAAAAGAACCAGAGTCTTTGTGGGGCACGGTAGAGAATGTGCACAA
TGATGGCGTGACGTTCAGCAAAGCAATGTGAGGCATTATTCTTCTCTGCCTCACAATATCCACTAACTATTGCCA
GATGGCCGTCGGACGCGGCTGGTTGTTACGTTGAACTGTTCAAGAATCTAGCAGCAGCCATAAGGGAGGGTGCGG
AGCTGTCCGTGCCCTGGAAGGATGCGCAGACAGTGATTGAGTTGATTGAGCTCGCCCATCAAAGCTCGGAGGAGG
GAAGGACGCTTACTGTCCCGCCGGTCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail