Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071660
Gene name
Locationscaffold_4:1564182..1566601
Strand-
Gene length (bp)2419
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9 3.3E-116 63 512

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O64890|GUN13_ARATH Endoglucanase 13 OS=Arabidopsis thaliana GN=At2g44550 PE=2 SV=1 65 514 4.0E-71
sp|O64889|GUN12_ARATH Endoglucanase 12 OS=Arabidopsis thaliana GN=At2g44540 PE=3 SV=1 65 514 1.0E-70
sp|P26221|GUN4_THEFU Endoglucanase E-4 OS=Thermobifida fusca GN=celD PE=1 SV=2 20 543 2.0E-69
sp|Q8S8Q4|GUN14_ARATH Endoglucanase 14 OS=Arabidopsis thaliana GN=At2g44560 PE=2 SV=2 65 496 5.0E-66
sp|O80497|GUN15_ARATH Endoglucanase 15 OS=Arabidopsis thaliana GN=At2g44570 PE=3 SV=1 59 514 4.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O64890|GUN13_ARATH Endoglucanase 13 OS=Arabidopsis thaliana GN=At2g44550 PE=2 SV=1 65 514 4.0E-71
sp|O64889|GUN12_ARATH Endoglucanase 12 OS=Arabidopsis thaliana GN=At2g44540 PE=3 SV=1 65 514 1.0E-70
sp|P26221|GUN4_THEFU Endoglucanase E-4 OS=Thermobifida fusca GN=celD PE=1 SV=2 20 543 2.0E-69
sp|Q8S8Q4|GUN14_ARATH Endoglucanase 14 OS=Arabidopsis thaliana GN=At2g44560 PE=2 SV=2 65 496 5.0E-66
sp|O80497|GUN15_ARATH Endoglucanase 15 OS=Arabidopsis thaliana GN=At2g44570 PE=3 SV=1 59 514 4.0E-64
sp|Q0J930|GUN13_ORYSJ Endoglucanase 13 OS=Oryza sativa subsp. japonica GN=GLU6 PE=2 SV=1 70 514 1.0E-60
sp|Q5YLG1|GUNA_BACPU Endoglucanase A OS=Bacillus pumilus GN=eglA PE=1 SV=1 21 509 1.0E-60
sp|Q02934|GUNI_CLOTH Endoglucanase 1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celI PE=1 SV=2 66 531 2.0E-60
sp|Q9M995|GUN5_ARATH Endoglucanase 5 OS=Arabidopsis thaliana GN=At1g48930 PE=2 SV=1 72 514 7.0E-60
sp|A2XYW8|GUN13_ORYSI Endoglucanase 13 OS=Oryza sativa subsp. indica GN=GLU6 PE=3 SV=2 70 514 9.0E-60
sp|P26224|GUNF_CLOTH Endoglucanase F OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celF PE=3 SV=1 70 510 2.0E-59
sp|Q8L7I0|GUN19_ARATH Endoglucanase 19 OS=Arabidopsis thaliana GN=At4g11050 PE=2 SV=1 70 514 2.0E-59
sp|P22503|GUN_PHAVU Endoglucanase OS=Phaseolus vulgaris PE=2 SV=2 49 510 3.0E-59
sp|Q5NAT8|GUN1_ORYSJ Endoglucanase 1 OS=Oryza sativa subsp. japonica GN=GLU7 PE=2 SV=1 69 512 6.0E-59
sp|Q5NAT0|GUN2_ORYSJ Endoglucanase 2 OS=Oryza sativa subsp. japonica GN=GLU5 PE=1 SV=1 69 514 2.0E-58
sp|O48766|GUN11_ARATH Endoglucanase 11 OS=Arabidopsis thaliana GN=At2g32990 PE=2 SV=1 69 514 9.0E-58
sp|P28622|GUN4_BACS5 Endoglucanase 4 OS=Bacillus sp. (strain KSM-522) PE=3 SV=2 62 509 2.0E-57
sp|Q67UW5|GUN5_ORYSJ Endoglucanase 5 OS=Oryza sativa subsp. japonica GN=Os02g0151300 PE=2 SV=1 69 510 5.0E-57
sp|Q6L4I2|GUN15_ORYSJ Endoglucanase 15 OS=Oryza sativa subsp. japonica GN=Os05g0212300 PE=2 SV=1 69 514 1.0E-56
sp|Q42059|GUN6_ARATH Endoglucanase 6 OS=Arabidopsis thaliana GN=At1g64390 PE=2 SV=2 70 514 2.0E-56
sp|Q8LQ92|GUN3_ORYSJ Endoglucanase 3 OS=Oryza sativa subsp. japonica GN=GLU8 PE=2 SV=1 45 515 9.0E-56
sp|P26225|GUNB_CELFI Endoglucanase B OS=Cellulomonas fimi GN=cenB PE=3 SV=1 70 525 3.0E-55
sp|O81416|GUN17_ARATH Endoglucanase 17 OS=Arabidopsis thaliana GN=At4g02290 PE=2 SV=1 17 515 6.0E-55
sp|Q9SRX3|GUN1_ARATH Endoglucanase 1 OS=Arabidopsis thaliana GN=CEL2 PE=2 SV=1 59 515 2.0E-54
sp|Q9C9H5|GUN9_ARATH Endoglucanase 9 OS=Arabidopsis thaliana GN=CEL3 PE=1 SV=1 48 515 5.0E-53
sp|Q6Z5P2|GUN7_ORYSJ Endoglucanase 7 OS=Oryza sativa subsp. japonica GN=GLU10 PE=2 SV=1 57 514 2.0E-52
sp|Q8LCP6|GUN10_ARATH Endoglucanase 10 OS=Arabidopsis thaliana GN=At1g75680 PE=2 SV=2 59 495 4.0E-52
sp|Q9FXI9|GUN2_ARATH Endoglucanase 2 OS=Arabidopsis thaliana GN=At1g19940 PE=2 SV=1 61 500 8.0E-52
sp|Q2V4L8|GUN3_ARATH Endoglucanase 3 OS=Arabidopsis thaliana GN=CEL5 PE=2 SV=2 66 515 1.0E-51
sp|Q6K7G9|GUN8_ORYSJ Endoglucanase 8 OS=Oryza sativa subsp. japonica GN=Os02g0778600 PE=2 SV=1 56 500 4.0E-51
sp|Q6H3Z9|GUN22_ORYSJ Endoglucanase 22 OS=Oryza sativa subsp. japonica GN=GLU11 PE=2 SV=2 69 514 6.0E-51
sp|P0C1U5|GUN14_ORYSJ Endoglucanase 14 OS=Oryza sativa subsp. japonica GN=Os05g0129200 PE=2 SV=1 69 514 1.0E-50
sp|Q69SG5|GUN24_ORYSJ Endoglucanase 24 OS=Oryza sativa subsp. japonica GN=Os09g0533900 PE=2 SV=1 35 500 1.0E-50
sp|Q5Z9P8|GUN18_ORYSJ Endoglucanase 18 OS=Oryza sativa subsp. japonica GN=Os06g0715300 PE=2 SV=1 56 510 1.0E-50
sp|Q69NF5|GUN23_ORYSJ Endoglucanase 23 OS=Oryza sativa subsp. japonica GN=GLU12 PE=2 SV=1 62 517 2.0E-50
sp|Q9CAC1|GUN8_ARATH Endoglucanase 8 OS=Arabidopsis thaliana GN=CEL1 PE=2 SV=1 70 521 2.0E-50
sp|Q652F9|GUN17_ORYSJ Endoglucanase 17 OS=Oryza sativa subsp. japonica GN=GLU13 PE=2 SV=1 62 515 3.0E-50
sp|P37700|GUNG_CLOCE Endoglucanase G OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=celCCG PE=1 SV=2 70 525 3.0E-50
sp|Q9SUS0|GUN20_ARATH Endoglucanase 20 OS=Arabidopsis thaliana GN=At4g23560 PE=2 SV=1 61 510 4.0E-50
sp|Q84Q51|GUN21_ORYSJ Endoglucanase 21 OS=Oryza sativa subsp. japonica GN=GLU9 PE=2 SV=1 65 522 6.0E-50
sp|P05522|GUN1_PERAE Endoglucanase 1 OS=Persea americana GN=CEL1 PE=2 SV=1 61 515 1.0E-49
sp|Q8GY58|GUN23_ARATH Endoglucanase 23 OS=Arabidopsis thaliana GN=At4g39000 PE=2 SV=2 54 515 2.0E-49
sp|Q9SZ90|GUN18_ARATH Endoglucanase 18 OS=Arabidopsis thaliana GN=At4g09740 PE=3 SV=2 66 510 2.0E-49
sp|Q6YXT7|GUN19_ORYSJ Endoglucanase 19 OS=Oryza sativa subsp. japonica GN=Os08g0114200 PE=2 SV=1 54 515 6.0E-49
sp|Q9SVJ4|GUN22_ARATH Endoglucanase 22 OS=Arabidopsis thaliana GN=GH9B16 PE=3 SV=1 62 515 1.0E-48
sp|Q654U4|GUN16_ORYSJ Endoglucanase 16 OS=Oryza sativa subsp. japonica GN=Os06g0247900 PE=2 SV=2 65 514 1.0E-48
sp|Q6Z2J3|GUN6_ORYSJ Endoglucanase 6 OS=Oryza sativa subsp. japonica GN=Os02g0733300 PE=2 SV=1 70 515 1.0E-48
sp|O49296|GUN4_ARATH Endoglucanase 4 OS=Arabidopsis thaliana GN=At1g23210 PE=2 SV=1 53 515 4.0E-48
sp|P22534|GUNA_CALSA Endoglucanase A OS=Caldicellulosiruptor saccharolyticus GN=celA PE=3 SV=2 70 510 1.0E-47
sp|Q8VYG3|GUN16_ARATH Endoglucanase 16 OS=Arabidopsis thaliana GN=At3g43860 PE=2 SV=1 70 493 3.0E-47
sp|Q93YQ7|GUN24_ARATH Endoglucanase 24 OS=Arabidopsis thaliana GN=At4g39010 PE=2 SV=1 62 515 4.0E-47
sp|Q6ZA06|GUN20_ORYSJ Endoglucanase 20 OS=Oryza sativa subsp. japonica GN=GLU15 PE=2 SV=1 66 502 4.0E-47
sp|Q7XTH4|GUN11_ORYSJ Endoglucanase 11 OS=Oryza sativa subsp. japonica GN=GLU4 PE=2 SV=3 56 515 3.0E-46
sp|Q6Z715|GUN4_ORYSJ Endoglucanase 4 OS=Oryza sativa subsp. japonica GN=GLU14 PE=2 SV=1 62 515 6.0E-46
sp|P22699|GUN6_DICDI Endoglucanase OS=Dictyostelium discoideum GN=celA PE=2 SV=1 48 510 9.0E-46
sp|P23659|GUNZ_CLOSR Endoglucanase Z OS=Clostridium stercorarium GN=celZ PE=1 SV=1 70 510 1.0E-42
sp|Q84R49|GUN10_ORYSJ Endoglucanase 10 OS=Oryza sativa subsp. japonica GN=GLU2 PE=2 SV=1 61 507 7.0E-39
sp|Q9STW8|GUN21_ARATH Endoglucanase 21 OS=Arabidopsis thaliana GN=KOR3 PE=2 SV=1 10 507 2.0E-38
sp|Q38890|GUN25_ARATH Endoglucanase 25 OS=Arabidopsis thaliana GN=KOR PE=1 SV=1 10 507 1.0E-35
sp|P0C1U4|GUN9_ORYSJ Endoglucanase 9 OS=Oryza sativa subsp. japonica GN=GLU1 PE=2 SV=1 70 507 3.0E-35
sp|Q7XUK4|GUN12_ORYSJ Endoglucanase 12 OS=Oryza sativa subsp. japonica GN=GLU3 PE=2 SV=2 61 507 4.0E-33
sp|O04478|GUN7_ARATH Endoglucanase 7 OS=Arabidopsis thaliana GN=KOR2 PE=2 SV=1 9 507 4.0E-31
sp|P23666|GUN2_PERAE Endoglucanase 2 (Fragment) OS=Persea americana GN=CEL2 PE=2 SV=1 418 515 6.0E-07
sp|P38534|GUNX_PRUPE Endoglucanase CX (Fragment) OS=Prunus persica PE=2 SV=1 189 442 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 564 586 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071660
MYRAVSFHSASRSMFLSLTVTSLLSLVSLCIAQLPLPVPPYLPPNASFGTIQSPSGRPNSQWTNLLGGLLYFYEA
QRSGQLPSETRVSWRNSSCLDDGKDVGLDLSGGYYDAGDYIKATFPLSFTLMSICWGATDFGQGYDLANQTAYLD
SMLRWGLDWLIKAHPNDNTLYVLVGNPTDDDDYWGGDLNIPTPRTSFRVDAAHPGTDVVAGTAAAFAACSNLYRN
KGFKNAPSGPAGLSNTSYADTLLAHAKSLYSFAVSATGGQRLYQESVPAVGRSYGSSDYGDELAIAALFLSWATD
SQDLFNQAASYWTQYHLDDEEGVFNWDSKSAGIPILFTQVLQSTTSVSGNIADWHSKAEDYLDKIVQRRSSGMMT
KGGLLYYNGDSDEASLNPAMNAAMLLTRYAPYASSPDKRNSYLKFAQSQVDYALGKNPMSAPYVIGINPNSPSNP
HSAMASGGSNIGAIDTDPVKTTYVLYGAVIGGPDVHDNYFDIRSDWPETEIALDYNAPFLTLAAYNVMQATADPF
YTNLQEGAYAKVKPTGQPCDAAIQTGCSRQRLSHGARIAISVVLAVVILATVGLIGYCIFWPKRKKVAY*
Coding >AgabiH97|071660
ATGTATAGAGCGGTATCTTTTCACTCAGCCTCTCGATCCATGTTCCTCTCTCTGACGGTCACTTCACTACTCAGC
CTCGTTTCCCTATGCATTGCCCAGCTCCCCCTACCAGTTCCCCCATACTTGCCCCCAAATGCATCGTTCGGCACC
ATCCAATCACCGAGTGGACGGCCAAATTCTCAGTGGACAAACCTTTTGGGTGGCTTACTATATTTCTATGAAGCC
CAGCGAAGCGGTCAACTTCCCAGTGAAACCCGAGTTTCTTGGCGTAATTCAAGTTGCCTCGATGACGGAAAGGAT
GTGGGACTTGATCTGAGTGGTGGATACTATGACGCAGGAGATTATATCAAAGCTACTTTCCCCCTCAGTTTCACG
CTCATGTCTATCTGCTGGGGGGCGACAGACTTTGGTCAAGGCTATGACCTTGCCAATCAAACGGCTTATTTGGAT
AGTATGCTACGCTGGGGACTCGATTGGCTTATTAAAGCACATCCAAATGACAATACCCTATACGTTTTGGTCGGA
AATCCCACGGATGATGATGACTACTGGGGTGGTGACCTTAACATCCCAACCCCTCGAACATCCTTCCGAGTCGAC
GCAGCGCACCCCGGTACTGATGTTGTCGCGGGTACGGCCGCTGCGTTTGCTGCATGTTCCAATCTATACCGCAAT
AAAGGATTCAAGAATGCCCCCTCAGGACCTGCCGGACTTTCGAATACTTCCTATGCTGATACCCTTTTAGCTCAT
GCTAAATCTCTGTACTCTTTCGCTGTAAGTGCTACAGGGGGTCAGAGGCTGTATCAGGAATCCGTTCCTGCCGTC
GGTAGAAGTTATGGGTCGTCTGATTACGGAGACGAGCTCGCTATAGCGGCTCTGTTCTTATCCTGGGCAACAGAC
TCGCAGGATTTATTTAACCAAGCGGCCTCATACTGGACACAGTATCATCTAGATGATGAAGAAGGTGTCTTCAAC
TGGGATAGCAAATCAGCTGGGATTCCTATCCTGTTTACTCAAGTTTTACAGAGCACGACCTCCGTCTCTGGTAAC
ATCGCCGATTGGCATTCCAAAGCCGAAGATTATCTCGACAAGATCGTACAACGTCGCAGCTCAGGAATGATGACC
AAAGGCGGACTACTATATTACAATGGTGACTCAGACGAAGCCAGTCTAAACCCAGCTATGAACGCCGCCATGCTC
CTGACACGCTATGCACCATATGCCTCGTCGCCTGACAAAAGAAATTCATATCTGAAATTCGCTCAATCTCAAGTG
GACTATGCTTTGGGCAAGAACCCAATGTCAGCTCCATACGTCATCGGCATCAATCCCAATTCACCATCCAATCCC
CATTCAGCAATGGCTAGCGGCGGATCAAATATCGGCGCAATCGACACTGATCCCGTGAAGACGACATACGTCCTC
TACGGAGCGGTTATCGGTGGACCTGACGTGCATGATAATTATTTCGACATCCGAAGCGATTGGCCAGAAACCGAA
ATTGCCTTGGATTACAATGCTCCGTTCCTGACTCTAGCAGCCTATAATGTCATGCAAGCTACAGCTGACCCTTTC
TACACCAATTTACAGGAGGGTGCTTATGCAAAGGTCAAGCCTACTGGACAACCTTGTGATGCCGCCATCCAAACT
GGTTGTTCAAGACAACGACTCAGTCATGGAGCTCGTATTGCAATTTCAGTTGTTCTCGCTGTCGTTATCCTCGCA
ACCGTTGGTCTGATCGGCTATTGTATCTTCTGGCCGAAGCGCAAGAAGGTTGCATATTAG
Transcript >AgabiH97|071660
ATGTATAGAGCGGTATCTTTTCACTCAGCCTCTCGATCCATGTTCCTCTCTCTGACGGTCACTTCACTACTCAGC
CTCGTTTCCCTATGCATTGCCCAGCTCCCCCTACCAGTTCCCCCATACTTGCCCCCAAATGCATCGTTCGGCACC
ATCCAATCACCGAGTGGACGGCCAAATTCTCAGTGGACAAACCTTTTGGGTGGCTTACTATATTTCTATGAAGCC
CAGCGAAGCGGTCAACTTCCCAGTGAAACCCGAGTTTCTTGGCGTAATTCAAGTTGCCTCGATGACGGAAAGGAT
GTGGGACTTGATCTGAGTGGTGGATACTATGACGCAGGAGATTATATCAAAGCTACTTTCCCCCTCAGTTTCACG
CTCATGTCTATCTGCTGGGGGGCGACAGACTTTGGTCAAGGCTATGACCTTGCCAATCAAACGGCTTATTTGGAT
AGTATGCTACGCTGGGGACTCGATTGGCTTATTAAAGCACATCCAAATGACAATACCCTATACGTTTTGGTCGGA
AATCCCACGGATGATGATGACTACTGGGGTGGTGACCTTAACATCCCAACCCCTCGAACATCCTTCCGAGTCGAC
GCAGCGCACCCCGGTACTGATGTTGTCGCGGGTACGGCCGCTGCGTTTGCTGCATGTTCCAATCTATACCGCAAT
AAAGGATTCAAGAATGCCCCCTCAGGACCTGCCGGACTTTCGAATACTTCCTATGCTGATACCCTTTTAGCTCAT
GCTAAATCTCTGTACTCTTTCGCTGTAAGTGCTACAGGGGGTCAGAGGCTGTATCAGGAATCCGTTCCTGCCGTC
GGTAGAAGTTATGGGTCGTCTGATTACGGAGACGAGCTCGCTATAGCGGCTCTGTTCTTATCCTGGGCAACAGAC
TCGCAGGATTTATTTAACCAAGCGGCCTCATACTGGACACAGTATCATCTAGATGATGAAGAAGGTGTCTTCAAC
TGGGATAGCAAATCAGCTGGGATTCCTATCCTGTTTACTCAAGTTTTACAGAGCACGACCTCCGTCTCTGGTAAC
ATCGCCGATTGGCATTCCAAAGCCGAAGATTATCTCGACAAGATCGTACAACGTCGCAGCTCAGGAATGATGACC
AAAGGCGGACTACTATATTACAATGGTGACTCAGACGAAGCCAGTCTAAACCCAGCTATGAACGCCGCCATGCTC
CTGACACGCTATGCACCATATGCCTCGTCGCCTGACAAAAGAAATTCATATCTGAAATTCGCTCAATCTCAAGTG
GACTATGCTTTGGGCAAGAACCCAATGTCAGCTCCATACGTCATCGGCATCAATCCCAATTCACCATCCAATCCC
CATTCAGCAATGGCTAGCGGCGGATCAAATATCGGCGCAATCGACACTGATCCCGTGAAGACGACATACGTCCTC
TACGGAGCGGTTATCGGTGGACCTGACGTGCATGATAATTATTTCGACATCCGAAGCGATTGGCCAGAAACCGAA
ATTGCCTTGGATTACAATGCTCCGTTCCTGACTCTAGCAGCCTATAATGTCATGCAAGCTACAGCTGACCCTTTC
TACACCAATTTACAGGAGGGTGCTTATGCAAAGGTCAAGCCTACTGGACAACCTTGTGATGCCGCCATCCAAACT
GGTTGTTCAAGACAACGACTCAGTCATGGAGCTCGTATTGCAATTTCAGTTGTTCTCGCTGTCGTTATCCTCGCA
ACCGTTGGTCTGATCGGCTATTGTATCTTCTGGCCGAAGCGCAAGAAGGTTGCATATTAG
Gene >AgabiH97|071660
ATGTATAGAGCGGTATCTTTTCACGTGAGTCTGGTAGACGAAAGGCTATTTTTAGGTTTAATTTCACGGAACGTA
CTTAATGTTGTTAATTGATACTGCAGTCAGCCTCTCGATCCATGTTCCTCTCTCTGACGGTCACTTCACTACTCA
GCCTCGTTTCCCTATGCATTGCCCAGCTCCCCCTACCAGTTCCCCCATACTTGCCCCCAAATGCATCGTTCGGCA
CCATCCAATCACCGAGTGGACGGCCAAATTCTCAGTGGACAAACCTTTTGGGTGGCTTACTATATTTCTATGAAG
CCCAGCGAAGCGGTCAACTTCCCAGTGAAACCCGAGTTTCTTGGCGTAATTCAAGTTGCCTCGATGACGGAAAGG
ATGTGGGACTTGATCTGAGTGGTGAGCAGATTCCCTTCAAACTTCCAGTTCGTCGTAATATCGACCCGGTGTACA
GGTGGATACTATGACGCAGGAGGTGATTATCCTCGTTCATCCCTCCTGATTACTCTTGCTCATGCTGTTCGACAA
GATTATATCAAAGCTACTTTCCCCCTCGTAAGTTGATTTTCAGCCTCTTTATTTCGGAACGTGACGCATCGTTTC
AGAGTTTCACGCTCATGTCTATCTGCTGGGGGGCGACAGACTTTGGTCAAGGTAAAAAAAATTTGCTCCCGCGTT
CCGTATTGACACTCAGTCATCAGGCTATGACCTTGCCAATCAAACGGCTTATTTGGATAGTATGCTACGCTGGGG
ACTCGATTGGCTTATTAAAGTGTGATCTATTTATATTCATCTCCACTCGGAGCTAATCATACAACTGCCAAGGCA
CATCCAAATGACAATACCCTATACGTTTTGGTCGGAAATCGTCAGTTCATCAAACACGACTTTTCTCCAGAAGAA
TATGCCCTGATTGCTTTCCACAAACAGCCACGGATGATGATGACTACTGGGGTGGTGACCTTAACATCCCAACCC
CTCGAACATCCTTCCGAGTCGACGCAGCGCACCCCGGTACTGATGTTGTCGCGGGTACGGCCGCTGCGTTTGCTG
CATGTTCCAATCTATACCGCAATAAAGGATTCAAGAATGCCCCCTCAGGACCTGCCGGACTTTCGAATACTTCCT
ATGCTGATACCCTTTTAGCTCATGCTAAATCTCTGTACTCTTTCGCTGTAAGTGCTACAGGGGGTCAGAGGCTGT
ATCAGGAATCCGTTCCTGCCGTCGGTAGAAGTTATGGGTCGTCTGATTACGGAGACGAGCTCGCTATAGCGGCTC
TGTTCTTATCCTGGGCAACAGACTCGCAGGATTTATTTAACCAAGCGGCCTCATACTGGACACAGTATCATCTAG
ATGATGAAGAAGGTGTCTTCAACTGGGATAGCAAATCAGCTGGGATTCCTATCCTGTTTACTCAAGTTTTACAGA
GCACGACCTCCGTCTCTGGTAACATCGCCGATTGGCATTCCAAAGCCGAAGATTATCTCGACAAGATCGTACAAC
GTCGCAGCTCAGGAATGATGACCAAAGGCACGTCCAATCCACCGTCATGCTCGTTCGAGCTTACTGACTTTTTGC
CATAGGCGGACTACTATATTACAATGGTGACTCAGACGAAGCCAGTCTAAACCCAGCTATGAACGCCGCCATGCT
CCTGACACGCTATGCACCATATGCCTCGTCGCCTGACAAAAGAAATTCATATCTGGTTAGTGATCTTCTGCCTCC
CGCACGTCCATAGTTCTCACAACATGCAATTACCGTTTGCCATAGAAATTCGCTCAATCTCAAGTGGACTATGCT
TTGGGCAAGAACCCAATGTCAGGTTAGCCCATTCGCCAGTCCTTTTTACATTTTGACATTACGCCACAAATCCTA
TAGCTCCATACGTCATCGGCATCAATCCCAATTCACCATCCAATCCCCATTCAGCAATGGCTAGCGGCGGATCAA
ATATCGGCGCAATCGACACTGATCCCGTGAAGACGACATACGTCCTCTACGGAGCGGTTATCGGTGGACCTGACG
TGCATGATAATTATTTCGACATCCGAAGCGATTGGCCAGAAACCGAAGTGAGCTACCTTGATAAGTAATTTCTCG
GCTGCGATGGAAATTGACACTTTTCGCATTCTAGATTGCCTTGGATTACAATGCTCCGTTCCTGACTCTAGCAGC
CTATAATGTCATGCAAGCTACAGCTGACCCTTTCTACACCAATTTACAGGAGGGTGCTTATGCAAAGGTCAAGCC
TACTGGACAACCTTGTGATGCCGCCATCCAAACTGGTTGTTCAAGACAACGACTCAGTCATGGAGCTCGTATTGC
AATTTCAGTTGTTCTCGCTGTCGTTATCCTCGCAACCGTTGGTCTGATCGGCTATTGTATCTTCTGGCCGAAGCG
CAAGAAGGTTGCATATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail