© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|071520 |
| Gene name | |
| Location | scaffold_4:1528345..1530126 |
| Strand | - |
| Gene length (bp) | 1781 |
| Transcript length (bp) | 1299 |
| Coding sequence length (bp) | 1299 |
| Protein length (aa) | 433 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00155 | Aminotran_1_2 | Aminotransferase class I and II | 3.0E-62 | 43 | 424 |
| PF01041 | DegT_DnrJ_EryC1 | DegT/DnrJ/EryC1/StrS aminotransferase family | 2.2E-05 | 107 | 225 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O14209|YDT4_SCHPO | Uncharacterized aminotransferase C6B12.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6B12.04c PE=3 SV=1 | 30 | 430 | 3.0E-141 |
| sp|P47039|BNA3_YEAST | Probable kynurenine--oxoglutarate transaminase BNA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA3 PE=1 SV=1 | 43 | 431 | 1.0E-122 |
| sp|Q54KM6|KAT_DICDI | Kynurenine--oxoglutarate transaminase OS=Dictyostelium discoideum GN=ccbl PE=3 SV=1 | 22 | 429 | 8.0E-110 |
| sp|Q7T3E5|KAT3_DANRE | Kynurenine--oxoglutarate transaminase 3 OS=Danio rerio GN=ccbl2 PE=2 SV=2 | 22 | 420 | 2.0E-91 |
| sp|Q08415|KAT1_RAT | Kynurenine--oxoglutarate transaminase 1, mitochondrial OS=Rattus norvegicus GN=Ccbl1 PE=1 SV=1 | 15 | 429 | 6.0E-88 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O14209|YDT4_SCHPO | Uncharacterized aminotransferase C6B12.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6B12.04c PE=3 SV=1 | 30 | 430 | 3.0E-141 |
| sp|P47039|BNA3_YEAST | Probable kynurenine--oxoglutarate transaminase BNA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA3 PE=1 SV=1 | 43 | 431 | 1.0E-122 |
| sp|Q54KM6|KAT_DICDI | Kynurenine--oxoglutarate transaminase OS=Dictyostelium discoideum GN=ccbl PE=3 SV=1 | 22 | 429 | 8.0E-110 |
| sp|Q7T3E5|KAT3_DANRE | Kynurenine--oxoglutarate transaminase 3 OS=Danio rerio GN=ccbl2 PE=2 SV=2 | 22 | 420 | 2.0E-91 |
| sp|Q08415|KAT1_RAT | Kynurenine--oxoglutarate transaminase 1, mitochondrial OS=Rattus norvegicus GN=Ccbl1 PE=1 SV=1 | 15 | 429 | 6.0E-88 |
| sp|Q6YP21|KAT3_HUMAN | Kynurenine--oxoglutarate transaminase 3 OS=Homo sapiens GN=CCBL2 PE=1 SV=1 | 26 | 422 | 8.0E-88 |
| sp|Q8BTY1|KAT1_MOUSE | Kynurenine--oxoglutarate transaminase 1 OS=Mus musculus GN=Ccbl1 PE=1 SV=1 | 18 | 424 | 9.0E-87 |
| sp|Q0P5G4|KAT3_BOVIN | Kynurenine--oxoglutarate transaminase 3 OS=Bos taurus GN=CCBL2 PE=2 SV=1 | 25 | 422 | 2.0E-84 |
| sp|Q58FK9|KAT3_RAT | Kynurenine--oxoglutarate transaminase 3 OS=Rattus norvegicus GN=Ccbl2 PE=2 SV=1 | 26 | 425 | 6.0E-83 |
| sp|Q71RI9|KAT3_MOUSE | Kynurenine--oxoglutarate transaminase 3 OS=Mus musculus GN=Ccbl2 PE=1 SV=1 | 26 | 425 | 8.0E-83 |
| sp|Q16773|KAT1_HUMAN | Kynurenine--oxoglutarate transaminase 1 OS=Homo sapiens GN=CCBL1 PE=1 SV=1 | 32 | 428 | 3.0E-81 |
| sp|Q9V0L2|AAT_PYRAB | Aspartate aminotransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspC PE=3 SV=1 | 43 | 427 | 2.0E-63 |
| sp|P9WPZ5|DAPC_MYCTU | Probable N-succinyldiaminopimelate aminotransferase DapC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dapC PE=1 SV=1 | 19 | 429 | 4.0E-62 |
| sp|P9WPZ4|DAPC_MYCTO | Probable N-succinyldiaminopimelate aminotransferase DapC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dapC PE=1 SV=1 | 19 | 429 | 4.0E-62 |
| sp|H3ZPU1|ARAT2_THELN | Aromatic-amino-acid aminotransferase 2 OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=OCC_04737 PE=1 SV=1 | 44 | 429 | 3.0E-55 |
| sp|P77806|YBDL_ECOLI | Methionine aminotransferase OS=Escherichia coli (strain K12) GN=ybdL PE=1 SV=1 | 27 | 427 | 3.0E-53 |
| sp|Q56232|AAT_THET8 | Aspartate aminotransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=aspC PE=1 SV=1 | 43 | 427 | 3.0E-51 |
| sp|O33822|AAT_THEAQ | Aspartate aminotransferase OS=Thermus aquaticus GN=aspC PE=3 SV=1 | 43 | 426 | 2.0E-50 |
| sp|O58489|AAT_PYRHO | Aspartate aminotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspC PE=3 SV=1 | 43 | 426 | 2.0E-47 |
| sp|Q60317|AAT_METJA | Probable aspartate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0001 PE=3 SV=1 | 43 | 352 | 4.0E-46 |
| sp|Q9X0Y2|AAT_THEMA | Aspartate aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aspC PE=1 SV=1 | 43 | 425 | 1.0E-44 |
| sp|Q795M6|YUGH_BACSU | Putative aminotransferase YugH OS=Bacillus subtilis (strain 168) GN=yugH PE=3 SV=1 | 45 | 426 | 2.0E-43 |
| sp|Q9HUI9|ARUH_PSEAE | Arginine--pyruvate transaminase AruH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruH PE=1 SV=1 | 47 | 351 | 6.0E-43 |
| sp|P16524|PATA_BACSU | Putative N-acetyl-LL-diaminopimelate aminotransferase OS=Bacillus subtilis (strain 168) GN=patA PE=1 SV=3 | 43 | 425 | 1.0E-41 |
| sp|E9L7A5|PAT_PETHY | Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Petunia hybrida PE=1 SV=1 | 45 | 432 | 2.0E-41 |
| sp|Q4J8X2|AAT_SULAC | Aspartate aminotransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=aspC PE=3 SV=1 | 44 | 423 | 5.0E-40 |
| sp|Q55128|AAT_SYNY3 | Aspartate aminotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aspC PE=3 SV=1 | 43 | 424 | 7.0E-40 |
| sp|O67781|AAT_AQUAE | Aspartate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=aspC PE=3 SV=1 | 43 | 422 | 8.0E-40 |
| sp|P14909|AAT_SULSO | Aspartate aminotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspC PE=1 SV=2 | 44 | 430 | 2.0E-39 |
| sp|Q59228|AAT_GEOSE | Aspartate aminotransferase OS=Geobacillus stearothermophilus GN=aspC PE=3 SV=1 | 43 | 426 | 3.0E-39 |
| sp|P53001|AAT1_BACSU | Aspartate aminotransferase OS=Bacillus subtilis (strain 168) GN=aspB PE=3 SV=1 | 43 | 426 | 1.0E-38 |
| sp|Q9SIE1|PAT_ARATH | Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Arabidopsis thaliana GN=PAT PE=1 SV=2 | 45 | 426 | 2.0E-38 |
| sp|P23034|AAT_BACY2 | Aspartate aminotransferase OS=Bacillus sp. (strain YM-2) PE=1 SV=1 | 43 | 352 | 4.0E-38 |
| sp|O66630|DAPAT_AQUAE | LL-diaminopimelate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=dapL PE=3 SV=1 | 43 | 428 | 1.0E-37 |
| sp|Q972A2|AAT_SULTO | Aspartate aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspC PE=3 SV=1 | 44 | 426 | 4.0E-37 |
| sp|Q5F4K8|PAT_PINPS | Aspartate aminotransferase OS=Pinus pinaster GN=AAT PE=1 SV=1 | 13 | 353 | 3.0E-36 |
| sp|Q06191|AATB_RHIML | Aspartate aminotransferase B OS=Rhizobium meliloti GN=aatB PE=3 SV=1 | 45 | 412 | 1.0E-35 |
| sp|P58350|AATB_RHIME | Aspartate aminotransferase B OS=Rhizobium meliloti (strain 1021) GN=aatB PE=3 SV=1 | 45 | 413 | 2.0E-35 |
| sp|Q60013|AAT_STRVG | Aspartate aminotransferase OS=Streptomyces virginiae GN=aspC PE=3 SV=1 | 44 | 427 | 7.0E-35 |
| sp|Q92JE7|AAT_RICCN | Aspartate aminotransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=aatA PE=3 SV=1 | 43 | 426 | 1.0E-34 |
| sp|Q4UND3|AAT_RICFE | Aspartate aminotransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=aatA PE=3 SV=1 | 43 | 426 | 2.0E-34 |
| sp|Q02635|AATA_RHIME | Aspartate aminotransferase A OS=Rhizobium meliloti (strain 1021) GN=aatA PE=3 SV=1 | 43 | 347 | 8.0E-34 |
| sp|Q58097|MFNC_METJA | (5-formylfuran-3-yl)methyl phosphate transaminase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=mfnC PE=1 SV=2 | 44 | 426 | 3.0E-33 |
| sp|Q68XV9|AAT_RICTY | Aspartate aminotransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=aatA PE=3 SV=1 | 43 | 354 | 7.0E-33 |
| sp|Q1RGV0|AAT_RICBR | Aspartate aminotransferase OS=Rickettsia bellii (strain RML369-C) GN=aatA PE=3 SV=1 | 43 | 426 | 9.0E-33 |
| sp|B2A250|DAPAT_NATTJ | LL-diaminopimelate aminotransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=dapL PE=3 SV=1 | 43 | 423 | 4.0E-32 |
| sp|Q9ZE56|AAT_RICPR | Aspartate aminotransferase OS=Rickettsia prowazekii (strain Madrid E) GN=aatA PE=3 SV=2 | 43 | 354 | 4.0E-32 |
| sp|B8DJJ6|DAPAT_DESVM | LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dapL PE=3 SV=1 | 43 | 427 | 2.0E-31 |
| sp|Q72BI1|DAPAT_DESVH | LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dapL PE=3 SV=1 | 43 | 427 | 2.0E-30 |
| sp|P77434|ALAC_ECOLI | Glutamate-pyruvate aminotransferase AlaC OS=Escherichia coli (strain K12) GN=alaC PE=1 SV=1 | 43 | 420 | 3.0E-30 |
| sp|A1VDD3|DAPAT_DESVV | LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dapL PE=3 SV=1 | 43 | 427 | 4.0E-30 |
| sp|Q30ZX9|DAPAT_DESAG | LL-diaminopimelate aminotransferase OS=Desulfovibrio alaskensis (strain G20) GN=dapL PE=3 SV=1 | 43 | 427 | 4.0E-30 |
| sp|C6BUK3|DAPAT_DESAD | LL-diaminopimelate aminotransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dapL PE=3 SV=1 | 43 | 427 | 2.0E-29 |
| sp|A0LEA5|DAPAT_SYNFM | LL-diaminopimelate aminotransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dapL PE=1 SV=1 | 43 | 427 | 2.0E-29 |
| sp|O86459|AAT_RHILP | Aspartate aminotransferase OS=Rhizobium leguminosarum bv. phaseoli GN=aspC PE=3 SV=1 | 43 | 347 | 9.0E-29 |
| sp|P0A961|ALAA_SHIFL | Glutamate-pyruvate aminotransferase AlaA OS=Shigella flexneri GN=alaA PE=3 SV=1 | 76 | 356 | 1.0E-28 |
| sp|P0A959|ALAA_ECOLI | Glutamate-pyruvate aminotransferase AlaA OS=Escherichia coli (strain K12) GN=alaA PE=1 SV=1 | 76 | 356 | 1.0E-28 |
| sp|P0A960|ALAA_ECOL6 | Glutamate-pyruvate aminotransferase AlaA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=alaA PE=3 SV=1 | 76 | 356 | 1.0E-28 |
| sp|Q3AC10|DAPAT_CARHZ | LL-diaminopimelate aminotransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dapL PE=3 SV=1 | 43 | 426 | 2.0E-27 |
| sp|P71348|ALAA_HAEIN | Glutamate-pyruvate aminotransferase AlaA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=alaA PE=3 SV=1 | 76 | 356 | 2.0E-27 |
| sp|Q2RK33|DAPAT_MOOTA | LL-diaminopimelate aminotransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=dapL PE=1 SV=1 | 43 | 347 | 7.0E-27 |
| sp|O07587|AAT3_BACSU | Putative aspartate aminotransferase YhdR OS=Bacillus subtilis (strain 168) GN=yhdR PE=3 SV=1 | 76 | 348 | 2.0E-26 |
| sp|B1I544|DAPAT_DESAP | LL-diaminopimelate aminotransferase OS=Desulforudis audaxviator (strain MP104C) GN=dapL PE=3 SV=1 | 43 | 347 | 2.0E-25 |
| sp|B8CX89|DAPAT_HALOH | LL-diaminopimelate aminotransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dapL PE=3 SV=1 | 43 | 425 | 2.0E-25 |
| sp|O87320|AATC_RHIME | Putative aminotransferase AatC OS=Rhizobium meliloti (strain 1021) GN=aatC PE=3 SV=2 | 43 | 346 | 7.0E-25 |
| sp|P33447|ATTY_TRYCR | Tyrosine aminotransferase OS=Trypanosoma cruzi PE=1 SV=2 | 65 | 351 | 7.0E-25 |
| sp|Q3MDN5|DAPT2_ANAVT | LL-diaminopimelate aminotransferase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dapL2 PE=3 SV=1 | 43 | 279 | 3.0E-24 |
| sp|Q7NDX4|DAPAT_GLOVI | LL-diaminopimelate aminotransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=dapL PE=1 SV=1 | 43 | 356 | 4.0E-24 |
| sp|P9WQ91|AAT_MYCTU | Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aspC PE=1 SV=1 | 76 | 275 | 8.0E-24 |
| sp|P9WQ90|AAT_MYCTO | Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aspC PE=3 SV=1 | 76 | 275 | 8.0E-24 |
| sp|P63499|AAT_MYCBO | Probable aspartate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aspC PE=3 SV=1 | 76 | 275 | 8.0E-24 |
| sp|P39643|AAT2_BACSU | Probable aspartate aminotransferase OS=Bacillus subtilis (strain 168) GN=ywfG PE=3 SV=1 | 44 | 354 | 1.0E-23 |
| sp|O31665|MTNE_BACSU | Transaminase MtnE OS=Bacillus subtilis (strain 168) GN=mtnE PE=3 SV=1 | 43 | 432 | 2.0E-23 |
| sp|Q8YP73|DAPT2_NOSS1 | LL-diaminopimelate aminotransferase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dapL2 PE=3 SV=1 | 43 | 273 | 2.0E-23 |
| sp|Q3Z8H5|DAPAT_DEHM1 | LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dapL PE=3 SV=1 | 43 | 347 | 4.0E-23 |
| sp|A5FRC5|DAPAT_DEHMB | LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dapL PE=3 SV=1 | 43 | 360 | 1.0E-22 |
| sp|Q3ZXC8|DAPAT_DEHMC | LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=dapL PE=3 SV=1 | 43 | 360 | 8.0E-22 |
| sp|Q8QZR1|ATTY_MOUSE | Tyrosine aminotransferase OS=Mus musculus GN=Tat PE=1 SV=1 | 60 | 368 | 9.0E-22 |
| sp|P04694|ATTY_RAT | Tyrosine aminotransferase OS=Rattus norvegicus GN=Tat PE=1 SV=1 | 60 | 368 | 2.0E-21 |
| sp|Q9LVY1|TAT_ARATH | Tyrosine aminotransferase OS=Arabidopsis thaliana GN=TAT PE=2 SV=1 | 33 | 272 | 1.0E-20 |
| sp|Q58365|HIS8_METJA | Histidinol-phosphate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisC PE=3 SV=1 | 41 | 376 | 5.0E-20 |
| sp|O93744|AAT_THEKO | Aspartate aminotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aspC PE=3 SV=1 | 29 | 370 | 3.0E-19 |
| sp|Q58CZ9|ATTY_BOVIN | Tyrosine aminotransferase OS=Bos taurus GN=TAT PE=2 SV=1 | 60 | 368 | 3.0E-19 |
| sp|P17735|ATTY_HUMAN | Tyrosine aminotransferase OS=Homo sapiens GN=TAT PE=1 SV=1 | 60 | 404 | 6.0E-19 |
| sp|Q54K95|ATTY_DICDI | Tyrosine aminotransferase OS=Dictyostelium discoideum GN=tat PE=3 SV=1 | 74 | 424 | 2.0E-18 |
| sp|Q9FN30|TAT2_ARATH | Probable aminotransferase TAT2 OS=Arabidopsis thaliana GN=At5g53970 PE=2 SV=1 | 45 | 430 | 3.0E-18 |
| sp|P36692|AAT_STRGR | Probable aspartate aminotransferase (Fragment) OS=Streptomyces griseus GN=aspC PE=3 SV=2 | 44 | 227 | 3.0E-18 |
| sp|Q9SIV0|SUR1_ARATH | S-alkyl-thiohydroximate lyase SUR1 OS=Arabidopsis thaliana GN=SUR1 PE=1 SV=1 | 62 | 334 | 5.0E-18 |
| sp|Q84CG1|CAMYS_STRVI | Capreomycidine synthase OS=Streptomyces vinaceus GN=vioD PE=1 SV=1 | 107 | 326 | 6.0E-18 |
| sp|Q9SK47|TAT3_ARATH | Probable aminotransferase TAT3 OS=Arabidopsis thaliana GN=TAT3 PE=2 SV=1 | 74 | 314 | 8.0E-18 |
| sp|Q46E46|HIS8_METBF | Histidinol-phosphate aminotransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisC PE=3 SV=1 | 41 | 376 | 1.0E-17 |
| sp|Q58786|DAPAT_METJA | LL-diaminopimelate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dapL PE=1 SV=1 | 37 | 349 | 2.0E-17 |
| sp|Q67Y55|TAT1_ARATH | Probable aminotransferase TAT1 OS=Arabidopsis thaliana GN=At4g28420 PE=2 SV=1 | 60 | 281 | 5.0E-17 |
| sp|Q8TUE9|HIS8_METAC | Histidinol-phosphate aminotransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisC PE=3 SV=1 | 41 | 376 | 5.0E-16 |
| sp|Q2IS68|HIS8_RHOP2 | Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=hisC PE=3 SV=1 | 64 | 349 | 5.0E-16 |
| sp|Q9ST02|NAATA_HORVU | Nicotianamine aminotransferase A OS=Hordeum vulgare GN=naat-A PE=1 SV=2 | 74 | 352 | 7.0E-16 |
| sp|Q9ST03|NAATB_HORVU | Nicotianamine aminotransferase B OS=Hordeum vulgare GN=naat-B PE=1 SV=2 | 106 | 352 | 1.0E-15 |
| sp|Q9ZQI7|ALD1_ARATH | Aminotransferase ALD1 OS=Arabidopsis thaliana GN=ALD1 PE=1 SV=2 | 45 | 337 | 5.0E-15 |
| sp|A6UTL8|HIS8_META3 | Histidinol-phosphate aminotransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisC PE=3 SV=1 | 41 | 376 | 5.0E-15 |
| sp|Q89UL9|HIS82_BRADU | Histidinol-phosphate aminotransferase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisC2 PE=3 SV=1 | 64 | 359 | 7.0E-15 |
| sp|A6VGF6|HIS8_METM7 | Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisC PE=3 SV=1 | 41 | 377 | 2.0E-14 |
| sp|Q0BVW4|HIS8_GRABC | Histidinol-phosphate aminotransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=hisC PE=3 SV=1 | 45 | 353 | 3.0E-14 |
| sp|Q8PX17|HIS8_METMA | Histidinol-phosphate aminotransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisC PE=3 SV=1 | 41 | 376 | 3.0E-14 |
| sp|Q31GD4|HIS82_THICR | Histidinol-phosphate aminotransferase 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=hisC2 PE=3 SV=1 | 105 | 374 | 5.0E-14 |
| sp|Q0C348|HIS8_HYPNA | Histidinol-phosphate aminotransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisC PE=3 SV=1 | 105 | 355 | 6.0E-14 |
| sp|Q08432|CBL_BACSU | Cystathionine beta-lyase PatB OS=Bacillus subtilis (strain 168) GN=patB PE=1 SV=1 | 52 | 352 | 7.0E-14 |
| sp|A9AA96|HIS8_METM6 | Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisC PE=3 SV=1 | 41 | 377 | 7.0E-14 |
| sp|A6UPL6|HIS8_METVS | Histidinol-phosphate aminotransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisC PE=3 SV=1 | 112 | 377 | 1.0E-13 |
| sp|Q6LX26|DAPAT_METMP | LL-diaminopimelate aminotransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=dapL PE=1 SV=1 | 43 | 349 | 1.0E-13 |
| sp|P61003|HIS8_METMP | Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=hisC PE=3 SV=1 | 65 | 377 | 2.0E-13 |
| sp|B3Q8Z5|HIS8_RHOPT | Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisC PE=3 SV=1 | 64 | 339 | 2.0E-13 |
| sp|P61002|HIS8_RHOPA | Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisC PE=3 SV=1 | 64 | 339 | 2.0E-13 |
| sp|A4FWW1|HIS8_METM5 | Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisC PE=3 SV=1 | 41 | 377 | 3.0E-13 |
| sp|C0ZCE7|HIS8_BREBN | Histidinol-phosphate aminotransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hisC PE=3 SV=1 | 105 | 351 | 3.0E-13 |
| sp|Q9CBM9|CBL_MYCLE | Putative cystathionine beta-lyase OS=Mycobacterium leprae (strain TN) GN=ML1794 PE=3 SV=1 | 41 | 358 | 6.0E-13 |
| sp|Q970Z4|HIS8_SULTO | Histidinol-phosphate aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hisC PE=3 SV=2 | 43 | 337 | 6.0E-13 |
| sp|Q07IG8|HIS8_RHOP5 | Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=hisC PE=3 SV=1 | 64 | 349 | 7.0E-13 |
| sp|Q8GYY0|1A112_ARATH | Probable aminotransferase ACS12 OS=Arabidopsis thaliana GN=ACS12 PE=2 SV=2 | 44 | 271 | 9.0E-13 |
| sp|Q9SUR6|CORI3_ARATH | Cystine lyase CORI3 OS=Arabidopsis thaliana GN=CORI3 PE=1 SV=1 | 74 | 333 | 9.0E-13 |
| sp|B8D707|HIS8_BUCAT | Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=hisC PE=3 SV=1 | 105 | 318 | 1.0E-12 |
| sp|B8D8Q3|HIS8_BUCA5 | Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=hisC PE=3 SV=1 | 105 | 318 | 1.0E-12 |
| sp|P57202|HIS8_BUCAI | Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hisC PE=3 SV=1 | 105 | 318 | 1.0E-12 |
| sp|Q8TVG3|HIS8_METKA | Histidinol-phosphate aminotransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisC PE=3 SV=1 | 41 | 376 | 1.0E-12 |
| sp|Q4FP52|HIS8_PELUB | Histidinol-phosphate aminotransferase OS=Pelagibacter ubique (strain HTCC1062) GN=hisC PE=3 SV=1 | 77 | 362 | 2.0E-12 |
| sp|Q1QQD5|HIS8_NITHX | Histidinol-phosphate aminotransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisC PE=3 SV=1 | 78 | 349 | 2.0E-12 |
| sp|Q20YH9|HIS8_RHOPB | Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=hisC PE=3 SV=1 | 78 | 357 | 2.0E-12 |
| sp|A8MEH2|HIS8_ALKOO | Histidinol-phosphate aminotransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=hisC PE=3 SV=1 | 99 | 304 | 3.0E-12 |
| sp|Q5HR08|HIS8_STAEQ | Histidinol-phosphate aminotransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisC PE=3 SV=1 | 54 | 320 | 3.0E-12 |
| sp|Q8CTG8|HIS8_STAES | Histidinol-phosphate aminotransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisC PE=3 SV=1 | 54 | 320 | 3.0E-12 |
| sp|A5UKY0|HIS8_METS3 | Histidinol-phosphate aminotransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hisC PE=3 SV=1 | 43 | 376 | 4.0E-12 |
| sp|Q8VYP2|TAT4_ARATH | Probable aminotransferase TAT4 OS=Arabidopsis thaliana GN=At4g23590 PE=2 SV=1 | 171 | 271 | 4.0E-12 |
| sp|P9WQ83|CBL_MYCTU | Putative cystathionine beta-lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2294 PE=1 SV=1 | 41 | 356 | 7.0E-12 |
| sp|P9WQ82|CBL_MYCTO | Putative cystathionine beta-lyase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2351 PE=3 SV=1 | 41 | 356 | 7.0E-12 |
| sp|P63503|CBL_MYCBO | Putative cystathionine beta-lyase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2316 PE=3 SV=1 | 41 | 356 | 7.0E-12 |
| sp|B8FP20|HIS8_DESHD | Histidinol-phosphate aminotransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hisC PE=3 SV=1 | 42 | 278 | 1.0E-11 |
| sp|Q0W253|HIS8_METAR | Histidinol-phosphate aminotransferase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisC PE=3 SV=1 | 64 | 274 | 1.0E-11 |
| sp|B3QP11|HIS8_CHLP8 | Histidinol-phosphate aminotransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisC PE=3 SV=1 | 107 | 272 | 1.0E-11 |
| sp|Q12U08|HIS8_METBU | Histidinol-phosphate aminotransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hisC PE=3 SV=1 | 41 | 275 | 2.0E-11 |
| sp|Q2W047|HIS8_MAGSA | Histidinol-phosphate aminotransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisC PE=3 SV=1 | 64 | 277 | 2.0E-11 |
| sp|Q5L6M0|DAPAT_CHLAB | LL-diaminopimelate aminotransferase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dapL PE=3 SV=1 | 61 | 304 | 2.0E-11 |
| sp|Q9KCA8|HIS8_BACHD | Histidinol-phosphate aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisC PE=3 SV=1 | 55 | 352 | 2.0E-11 |
| sp|Q131B9|HIS8_RHOPS | Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=hisC PE=3 SV=1 | 64 | 349 | 3.0E-11 |
| sp|Q73AX7|HIS81_BACC1 | Histidinol-phosphate aminotransferase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisC1 PE=3 SV=1 | 66 | 319 | 3.0E-11 |
| sp|Q8R5U4|COBD_CALS4 | Putative threonine-phosphate decarboxylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobD PE=3 SV=1 | 36 | 279 | 3.0E-11 |
| sp|Q3SV41|HIS8_NITWN | Histidinol-phosphate aminotransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisC PE=3 SV=1 | 78 | 358 | 4.0E-11 |
| sp|P52892|ALAT_YEAST | Probable alanine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALT2 PE=1 SV=1 | 62 | 393 | 4.0E-11 |
| sp|P23256|MALY_ECOLI | Protein MalY OS=Escherichia coli (strain K12) GN=malY PE=1 SV=1 | 103 | 261 | 5.0E-11 |
| sp|A1JTV9|HIS8_YERE8 | Histidinol-phosphate aminotransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hisC PE=3 SV=1 | 106 | 310 | 5.0E-11 |
| sp|Q10MQ2|DAPAT_ORYSJ | Probable LL-diaminopimelate aminotransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=AGD2 PE=2 SV=1 | 45 | 336 | 5.0E-11 |
| sp|Q24QJ1|HIS8_DESHY | Histidinol-phosphate aminotransferase OS=Desulfitobacterium hafniense (strain Y51) GN=hisC PE=3 SV=1 | 42 | 334 | 5.0E-11 |
| sp|Q6ABU3|PATR_PROAC | Putative phenylalanine aminotransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pat PE=3 SV=1 | 105 | 377 | 6.0E-11 |
| sp|Q93QC6|CBL_CORGT | Cystathionine beta-lyase OS=Corynebacterium glutamicum GN=metC PE=1 SV=1 | 57 | 358 | 6.0E-11 |
| sp|C6DF75|HIS8_PECCP | Histidinol-phosphate aminotransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hisC PE=3 SV=1 | 106 | 349 | 7.0E-11 |
| sp|B6EJ89|HIS8_ALISL | Histidinol-phosphate aminotransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=hisC PE=3 SV=1 | 106 | 278 | 8.0E-11 |
| sp|Q2NEQ0|HIS8_METST | Histidinol-phosphate aminotransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisC PE=3 SV=1 | 104 | 396 | 8.0E-11 |
| sp|Q6D410|HIS8_PECAS | Histidinol-phosphate aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hisC PE=3 SV=1 | 106 | 334 | 1.0E-10 |
| sp|Q6HL37|HIS81_BACHK | Histidinol-phosphate aminotransferase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisC1 PE=3 SV=1 | 66 | 319 | 1.0E-10 |
| sp|Q81SV5|HIS81_BACAN | Histidinol-phosphate aminotransferase 1 OS=Bacillus anthracis GN=hisC1 PE=3 SV=1 | 66 | 319 | 1.0E-10 |
| sp|Q8KD01|HIS8_CHLTE | Histidinol-phosphate aminotransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisC PE=3 SV=1 | 101 | 278 | 1.0E-10 |
| sp|Q9LQ10|1A110_ARATH | Probable aminotransferase ACS10 OS=Arabidopsis thaliana GN=ACS10 PE=1 SV=1 | 35 | 351 | 1.0E-10 |
| sp|B0UN04|HIS8_METS4 | Histidinol-phosphate aminotransferase OS=Methylobacterium sp. (strain 4-46) GN=hisC PE=3 SV=1 | 57 | 274 | 1.0E-10 |
| sp|Q63DL4|HIS81_BACCZ | Histidinol-phosphate aminotransferase 1 OS=Bacillus cereus (strain ZK / E33L) GN=hisC1 PE=3 SV=1 | 66 | 319 | 2.0E-10 |
| sp|Q8EQB9|HIS82_OCEIH | Histidinol-phosphate aminotransferase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisC2 PE=3 SV=1 | 97 | 348 | 2.0E-10 |
| sp|P61004|PATR_CORDI | Putative phenylalanine aminotransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pat PE=3 SV=1 | 106 | 278 | 2.0E-10 |
| sp|Q8U9W3|HIS8_AGRFC | Histidinol-phosphate aminotransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hisC PE=3 SV=1 | 64 | 278 | 2.0E-10 |
| sp|C0R1Z0|HIS8_BRAHW | Histidinol-phosphate aminotransferase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=hisC PE=3 SV=1 | 105 | 359 | 2.0E-10 |
| sp|Q2RL44|HIS8_MOOTA | Histidinol-phosphate aminotransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=hisC PE=3 SV=1 | 64 | 352 | 2.0E-10 |
| sp|Q5LNM6|HIS8_RUEPO | Histidinol-phosphate aminotransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisC PE=3 SV=2 | 63 | 336 | 3.0E-10 |
| sp|P34037|HIS8_ZYMMO | Histidinol-phosphate aminotransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisC PE=3 SV=3 | 81 | 349 | 3.0E-10 |
| sp|A1BGB4|HIS8_CHLPD | Histidinol-phosphate aminotransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisC PE=3 SV=1 | 107 | 292 | 3.0E-10 |
| sp|B3ECG2|HIS8_CHLL2 | Histidinol-phosphate aminotransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisC PE=3 SV=1 | 107 | 273 | 3.0E-10 |
| sp|C1AIM6|PATR_MYCBT | Putative phenylalanine aminotransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pat PE=3 SV=1 | 42 | 278 | 3.0E-10 |
| sp|A1KQA5|PATR_MYCBP | Putative phenylalanine aminotransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pat PE=3 SV=1 | 42 | 278 | 3.0E-10 |
| sp|Q7TVQ0|PATR_MYCBO | Putative phenylalanine aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pat PE=3 SV=1 | 42 | 278 | 3.0E-10 |
| sp|B5FDA0|HIS8_VIBFM | Histidinol-phosphate aminotransferase OS=Vibrio fischeri (strain MJ11) GN=hisC PE=3 SV=1 | 106 | 282 | 4.0E-10 |
| sp|Q11DR9|HIS8_CHESB | Histidinol-phosphate aminotransferase OS=Chelativorans sp. (strain BNC1) GN=hisC PE=3 SV=1 | 63 | 359 | 5.0E-10 |
| sp|P95957|Y104_SULSO | Uncharacterized aminotransferase SSO0104 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0104 PE=3 SV=1 | 107 | 396 | 5.0E-10 |
| sp|P0DI07|HIS6B_ARATH | Histidinol-phosphate aminotransferase 2, chloroplastic OS=Arabidopsis thaliana GN=HISN6B PE=1 SV=1 | 41 | 353 | 5.0E-10 |
| sp|B9DHD3|HIS6A_ARATH | Histidinol-phosphate aminotransferase 1, chloroplastic OS=Arabidopsis thaliana GN=HISN6A PE=1 SV=1 | 41 | 353 | 5.0E-10 |
| sp|A8LK96|HIS8_DINSH | Histidinol-phosphate aminotransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisC PE=3 SV=1 | 85 | 279 | 5.0E-10 |
| sp|Q00257|1A12_CUCMA | 1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima GN=ACS2 PE=2 SV=1 | 107 | 409 | 6.0E-10 |
| sp|A3Q7J9|PATR_MYCSJ | Putative phenylalanine aminotransferase OS=Mycobacterium sp. (strain JLS) GN=pat PE=3 SV=1 | 42 | 278 | 6.0E-10 |
| sp|Q9ZHE5|HIS8_BUCAP | Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisC PE=3 SV=1 | 103 | 278 | 6.0E-10 |
| sp|Q4L4E7|HIS8_STAHJ | Histidinol-phosphate aminotransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hisC PE=3 SV=1 | 64 | 320 | 6.0E-10 |
| sp|Q9S9U6|1A111_ARATH | 1-aminocyclopropane-1-carboxylate synthase 11 OS=Arabidopsis thaliana GN=ACS11 PE=1 SV=1 | 85 | 397 | 6.0E-10 |
| sp|Q8NXN3|HIS8_STAAW | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain MW2) GN=hisC PE=3 SV=1 | 43 | 320 | 6.0E-10 |
| sp|Q6GBA6|HIS8_STAAS | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain MSSA476) GN=hisC PE=3 SV=1 | 43 | 320 | 6.0E-10 |
| sp|Q3AAT6|HIS82_CARHZ | Histidinol-phosphate aminotransferase 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisC2 PE=3 SV=1 | 60 | 382 | 6.0E-10 |
| sp|Q9KSX2|HIS8_VIBCH | Histidinol-phosphate aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisC PE=3 SV=1 | 106 | 315 | 7.0E-10 |
| sp|P61005|PATR_MYCPA | Putative phenylalanine aminotransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pat PE=3 SV=1 | 106 | 309 | 8.0E-10 |
| sp|A0Q9F3|PATR_MYCA1 | Putative phenylalanine aminotransferase OS=Mycobacterium avium (strain 104) GN=pat PE=3 SV=1 | 106 | 309 | 9.0E-10 |
| sp|Q6GIR8|HIS8_STAAR | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain MRSA252) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|Q6HHF6|HIS82_BACHK | Histidinol-phosphate aminotransferase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisC2 PE=3 SV=1 | 74 | 302 | 1.0E-09 |
| sp|A0PVN0|PATR_MYCUA | Putative phenylalanine aminotransferase OS=Mycobacterium ulcerans (strain Agy99) GN=pat PE=3 SV=1 | 42 | 280 | 1.0E-09 |
| sp|B2IDA4|HIS8_BEII9 | Histidinol-phosphate aminotransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=hisC PE=3 SV=1 | 64 | 274 | 1.0E-09 |
| sp|B1JPW1|HIS8_YERPY | Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=hisC PE=3 SV=1 | 106 | 350 | 1.0E-09 |
| sp|A7FJH1|HIS8_YERP3 | Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=hisC PE=3 SV=1 | 106 | 350 | 1.0E-09 |
| sp|P9WML5|PATR_MYCTU | Putative phenylalanine aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pat PE=1 SV=1 | 42 | 278 | 1.0E-09 |
| sp|P9WML4|PATR_MYCTO | Putative phenylalanine aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pat PE=3 SV=1 | 42 | 278 | 1.0E-09 |
| sp|A5U9A1|PATR_MYCTA | Putative phenylalanine aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pat PE=3 SV=1 | 42 | 278 | 1.0E-09 |
| sp|A4TKK4|HIS8_YERPP | Histidinol-phosphate aminotransferase OS=Yersinia pestis (strain Pestoides F) GN=hisC PE=3 SV=1 | 106 | 310 | 1.0E-09 |
| sp|Q1CGX0|HIS8_YERPN | Histidinol-phosphate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hisC PE=3 SV=1 | 106 | 310 | 1.0E-09 |
| sp|A9R2K5|HIS8_YERPG | Histidinol-phosphate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=hisC PE=3 SV=1 | 106 | 310 | 1.0E-09 |
| sp|Q8ZFX6|HIS8_YERPE | Histidinol-phosphate aminotransferase OS=Yersinia pestis GN=hisC PE=3 SV=1 | 106 | 310 | 1.0E-09 |
| sp|Q1C9R1|HIS8_YERPA | Histidinol-phosphate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hisC PE=3 SV=1 | 106 | 310 | 1.0E-09 |
| sp|Q6LT75|HIS8_PHOPR | Histidinol-phosphate aminotransferase OS=Photobacterium profundum GN=hisC PE=3 SV=1 | 74 | 282 | 1.0E-09 |
| sp|B2UPR9|HIS8_AKKM8 | Histidinol-phosphate aminotransferase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=hisC PE=3 SV=1 | 84 | 275 | 1.0E-09 |
| sp|A4XMY1|HIS8_CALS8 | Histidinol-phosphate aminotransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hisC PE=3 SV=1 | 105 | 352 | 1.0E-09 |
| sp|Q66C50|HIS8_YERPS | Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hisC PE=3 SV=1 | 106 | 310 | 1.0E-09 |
| sp|B2JZM8|HIS8_YERPB | Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=hisC PE=3 SV=1 | 106 | 310 | 1.0E-09 |
| sp|Q8D8Q1|HIS8_VIBVU | Histidinol-phosphate aminotransferase OS=Vibrio vulnificus (strain CMCP6) GN=hisC PE=3 SV=1 | 106 | 315 | 1.0E-09 |
| sp|Q9PK04|DAPAT_CHLMU | LL-diaminopimelate aminotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dapL PE=3 SV=1 | 45 | 335 | 1.0E-09 |
| sp|Q1AY33|HIS8_RUBXD | Histidinol-phosphate aminotransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=hisC PE=3 SV=1 | 105 | 356 | 1.0E-09 |
| sp|A8YZZ5|HIS8_STAAT | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|P67725|HIS8_STAAN | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain N315) GN=hisC PE=1 SV=1 | 43 | 320 | 1.0E-09 |
| sp|P67724|HIS8_STAAM | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|A6QF32|HIS8_STAAE | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain Newman) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|Q5HHU9|HIS8_STAAC | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain COL) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|A5IQS7|HIS8_STAA9 | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain JH9) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|Q2G087|HIS8_STAA8 | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|Q2FIR7|HIS8_STAA3 | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain USA300) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|A6TZK2|HIS8_STAA2 | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain JH1) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|A7WZL0|HIS8_STAA1 | Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hisC PE=3 SV=1 | 43 | 320 | 1.0E-09 |
| sp|Q58874|Y1479_METJA | Uncharacterized aminotransferase MJ1479 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1479 PE=3 SV=1 | 57 | 325 | 1.0E-09 |
| sp|Q9ZBY8|PATR_STRCO | Putative phenylalanine aminotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pat PE=3 SV=1 | 128 | 309 | 2.0E-09 |
| sp|Q84I53|HIS8_BUCDN | Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=hisC PE=3 SV=1 | 105 | 318 | 2.0E-09 |
| sp|Q92MG0|HIS81_RHIME | Histidinol-phosphate aminotransferase 1 OS=Rhizobium meliloti (strain 1021) GN=hisC1 PE=3 SV=1 | 57 | 279 | 2.0E-09 |
| sp|Q736A5|HIS82_BACC1 | Histidinol-phosphate aminotransferase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisC2 PE=3 SV=1 | 74 | 301 | 2.0E-09 |
| sp|Q7MLS5|HIS8_VIBVY | Histidinol-phosphate aminotransferase OS=Vibrio vulnificus (strain YJ016) GN=hisC PE=3 SV=1 | 106 | 315 | 2.0E-09 |
| sp|Q8NTT4|PATR_CORGL | Probable phenylalanine aminotransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pat PE=3 SV=1 | 43 | 278 | 2.0E-09 |
| sp|Q2GAI1|HIS8_NOVAD | Histidinol-phosphate aminotransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=hisC PE=3 SV=1 | 73 | 349 | 2.0E-09 |
| sp|B4S8L6|HIS8_PROA2 | Histidinol-phosphate aminotransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisC PE=3 SV=1 | 107 | 292 | 2.0E-09 |
| sp|Q6MDE0|DAPAT_PARUW | LL-diaminopimelate aminotransferase OS=Protochlamydia amoebophila (strain UWE25) GN=dapL PE=1 SV=2 | 45 | 415 | 2.0E-09 |
| sp|P96681|YDFD_BACSU | Uncharacterized HTH-type transcriptional regulator YdfD OS=Bacillus subtilis (strain 168) GN=ydfD PE=3 SV=1 | 43 | 351 | 2.0E-09 |
| sp|Q51687|HIS8_PARDP | Histidinol-phosphate aminotransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=hisC PE=3 SV=2 | 107 | 278 | 2.0E-09 |
| sp|B8IRU5|HIS8_METNO | Histidinol-phosphate aminotransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=hisC PE=3 SV=1 | 85 | 271 | 2.0E-09 |
| sp|Q8YJK3|HIS8_BRUME | Histidinol-phosphate aminotransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisC PE=3 SV=2 | 78 | 359 | 2.0E-09 |
| sp|Q5LAZ9|HIS8_BACFN | Histidinol-phosphate aminotransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisC PE=3 SV=1 | 105 | 372 | 2.0E-09 |
| sp|B6IYQ0|HIS8_RHOCS | Histidinol-phosphate aminotransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=hisC PE=3 SV=1 | 64 | 359 | 2.0E-09 |
| sp|A7ICA9|HIS8_XANP2 | Histidinol-phosphate aminotransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=hisC PE=3 SV=1 | 85 | 278 | 2.0E-09 |
| sp|C3LU31|HIS8_VIBCM | Histidinol-phosphate aminotransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=hisC PE=3 SV=1 | 106 | 315 | 2.0E-09 |
| sp|A5F2A2|HIS8_VIBC3 | Histidinol-phosphate aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=hisC PE=3 SV=1 | 106 | 315 | 2.0E-09 |
| sp|Q1GET3|HIS8_RUEST | Histidinol-phosphate aminotransferase OS=Ruegeria sp. (strain TM1040) GN=hisC PE=3 SV=1 | 102 | 336 | 3.0E-09 |
| sp|Q28TL1|HIS8_JANSC | Histidinol-phosphate aminotransferase OS=Jannaschia sp. (strain CCS1) GN=hisC PE=3 SV=1 | 61 | 278 | 3.0E-09 |
| sp|Q8FY98|HIS8_BRUSU | Histidinol-phosphate aminotransferase OS=Brucella suis biovar 1 (strain 1330) GN=hisC PE=3 SV=1 | 78 | 359 | 3.0E-09 |
| sp|A5VSV7|HIS8_BRUO2 | Histidinol-phosphate aminotransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hisC PE=3 SV=2 | 78 | 359 | 3.0E-09 |
| sp|Q57AR7|HIS8_BRUAB | Histidinol-phosphate aminotransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=hisC PE=3 SV=1 | 78 | 359 | 3.0E-09 |
| sp|Q2YR81|HIS8_BRUA2 | Histidinol-phosphate aminotransferase OS=Brucella abortus (strain 2308) GN=hisC PE=3 SV=1 | 78 | 359 | 3.0E-09 |
| sp|Q163G3|HIS8_ROSDO | Histidinol-phosphate aminotransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisC PE=3 SV=1 | 105 | 348 | 4.0E-09 |
| sp|A7GN55|HIS8_BACCN | Histidinol-phosphate aminotransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisC PE=3 SV=1 | 57 | 309 | 4.0E-09 |
| sp|A4QAL4|PATR_CORGB | Putative phenylalanine aminotransferase OS=Corynebacterium glutamicum (strain R) GN=pat PE=3 SV=1 | 43 | 278 | 4.0E-09 |
| sp|B2HLJ8|PATR_MYCMM | Putative phenylalanine aminotransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pat PE=3 SV=1 | 42 | 278 | 4.0E-09 |
| sp|Q8KZ92|HIS8_BACNA | Histidinol-phosphate aminotransferase OS=Bacillus subtilis subsp. natto GN=hisC PE=3 SV=1 | 57 | 279 | 4.0E-09 |
| sp|Q1B1Z8|PATR_MYCSS | Putative phenylalanine aminotransferase OS=Mycobacterium sp. (strain MCS) GN=pat PE=3 SV=1 | 42 | 278 | 5.0E-09 |
| sp|A1UN51|PATR_MYCSK | Putative phenylalanine aminotransferase OS=Mycobacterium sp. (strain KMS) GN=pat PE=3 SV=1 | 42 | 278 | 5.0E-09 |
| sp|A1A2H6|HIS8_BIFAA | Histidinol-phosphate aminotransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=hisC PE=3 SV=1 | 42 | 278 | 5.0E-09 |
| sp|B3DXN2|HIS8_METI4 | Histidinol-phosphate aminotransferase OS=Methylacidiphilum infernorum (isolate V4) GN=hisC PE=3 SV=1 | 97 | 356 | 5.0E-09 |
| sp|Q88UE6|HIS8_LACPL | Histidinol-phosphate aminotransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisC PE=3 SV=1 | 105 | 360 | 6.0E-09 |
| sp|Q5E637|HIS8_VIBF1 | Histidinol-phosphate aminotransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hisC PE=3 SV=1 | 106 | 282 | 6.0E-09 |
| sp|Q87QL0|HIS8_VIBPA | Histidinol-phosphate aminotransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisC PE=3 SV=1 | 106 | 315 | 7.0E-09 |
| sp|Q98G10|HIS82_RHILO | Histidinol-phosphate aminotransferase 2 OS=Rhizobium loti (strain MAFF303099) GN=hisC2 PE=3 SV=1 | 84 | 359 | 7.0E-09 |
| sp|Q49VS0|HIS8_STAS1 | Histidinol-phosphate aminotransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisC PE=3 SV=1 | 54 | 320 | 7.0E-09 |
| sp|P17731|HIS8_BACSU | Histidinol-phosphate aminotransferase OS=Bacillus subtilis (strain 168) GN=hisC PE=3 SV=3 | 57 | 279 | 7.0E-09 |
| sp|B1VP97|PATR_STRGG | Putative phenylalanine aminotransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pat PE=3 SV=1 | 120 | 309 | 9.0E-09 |
| sp|Q3B3L3|HIS8_CHLL7 | Histidinol-phosphate aminotransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisC PE=3 SV=1 | 45 | 278 | 9.0E-09 |
| sp|Q64RE8|HIS8_BACFR | Histidinol-phosphate aminotransferase OS=Bacteroides fragilis (strain YCH46) GN=hisC PE=3 SV=1 | 105 | 372 | 9.0E-09 |
| sp|Q81FQ1|HIS81_BACCR | Histidinol-phosphate aminotransferase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisC1 PE=3 SV=1 | 66 | 318 | 9.0E-09 |
| sp|B7GHJ8|HIS8_ANOFW | Histidinol-phosphate aminotransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hisC PE=3 SV=1 | 85 | 413 | 1.0E-08 |
| sp|Q987C8|HIS81_RHILO | Histidinol-phosphate aminotransferase 1 OS=Rhizobium loti (strain MAFF303099) GN=hisC1 PE=3 SV=1 | 76 | 272 | 1.0E-08 |
| sp|Q96QU6|1A1L1_HUMAN | 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Homo sapiens GN=ACCS PE=1 SV=1 | 41 | 427 | 1.0E-08 |
| sp|P18485|1A12_SOLLC | 1-aminocyclopropane-1-carboxylate synthase 2 OS=Solanum lycopersicum GN=ACS2 PE=1 SV=2 | 44 | 351 | 1.0E-08 |
| sp|B0K625|HIS8_THEPX | Histidinol-phosphate aminotransferase OS=Thermoanaerobacter sp. (strain X514) GN=hisC PE=3 SV=1 | 54 | 393 | 1.0E-08 |
| sp|Q84I51|HIS8_BUCSC | Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=hisC PE=3 SV=1 | 107 | 284 | 1.0E-08 |
| sp|B0K735|HIS8_THEP3 | Histidinol-phosphate aminotransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisC PE=3 SV=1 | 54 | 393 | 1.0E-08 |
| sp|A7MX17|HIS8_VIBCB | Histidinol-phosphate aminotransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=hisC PE=3 SV=1 | 106 | 315 | 2.0E-08 |
| sp|P37821|1A1C_MALDO | 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica GN=ACS-1 PE=1 SV=2 | 85 | 354 | 2.0E-08 |
| sp|B0BC25|DAPAT_CHLTB | LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dapL PE=3 SV=1 | 97 | 335 | 2.0E-08 |
| sp|B0B7W0|DAPAT_CHLT2 | LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dapL PE=3 SV=1 | 97 | 335 | 2.0E-08 |
| sp|B4SGL8|HIS8_PELPB | Histidinol-phosphate aminotransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisC PE=3 SV=1 | 107 | 273 | 2.0E-08 |
| sp|Q8N5Z0|AADAT_HUMAN | Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Homo sapiens GN=AADAT PE=1 SV=2 | 106 | 279 | 2.0E-08 |
| sp|A5N7Q7|HIS8_CLOK5 | Histidinol-phosphate aminotransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=hisC PE=3 SV=1 | 107 | 373 | 2.0E-08 |
| sp|B9E168|HIS8_CLOK1 | Histidinol-phosphate aminotransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=hisC PE=3 SV=1 | 107 | 373 | 2.0E-08 |
| sp|O84395|DAPAT_CHLTR | LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dapL PE=1 SV=2 | 97 | 335 | 3.0E-08 |
| sp|Q3KLW3|DAPAT_CHLTA | LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dapL PE=3 SV=1 | 97 | 335 | 3.0E-08 |
| sp|Q67KI2|HIS8_SYMTH | Histidinol-phosphate aminotransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisC PE=3 SV=1 | 76 | 376 | 3.0E-08 |
| sp|Q63A05|HIS82_BACCZ | Histidinol-phosphate aminotransferase 2 OS=Bacillus cereus (strain ZK / E33L) GN=hisC2 PE=3 SV=1 | 74 | 302 | 3.0E-08 |
| sp|A7MJP4|HIS8_CROS8 | Histidinol-phosphate aminotransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=hisC PE=3 SV=1 | 106 | 278 | 3.0E-08 |
| sp|Q81P62|HIS82_BACAN | Histidinol-phosphate aminotransferase 2 OS=Bacillus anthracis GN=hisC2 PE=3 SV=1 | 74 | 302 | 4.0E-08 |
| sp|A4IQ80|HIS8_GEOTN | Histidinol-phosphate aminotransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hisC PE=3 SV=1 | 63 | 279 | 4.0E-08 |
| sp|A5CZ78|HIS8_PELTS | Histidinol-phosphate aminotransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisC PE=3 SV=1 | 84 | 316 | 4.0E-08 |
| sp|B8I5V1|HIS8_CLOCE | Histidinol-phosphate aminotransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisC PE=3 SV=1 | 35 | 353 | 4.0E-08 |
| sp|Q47KH1|PATR_THEFY | Putative phenylalanine aminotransferase OS=Thermobifida fusca (strain YX) GN=pat PE=3 SV=1 | 74 | 278 | 4.0E-08 |
| sp|Q10DK7|1A11_ORYSJ | 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=2 SV=1 | 105 | 397 | 4.0E-08 |
| sp|A2XLL2|1A11_ORYSI | 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica GN=ACC1 PE=2 SV=2 | 105 | 397 | 4.0E-08 |
| sp|Q4AC99|1A1L2_HUMAN | Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Homo sapiens GN=ACCSL PE=2 SV=3 | 45 | 271 | 5.0E-08 |
| sp|C0ZM44|PATR_RHOE4 | Putative phenylalanine aminotransferase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=pat PE=3 SV=1 | 126 | 278 | 5.0E-08 |
| sp|A8HZS2|HIS8_AZOC5 | Histidinol-phosphate aminotransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=hisC PE=3 SV=1 | 64 | 278 | 5.0E-08 |
| sp|Q9M2Y8|1A19_ARATH | 1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana GN=ACS9 PE=1 SV=1 | 81 | 304 | 5.0E-08 |
| sp|B9EAC1|HIS8_MACCJ | Histidinol-phosphate aminotransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=hisC PE=3 SV=1 | 72 | 278 | 5.0E-08 |
| sp|Q93ZN9|DAPAT_ARATH | LL-diaminopimelate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=DAP PE=1 SV=1 | 45 | 335 | 6.0E-08 |
| sp|Q65RB2|HIS82_MANSM | Histidinol-phosphate aminotransferase 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisC2 PE=3 SV=1 | 107 | 278 | 6.0E-08 |
| sp|A8AEK3|HIS8_CITK8 | Histidinol-phosphate aminotransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=hisC PE=3 SV=1 | 106 | 278 | 7.0E-08 |
| sp|C1B997|PATR_RHOOB | Putative phenylalanine aminotransferase OS=Rhodococcus opacus (strain B4) GN=pat PE=3 SV=1 | 105 | 270 | 7.0E-08 |
| sp|Q0S962|PATR_RHOJR | Putative phenylalanine aminotransferase OS=Rhodococcus jostii (strain RHA1) GN=pat PE=3 SV=2 | 120 | 273 | 7.0E-08 |
| sp|Q8G4S8|HIS8_BIFLO | Histidinol-phosphate aminotransferase OS=Bifidobacterium longum (strain NCC 2705) GN=hisC PE=3 SV=1 | 42 | 278 | 9.0E-08 |
| sp|Q82FJ1|PATR_STRAW | Putative phenylalanine aminotransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pat PE=3 SV=1 | 105 | 309 | 9.0E-08 |
| sp|A1ACN3|HIS8_ECOK1 | Histidinol-phosphate aminotransferase OS=Escherichia coli O1:K1 / APEC GN=hisC PE=3 SV=1 | 106 | 278 | 1.0E-07 |
| sp|P77730|YDCR_ECOLI | Uncharacterized HTH-type transcriptional regulator YdcR OS=Escherichia coli (strain K12) GN=ydcR PE=3 SV=1 | 79 | 324 | 1.0E-07 |
| sp|P17736|HIS8_HALVD | Histidinol-phosphate aminotransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=hisC PE=3 SV=1 | 106 | 275 | 1.0E-07 |
| sp|Q57004|HIS82_HAEIN | Histidinol-phosphate aminotransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisC2 PE=3 SV=1 | 105 | 272 | 1.0E-07 |
| sp|B9DK21|HIS8_STACT | Histidinol-phosphate aminotransferase OS=Staphylococcus carnosus (strain TM300) GN=hisC PE=3 SV=1 | 100 | 320 | 1.0E-07 |
| sp|O28255|HIS82_ARCFU | Histidinol-phosphate aminotransferase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisC2 PE=3 SV=1 | 43 | 349 | 1.0E-07 |
| sp|A4WUN9|HIS8_RHOS5 | Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisC PE=3 SV=1 | 62 | 278 | 2.0E-07 |
| sp|Q253K9|DAPAT_CHLFF | LL-diaminopimelate aminotransferase OS=Chlamydophila felis (strain Fe/C-56) GN=dapL PE=3 SV=1 | 106 | 303 | 2.0E-07 |
| sp|A8GC78|HIS8_SERP5 | Histidinol-phosphate aminotransferase OS=Serratia proteamaculans (strain 568) GN=hisC PE=3 SV=1 | 106 | 322 | 2.0E-07 |
| sp|Q28DB5|ALAT2_XENTR | Alanine aminotransferase 2 OS=Xenopus tropicalis GN=gpt2 PE=2 SV=1 | 172 | 425 | 2.0E-07 |
| sp|A7Z614|HIS8_BACMF | Histidinol-phosphate aminotransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hisC PE=3 SV=1 | 57 | 279 | 2.0E-07 |
| sp|O28277|HIS81_ARCFU | Histidinol-phosphate aminotransferase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisC1 PE=3 SV=1 | 64 | 286 | 2.0E-07 |
| sp|Q37001|1A15_ARATH | 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana GN=ACS5 PE=1 SV=1 | 81 | 354 | 2.0E-07 |
| sp|A5UGY2|HIS8_HAEIG | Histidinol-phosphate aminotransferase OS=Haemophilus influenzae (strain PittGG) GN=hisC PE=3 SV=1 | 74 | 278 | 2.0E-07 |
| sp|Q4QN73|HIS81_HAEI8 | Histidinol-phosphate aminotransferase 1 OS=Haemophilus influenzae (strain 86-028NP) GN=hisC1 PE=3 SV=2 | 74 | 278 | 2.0E-07 |
| sp|A5UA19|HIS8_HAEIE | Histidinol-phosphate aminotransferase OS=Haemophilus influenzae (strain PittEE) GN=hisC PE=3 SV=1 | 74 | 278 | 2.0E-07 |
| sp|Q8AAB8|DAPAT_BACTN | LL-diaminopimelate aminotransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dapL PE=3 SV=1 | 43 | 282 | 2.0E-07 |
| sp|B1HTD4|HIS8_LYSSC | Histidinol-phosphate aminotransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=hisC PE=3 SV=1 | 68 | 358 | 3.0E-07 |
| sp|Q6GM82|ALAT2_XENLA | Alanine aminotransferase 2 OS=Xenopus laevis GN=gpt2 PE=2 SV=1 | 172 | 425 | 3.0E-07 |
| sp|Q10334|ALAT_SCHPO | Putative alanine aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.08 PE=3 SV=1 | 105 | 271 | 3.0E-07 |
| sp|Q6ABX6|PATR_LEIXX | Putative phenylalanine aminotransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pat PE=3 SV=1 | 91 | 348 | 3.0E-07 |
| sp|B9LNJ8|HIS8_HALLT | Histidinol-phosphate aminotransferase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=hisC PE=3 SV=1 | 106 | 275 | 3.0E-07 |
| sp|Q7UZZ3|DAPAT_PROMP | LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dapL PE=3 SV=1 | 35 | 277 | 3.0E-07 |
| sp|B1XKF6|DAPAT_SYNP2 | LL-diaminopimelate aminotransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=dapL PE=3 SV=1 | 45 | 277 | 3.0E-07 |
| sp|P44423|HIS81_HAEIN | Histidinol-phosphate aminotransferase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisC1 PE=3 SV=1 | 74 | 278 | 4.0E-07 |
| sp|P31531|1A1C_SOYBN | 1-aminocyclopropane-1-carboxylate synthase OS=Glycine max GN=ACS1 PE=2 SV=1 | 80 | 431 | 4.0E-07 |
| sp|A6GY79|HIS8_FLAPJ | Histidinol-phosphate aminotransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=hisC PE=3 SV=1 | 104 | 371 | 4.0E-07 |
| sp|Q98B00|HIS83_RHILO | Histidinol-phosphate aminotransferase 3 OS=Rhizobium loti (strain MAFF303099) GN=hisC3 PE=3 SV=1 | 54 | 278 | 4.0E-07 |
| sp|A1TGS6|PATR_MYCVP | Putative phenylalanine aminotransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pat PE=3 SV=1 | 42 | 278 | 4.0E-07 |
| sp|Q9SAR0|1A16_ARATH | 1-aminocyclopropane-1-carboxylate synthase 6 OS=Arabidopsis thaliana GN=ACS6 PE=1 SV=2 | 58 | 354 | 4.0E-07 |
| sp|Q5E9H2|1A1L1_BOVIN | 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Bos taurus GN=ACCS PE=2 SV=1 | 41 | 427 | 5.0E-07 |
| sp|Q824A4|DAPAT_CHLCV | LL-diaminopimelate aminotransferase OS=Chlamydophila caviae (strain GPIC) GN=dapL PE=3 SV=1 | 61 | 303 | 5.0E-07 |
| sp|Q3J7H2|HIS82_NITOC | Histidinol-phosphate aminotransferase 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisC2 PE=3 SV=1 | 60 | 273 | 5.0E-07 |
| sp|Q8ABA8|HIS8_BACTN | Histidinol-phosphate aminotransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisC PE=3 SV=1 | 107 | 371 | 5.0E-07 |
| sp|O27624|HIS8_METTH | Histidinol-phosphate aminotransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisC PE=3 SV=1 | 31 | 321 | 5.0E-07 |
| sp|Q7VQW9|HIS8_BLOFL | Histidinol-phosphate aminotransferase OS=Blochmannia floridanus GN=hisC PE=3 SV=1 | 106 | 374 | 5.0E-07 |
| sp|Q81C43|HIS82_BACCR | Histidinol-phosphate aminotransferase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisC2 PE=3 SV=1 | 106 | 302 | 6.0E-07 |
| sp|Q5QZ49|HIS81_IDILO | Histidinol-phosphate aminotransferase 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hisC1 PE=3 SV=1 | 106 | 272 | 6.0E-07 |
| sp|P39389|YJIR_ECOLI | Uncharacterized HTH-type transcriptional regulator YjiR OS=Escherichia coli (strain K12) GN=yjiR PE=3 SV=1 | 81 | 407 | 6.0E-07 |
| sp|Q1LT68|HIS8_BAUCH | Histidinol-phosphate aminotransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=hisC PE=3 SV=1 | 105 | 282 | 6.0E-07 |
| sp|B5BFB9|HIS8_SALPK | Histidinol-phosphate aminotransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=hisC PE=3 SV=1 | 106 | 278 | 7.0E-07 |
| sp|Q5PDP4|HIS8_SALPA | Histidinol-phosphate aminotransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hisC PE=3 SV=1 | 106 | 278 | 7.0E-07 |
| sp|Q9T065|1A18_ARATH | 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1 | 105 | 354 | 7.0E-07 |
| sp|Q43309|1A14_ARATH | 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana GN=ACS4 PE=1 SV=1 | 107 | 427 | 7.0E-07 |
| sp|A9MSC2|HIS8_SALPB | Histidinol-phosphate aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=hisC PE=3 SV=1 | 106 | 278 | 8.0E-07 |
| sp|B4SX42|HIS8_SALNS | Histidinol-phosphate aminotransferase OS=Salmonella newport (strain SL254) GN=hisC PE=3 SV=1 | 106 | 278 | 8.0E-07 |
| sp|A0PXP5|HIS8_CLONN | Histidinol-phosphate aminotransferase OS=Clostridium novyi (strain NT) GN=hisC PE=3 SV=1 | 104 | 279 | 8.0E-07 |
| sp|Q4QLD1|HIS82_HAEI8 | Histidinol-phosphate aminotransferase 2 OS=Haemophilus influenzae (strain 86-028NP) GN=hisC2 PE=3 SV=1 | 105 | 272 | 8.0E-07 |
| sp|P55683|HIS8_RHISN | Histidinol-phosphate aminotransferase OS=Rhizobium sp. (strain NGR234) GN=hisC PE=3 SV=1 | 34 | 278 | 8.0E-07 |
| sp|Q42881|1A13_SOLLC | 1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1 | 85 | 397 | 9.0E-07 |
| sp|A2BT75|DAPAT_PROMS | LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus (strain AS9601) GN=dapL PE=3 SV=1 | 34 | 277 | 9.0E-07 |
| sp|A7HCR6|HIS8_ANADF | Histidinol-phosphate aminotransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=hisC PE=3 SV=1 | 106 | 270 | 9.0E-07 |
| sp|Q3UX83|1A1L2_MOUSE | Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Mus musculus GN=Accsl PE=2 SV=1 | 76 | 271 | 9.0E-07 |
| sp|A2AIG8|1A1L1_MOUSE | 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Mus musculus GN=Accs PE=2 SV=1 | 41 | 351 | 1.0E-06 |
| sp|P27486|1A1C_DIACA | 1-aminocyclopropane-1-carboxylate synthase OS=Dianthus caryophyllus GN=ACS2 PE=2 SV=1 | 81 | 397 | 1.0E-06 |
| sp|Q323J1|HIS8_SHIBS | Histidinol-phosphate aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=hisC PE=3 SV=1 | 106 | 278 | 1.0E-06 |
| sp|Q9A671|HIS81_CAUCR | Histidinol-phosphate aminotransferase 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisC1 PE=3 SV=1 | 61 | 348 | 1.0E-06 |
| sp|A7ZNJ3|HIS8_ECO24 | Histidinol-phosphate aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hisC PE=3 SV=1 | 106 | 278 | 1.0E-06 |
| sp|B7NQG9|HIS8_ECO7I | Histidinol-phosphate aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hisC PE=3 SV=1 | 106 | 278 | 1.0E-06 |
| sp|Q2SBJ7|HIS8_HAHCH | Histidinol-phosphate aminotransferase OS=Hahella chejuensis (strain KCTC 2396) GN=hisC PE=3 SV=1 | 68 | 364 | 1.0E-06 |
| sp|A3PEY9|DAPAT_PROM0 | LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=dapL PE=3 SV=1 | 35 | 277 | 1.0E-06 |
| sp|Q6AQK2|HIS8_DESPS | Histidinol-phosphate aminotransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisC PE=3 SV=1 | 105 | 304 | 1.0E-06 |
| sp|P52893|ALAM_YEAST | Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALT1 PE=1 SV=1 | 76 | 393 | 2.0E-06 |
| sp|Q3BUF6|HIS8_XANC5 | Histidinol-phosphate aminotransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hisC PE=3 SV=1 | 78 | 355 | 2.0E-06 |
| sp|B9KPH4|HIS8_RHOSK | Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisC PE=3 SV=1 | 62 | 278 | 2.0E-06 |
| sp|Q9HQS0|HIS8_HALSA | Histidinol-phosphate aminotransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisC PE=3 SV=3 | 75 | 298 | 2.0E-06 |
| sp|B0R4Q4|HIS8_HALS3 | Histidinol-phosphate aminotransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisC PE=3 SV=1 | 75 | 298 | 2.0E-06 |
| sp|Q318P3|DAPAT_PROM9 | LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=dapL PE=3 SV=1 | 34 | 277 | 2.0E-06 |
| sp|Q9FEW2|HIS8_NICPL | Histidinol-phosphate aminotransferase, chloroplastic OS=Nicotiana plumbaginifolia GN=HPA PE=1 SV=1 | 41 | 279 | 2.0E-06 |
| sp|Q3Z879|HIS8_DEHM1 | Histidinol-phosphate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisC PE=3 SV=1 | 106 | 351 | 2.0E-06 |
| sp|B2TYF9|HIS8_SHIB3 | Histidinol-phosphate aminotransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hisC PE=3 SV=1 | 106 | 278 | 2.0E-06 |
| sp|Q32EF0|HIS8_SHIDS | Histidinol-phosphate aminotransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hisC PE=3 SV=1 | 106 | 278 | 2.0E-06 |
| sp|Q5WGR9|HIS8_BACSK | Histidinol-phosphate aminotransferase OS=Bacillus clausii (strain KSM-K16) GN=hisC PE=3 SV=1 | 104 | 277 | 2.0E-06 |
| sp|Q8BGT5|ALAT2_MOUSE | Alanine aminotransferase 2 OS=Mus musculus GN=Gpt2 PE=1 SV=1 | 66 | 430 | 2.0E-06 |
| sp|B7LUF2|HIS8_ESCF3 | Histidinol-phosphate aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hisC PE=3 SV=1 | 106 | 278 | 2.0E-06 |
| sp|O82030|HIS8_TOBAC | Histidinol-phosphate aminotransferase, chloroplastic OS=Nicotiana tabacum GN=HPA PE=2 SV=1 | 41 | 279 | 2.0E-06 |
| sp|Q3AMU5|DAPAT_SYNSC | LL-diaminopimelate aminotransferase OS=Synechococcus sp. (strain CC9605) GN=dapL PE=3 SV=1 | 35 | 277 | 2.0E-06 |
| sp|Q5QWQ9|HIS82_IDILO | Histidinol-phosphate aminotransferase 2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hisC2 PE=3 SV=1 | 105 | 279 | 2.0E-06 |
| sp|O26158|DAPAT_METTH | LL-diaminopimelate aminotransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dapL PE=1 SV=1 | 39 | 338 | 2.0E-06 |
| sp|Q92A83|HIS8_LISIN | Histidinol-phosphate aminotransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisC PE=1 SV=1 | 63 | 351 | 2.0E-06 |
| sp|Q9PBC6|HIS8_XYLFA | Histidinol-phosphate aminotransferase OS=Xylella fastidiosa (strain 9a5c) GN=hisC PE=3 SV=1 | 84 | 355 | 3.0E-06 |
| sp|Q11VM5|HIS8_CYTH3 | Histidinol-phosphate aminotransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hisC PE=3 SV=1 | 102 | 371 | 3.0E-06 |
| sp|B7L9P8|HIS8_ECO55 | Histidinol-phosphate aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=hisC PE=3 SV=1 | 106 | 278 | 3.0E-06 |
| sp|Q3J445|HIS8_RHOS4 | Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisC PE=3 SV=1 | 62 | 278 | 3.0E-06 |
| sp|B5YU77|HIS8_ECO5E | Histidinol-phosphate aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hisC PE=3 SV=1 | 106 | 278 | 3.0E-06 |
| sp|Q9S5G6|HIS8_ECO57 | Histidinol-phosphate aminotransferase OS=Escherichia coli O157:H7 GN=hisC PE=3 SV=1 | 106 | 278 | 3.0E-06 |
| sp|Q83KJ6|HIS8_SHIFL | Histidinol-phosphate aminotransferase OS=Shigella flexneri GN=hisC PE=3 SV=1 | 106 | 278 | 3.0E-06 |
| sp|Q0T3A6|HIS8_SHIF8 | Histidinol-phosphate aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=hisC PE=3 SV=1 | 106 | 278 | 3.0E-06 |
| sp|B7MWU0|HIS8_ECO81 | Histidinol-phosphate aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=hisC PE=3 SV=1 | 106 | 278 | 3.0E-06 |
| sp|B2GBR8|HIS8_LACF3 | Histidinol-phosphate aminotransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=hisC PE=3 SV=1 | 60 | 353 | 3.0E-06 |
| sp|Q00379|1A12_CUCPE | 1-aminocyclopropane-1-carboxylate synthase 2 OS=Cucurbita pepo GN=ACS2 PE=2 SV=1 | 80 | 351 | 3.0E-06 |
| sp|A5UN82|DAPAT_METS3 | LL-diaminopimelate aminotransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=dapL PE=3 SV=1 | 39 | 427 | 3.0E-06 |
| sp|Q8Y5X8|HIS8_LISMO | Histidinol-phosphate aminotransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisC PE=3 SV=1 | 63 | 278 | 3.0E-06 |
| sp|Q930J0|HIS83_RHIME | Histidinol-phosphate aminotransferase 3 OS=Rhizobium meliloti (strain 1021) GN=hisC3 PE=3 SV=1 | 104 | 272 | 4.0E-06 |
| sp|Q3ARM7|HIS8_CHLCH | Histidinol-phosphate aminotransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisC PE=3 SV=1 | 45 | 273 | 4.0E-06 |
| sp|C5D3D2|HIS8_GEOSW | Histidinol-phosphate aminotransferase OS=Geobacillus sp. (strain WCH70) GN=hisC PE=3 SV=1 | 43 | 279 | 4.0E-06 |
| sp|B7MDH5|HIS8_ECO45 | Histidinol-phosphate aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hisC PE=3 SV=1 | 106 | 278 | 4.0E-06 |
| sp|Q65S79|HIS81_MANSM | Histidinol-phosphate aminotransferase 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisC1 PE=3 SV=2 | 106 | 272 | 4.0E-06 |
| sp|P53090|ARO8_YEAST | Aromatic/aminoadipate aminotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO8 PE=1 SV=1 | 104 | 348 | 4.0E-06 |
| sp|Q46IX2|DAPAT_PROMT | LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus (strain NATL2A) GN=dapL PE=3 SV=1 | 33 | 277 | 5.0E-06 |
| sp|A3PIA4|HIS8_RHOS1 | Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=hisC PE=3 SV=1 | 62 | 278 | 5.0E-06 |
| sp|B1LP20|HIS8_ECOSM | Histidinol-phosphate aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hisC PE=3 SV=1 | 106 | 278 | 6.0E-06 |
| sp|Q15RU8|HIS8_PSEA6 | Histidinol-phosphate aminotransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hisC PE=3 SV=1 | 106 | 282 | 6.0E-06 |
| sp|Q5V4K3|HIS8_HALMA | Histidinol-phosphate aminotransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisC PE=3 SV=1 | 41 | 276 | 6.0E-06 |
| sp|Q2NFU1|DAPAT_METST | LL-diaminopimelate aminotransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=dapL PE=3 SV=1 | 35 | 337 | 6.0E-06 |
| sp|Q8FNZ1|HIS8_COREF | Histidinol-phosphate aminotransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisC PE=3 SV=1 | 80 | 385 | 6.0E-06 |
| sp|P52894|ALA2_HORVU | Alanine aminotransferase 2 OS=Hordeum vulgare PE=1 SV=1 | 72 | 237 | 6.0E-06 |
| sp|Q3AW44|DAPAT_SYNS9 | LL-diaminopimelate aminotransferase OS=Synechococcus sp. (strain CC9902) GN=dapL PE=3 SV=1 | 35 | 277 | 6.0E-06 |
| sp|A0PP15|HIS8_MYCUA | Histidinol-phosphate aminotransferase OS=Mycobacterium ulcerans (strain Agy99) GN=hisC PE=3 SV=1 | 56 | 308 | 6.0E-06 |
| sp|Q5KXV3|HIS8_GEOKA | Histidinol-phosphate aminotransferase OS=Geobacillus kaustophilus (strain HTA426) GN=hisC PE=3 SV=1 | 104 | 279 | 7.0E-06 |
| sp|Q64SY6|DAPAT_BACFR | LL-diaminopimelate aminotransferase OS=Bacteroides fragilis (strain YCH46) GN=dapL PE=3 SV=1 | 43 | 337 | 7.0E-06 |
| sp|A5FVN2|HIS8_ACICJ | Histidinol-phosphate aminotransferase OS=Acidiphilium cryptum (strain JF-5) GN=hisC PE=3 SV=1 | 45 | 351 | 7.0E-06 |
| sp|Q9S7E9|GGT2_ARATH | Glutamate--glyoxylate aminotransferase 2 OS=Arabidopsis thaliana GN=GGAT2 PE=1 SV=1 | 67 | 236 | 8.0E-06 |
| sp|Q5LC03|DAPAT_BACFN | LL-diaminopimelate aminotransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dapL PE=1 SV=1 | 43 | 337 | 8.0E-06 |
| sp|Q06429|1A11_ARATH | 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Arabidopsis thaliana GN=ACS1 PE=1 SV=2 | 81 | 425 | 8.0E-06 |
| sp|A5GW23|DAPAT_SYNR3 | LL-diaminopimelate aminotransferase OS=Synechococcus sp. (strain RCC307) GN=dapL PE=3 SV=1 | 42 | 278 | 9.0E-06 |
| sp|B2HQA3|HIS8_MYCMM | Histidinol-phosphate aminotransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hisC PE=3 SV=1 | 56 | 308 | 9.0E-06 |
| sp|Q0AM22|HIS8_MARMM | Histidinol-phosphate aminotransferase OS=Maricaulis maris (strain MCS10) GN=hisC PE=3 SV=1 | 81 | 358 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0030170 | pyridoxal phosphate binding | Yes |
| GO:0009058 | biosynthetic process | Yes |
| GO:0008152 | metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0043167 | ion binding | No |
| GO:0070279 | vitamin B6 binding | No |
| GO:0005488 | binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0043168 | anion binding | No |
| GO:0008150 | biological_process | No |
| GO:0036094 | small molecule binding | No |
| GO:0019842 | vitamin binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 29 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 87.38 | 52.51 | 122.25 |
| Initials | Initials knots | 63.25 | 37.65 | 88.85 |
| Pileal_Stipeal_center | Stage I stipe center | 91.23 | 54.25 | 128.21 |
| Pileal_Stipeal_shell | Stage I stipe shell | 97.25 | 58.07 | 136.43 |
| DIF_stipe_center | Stage II stipe center | 109.87 | 65.92 | 153.83 |
| DIF_stipe_shell | Stage II stipe shell | 109.44 | 65.40 | 153.47 |
| DIF_stipe_skin | Stage II stipe skin | 100.60 | 60.03 | 141.18 |
| DIF_cap_skin | Stage II cap skin | 108.93 | 65.36 | 152.50 |
| DIF_cap_tissue | Stage II cap tissue | 111.85 | 66.56 | 157.14 |
| DIF_gill_tissue | Stage II gill tissue | 107.12 | 64.31 | 149.94 |
| YFB_stipe_center | Young fruiting body stipe center | 114.30 | 68.59 | 160.01 |
| YFB_stipe_shell | Young fruiting body stipe shell | 132.15 | 78.42 | 185.87 |
| YFB_stipe_skin | Young fruiting body stipe skin | 227.65 | 127.09 | 328.21 |
| YFB_cap_skin | Young fruiting body cap skin | 133.17 | 78.09 | 188.25 |
| YFB_cap_tissue | Young fruiting body cap tissue | 112.00 | 66.68 | 157.32 |
| YFB_gill_tissue | Young fruiting body gill tissue | 113.32 | 67.99 | 158.65 |
| YFB_veil | Young fruiting body veil | 110.46 | 66.26 | 154.67 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.572868 | no |
| Casing | YFB_stipe_center | 0.404285 | no |
| Casing | YFB_stipe_shell | 0.150844 | no |
| Casing | YFB_stipe_skin | 0.000613 | yes |
| Casing | YFB_cap_skin | 0.150574 | no |
| Casing | YFB_cap_tissue | 0.467805 | no |
| Casing | YFB_gill_tissue | 0.432334 | no |
| Casing | YFB_veil | 0.499105 | no |
| Casing | Initials | 0.304877 | no |
| Casing | Pileal_Stipeal_center | 0.936942 | no |
| Casing | Pileal_Stipeal_shell | 0.812824 | no |
| Casing | DIF_stipe_center | 0.509581 | no |
| Casing | DIF_stipe_shell | 0.525365 | no |
| Casing | DIF_stipe_skin | 0.738742 | no |
| Casing | DIF_cap_skin | 0.528044 | no |
| Casing | DIF_cap_tissue | 0.473074 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.896068 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.557994 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.005302 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.551685 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.933526 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.912444 | no |
| DIF_gill_tissue | YFB_veil | 0.953764 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.720930 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.011350 | yes |
| YFB_stipe_center | YFB_cap_skin | 0.709147 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.970184 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.986136 | no |
| YFB_stipe_center | YFB_veil | 0.947675 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.058926 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.988684 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.676468 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.700548 | no |
| YFB_stipe_shell | YFB_veil | 0.640735 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.061473 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.010728 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.009773 | yes |
| YFB_stipe_skin | YFB_veil | 0.007092 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.667390 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.689536 | no |
| YFB_cap_skin | YFB_veil | 0.632576 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.982743 | no |
| YFB_cap_tissue | YFB_veil | 0.979560 | no |
| YFB_gill_tissue | YFB_veil | 0.961619 | no |
| Initials | DIF_gill_tissue | 0.054375 | no |
| Initials | YFB_stipe_center | 0.026461 | yes |
| Initials | YFB_stipe_shell | 0.004548 | yes |
| Initials | YFB_stipe_skin | 0.000613 | yes |
| Initials | YFB_cap_skin | 0.002084 | yes |
| Initials | YFB_cap_tissue | 0.038942 | yes |
| Initials | YFB_gill_tissue | 0.026461 | yes |
| Initials | YFB_veil | 0.038495 | yes |
| Initials | Pileal_Stipeal_center | 0.227594 | no |
| Initials | Pileal_Stipeal_shell | 0.133711 | no |
| Initials | DIF_stipe_center | 0.042475 | yes |
| Initials | DIF_stipe_shell | 0.047163 | yes |
| Initials | DIF_stipe_skin | 0.102830 | no |
| Initials | DIF_cap_skin | 0.043339 | yes |
| Initials | DIF_cap_tissue | 0.038942 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.685194 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.514895 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.211808 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_skin | 0.209483 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.579955 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.541476 | no |
| Pileal_Stipeal_center | YFB_veil | 0.613143 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.901469 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.623158 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.637194 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.837318 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.641577 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.584724 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.835884 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.682658 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.335330 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.001625 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.331609 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.741202 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.707656 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.768617 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.779362 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.790748 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.951362 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.796970 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.744339 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.963029 | no |
| DIF_stipe_center | YFB_stipe_center | 0.939386 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.626278 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.006742 | yes |
| DIF_stipe_center | YFB_cap_skin | 0.617938 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.972845 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.954167 | no |
| DIF_stipe_center | YFB_veil | 0.991241 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.993279 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.856285 | no |
| DIF_stipe_center | DIF_cap_skin | 0.986858 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.974183 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.968647 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.933861 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.619700 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.005671 | yes |
| DIF_stipe_shell | YFB_cap_skin | 0.610306 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.966113 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.948670 | no |
| DIF_stipe_shell | YFB_veil | 0.984946 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.863718 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.992195 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.967806 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.901182 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.766358 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.410792 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.002951 | yes |
| DIF_stipe_skin | YFB_cap_skin | 0.409616 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.817852 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.788051 | no |
| DIF_stipe_skin | YFB_veil | 0.844077 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.869875 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.820041 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.975758 | no |
| DIF_cap_skin | YFB_stipe_center | 0.925892 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.600995 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.006032 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.592767 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.960749 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.941584 | no |
| DIF_cap_skin | YFB_veil | 0.978841 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.962056 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.933232 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.968440 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.673106 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.009773 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.662783 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.997490 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.980349 | no |
| DIF_cap_tissue | YFB_veil | 0.980563 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|071520 MSSTANNNQDRSNLIPFSSRLREGRALALDVWTIYNALNLPPDCINLGQGYMNFAPPKWITEAAEQALNSVAPNH YSHPRGRIRLREAIKNFYDPLFNRSLNVDSEILITSGANEGMYSVLTAFLEQGDEVILFEPFFDQYLPSVTFNGG KPVYVPLHPPASHIKKPTSDDWTIDMDELRRAVTPRTKIIIVNTPHNPVGKVFTRKELQGIADIAEEFNLLVMSD EVYDSLVFDNKEHVRMANLPGMWDRTVTVGSAGKAFAATGWRIGWLIGPKNLIQPTLAATTRIVFCSVSPLQEAA AAGLEQANQRNFFQIQRNEYTERRTVLTDVFDKLGLRYTLPEGSYFILLDISNVEFPEDYPFPESVMGRGRDFRA CWFMAMEIGVSSIPVSEFYCEEHANLGEAYARFAFCKDVDNLKAAAERFQKIKKYIK* |
| Coding | >AgabiH97|071520 ATGTCTTCTACGGCTAACAATAACCAGGACCGATCCAACCTCATCCCTTTCTCTTCCCGCCTCAGGGAGGGTAGG GCACTTGCTCTCGATGTTTGGACCATCTACAATGCTCTCAATCTTCCCCCTGATTGTATTAATCTCGGCCAGGGA TATATGAATTTCGCACCCCCGAAGTGGATCACAGAAGCTGCAGAGCAAGCTCTCAACTCCGTCGCGCCAAACCAC TACTCTCATCCCCGAGGACGTATCCGTCTGCGCGAGGCTATCAAGAATTTCTATGATCCACTCTTCAACAGGAGT CTCAATGTCGATTCAGAGATCTTGATCACGAGCGGTGCCAATGAAGGCATGTACTCCGTTTTGACCGCGTTTCTA GAACAAGGAGATGAGGTCATTTTGTTTGAACCCTTCTTCGACCAATACCTTCCTTCCGTTACATTCAATGGAGGA AAACCCGTTTACGTTCCTTTACATCCTCCCGCTTCTCATATCAAGAAGCCGACTAGTGACGACTGGACCATTGAC ATGGACGAACTCAGGCGTGCTGTCACTCCCCGCACAAAAATCATCATCGTCAATACACCTCACAATCCCGTTGGC AAAGTATTTACGCGGAAAGAGCTACAAGGCATTGCCGATATCGCTGAAGAGTTTAACCTTCTCGTAATGTCAGAC GAAGTTTACGATTCTTTGGTTTTTGACAACAAAGAACATGTGCGCATGGCCAATCTCCCAGGCATGTGGGATCGC ACAGTGACTGTCGGCTCTGCAGGAAAAGCATTTGCCGCCACCGGTTGGCGAATTGGTTGGCTTATCGGACCAAAG AATCTCATCCAACCGACTCTTGCCGCAACAACCAGAATTGTCTTTTGCTCCGTATCCCCATTGCAAGAGGCTGCT GCTGCTGGTCTCGAACAAGCAAACCAACGCAACTTCTTCCAAATTCAGCGTAACGAATATACGGAACGCCGCACT GTCCTTACCGATGTCTTTGACAAGCTCGGTCTGAGGTATACTCTCCCTGAAGGCAGCTACTTCATTCTTCTGGAT ATCTCCAACGTTGAGTTTCCTGAAGACTATCCCTTCCCCGAGAGCGTTATGGGTCGCGGCCGTGACTTCAGGGCT TGCTGGTTCATGGCAATGGAAATCGGAGTTTCTTCTATCCCTGTTAGCGAGTTCTACTGTGAAGAGCACGCCAAC CTCGGAGAAGCTTATGCGCGATTTGCCTTCTGCAAGGATGTTGATAATCTGAAAGCTGCTGCGGAACGCTTTCAG AAAATCAAGAAGTACATAAAATGA |
| Transcript | >AgabiH97|071520 ATGTCTTCTACGGCTAACAATAACCAGGACCGATCCAACCTCATCCCTTTCTCTTCCCGCCTCAGGGAGGGTAGG GCACTTGCTCTCGATGTTTGGACCATCTACAATGCTCTCAATCTTCCCCCTGATTGTATTAATCTCGGCCAGGGA TATATGAATTTCGCACCCCCGAAGTGGATCACAGAAGCTGCAGAGCAAGCTCTCAACTCCGTCGCGCCAAACCAC TACTCTCATCCCCGAGGACGTATCCGTCTGCGCGAGGCTATCAAGAATTTCTATGATCCACTCTTCAACAGGAGT CTCAATGTCGATTCAGAGATCTTGATCACGAGCGGTGCCAATGAAGGCATGTACTCCGTTTTGACCGCGTTTCTA GAACAAGGAGATGAGGTCATTTTGTTTGAACCCTTCTTCGACCAATACCTTCCTTCCGTTACATTCAATGGAGGA AAACCCGTTTACGTTCCTTTACATCCTCCCGCTTCTCATATCAAGAAGCCGACTAGTGACGACTGGACCATTGAC ATGGACGAACTCAGGCGTGCTGTCACTCCCCGCACAAAAATCATCATCGTCAATACACCTCACAATCCCGTTGGC AAAGTATTTACGCGGAAAGAGCTACAAGGCATTGCCGATATCGCTGAAGAGTTTAACCTTCTCGTAATGTCAGAC GAAGTTTACGATTCTTTGGTTTTTGACAACAAAGAACATGTGCGCATGGCCAATCTCCCAGGCATGTGGGATCGC ACAGTGACTGTCGGCTCTGCAGGAAAAGCATTTGCCGCCACCGGTTGGCGAATTGGTTGGCTTATCGGACCAAAG AATCTCATCCAACCGACTCTTGCCGCAACAACCAGAATTGTCTTTTGCTCCGTATCCCCATTGCAAGAGGCTGCT GCTGCTGGTCTCGAACAAGCAAACCAACGCAACTTCTTCCAAATTCAGCGTAACGAATATACGGAACGCCGCACT GTCCTTACCGATGTCTTTGACAAGCTCGGTCTGAGGTATACTCTCCCTGAAGGCAGCTACTTCATTCTTCTGGAT ATCTCCAACGTTGAGTTTCCTGAAGACTATCCCTTCCCCGAGAGCGTTATGGGTCGCGGCCGTGACTTCAGGGCT TGCTGGTTCATGGCAATGGAAATCGGAGTTTCTTCTATCCCTGTTAGCGAGTTCTACTGTGAAGAGCACGCCAAC CTCGGAGAAGCTTATGCGCGATTTGCCTTCTGCAAGGATGTTGATAATCTGAAAGCTGCTGCGGAACGCTTTCAG AAAATCAAGAAGTACATAAAATGA |
| Gene | >AgabiH97|071520 ATGTCTTCTACGGCTAACAATAACCAGGACCGATCCAACCTCATCCCTTTCTCTTCCCGCCTCAGGGAGGGTAGG GCACTTGCTCTCGATGTTTGGACCATCTACAAGTAGTCTTTCTCGTCTGCCCATGCTCGATACATTTTCAAAATT TCCCATAGTGCTCTCAATCTTCCCCCTGATTGTATTAATCTCGGCCAGGGATATATGAATTTCGCACCCCCGAAG TGGATCACAGAAGCTGCAGAGCAAGCTCTCAACTCCGTCGCGCCAAACCACTACTCTCATCCCCGAGGACGTATC CGTCTGCGCGAGGCTATCAAGAATTTCTATGATCCACTCTTCAACAGGAGTCTCAATGTCGATTCAGAGATCTTG ATCACGAGCGGTGCCAATGAAGGTATGTGTAGTTCGCTTTGCAGGGTTGAAGCATTGTCTGAAAGTTATATACTT GCAGGCATGTACTCCGTTTTGACCGCGTTTCTAGAACAAGGAGATGAGGTCATTTTGTTTGAACCCTTCTTCGAC CAATACCTTCCTTCCGTTACATTCAATGGAGGAAAACCCGTTTACGTTCCTTTACATCCTCCCGCTTCTCATATC AAGAAGCCGACTAGTGACGACTGGACCATTGACATGGACGAACTCAGGTGTGTCATTGTAATTCCTATGAATCTA TTGCGTGTACCTCATCCGAATCCAATGTTACTGCTGCTTGAAGGCGTGCTGTCACTCCCCGCACAAAAATCATCA TCGTCAATACACCTCACAATCCCGTTGGCAAAGTATTTACGCGGAAAGAGCTACAAGGCATTGCCGATATCGCTG AAGAGTTTAACCTTCTCGTAATGTCAGACGAAGTTGTGAGTATAAATGTCGCCTCGATCTCGTATAATGGTCCCT GAAAGGCGAATAATGTCAGTACGATTCTTTGGTTTTTGACAACAAAGAACATGTGCGCATGGCCAATCTCCCAGG CATGTGGGATCGCACAGTGACTGTCGGCTCTGCAGGAAGTGAGTACCTCATCCTCTGCCGTCGAATAGATTATCA TAACACTCCACATGATAAACAATCATGTACTAACCCATCGCTCAGAAGCATTTGCCGCCACCGGTTGGCGAATTG GTTGGCTTATCGGACCAAAGAATCTCATCCAACCGACTCTTGCCGCAACAACCAGAATTGTCTTTTGCTCCGTAT CCCCATTGCAAGAGGCTGCTGCTGCTGGTCTCGAACAAGCAAACCAACGCAACTTCTTCCAAATTCAGCGTAACG AATATACGGAACGCCGCACTGTCCTTACCGATGTCTTTGACAAGCTCGGTCTGAGGTATACTCTCCCTGAAGGCA GCTACTTCATTCTTCTGGTCTGTCTGTATATCATTCACCTTCATTGTACCCGTTAACCTGGCCCTTCACTTTTAG GATATCTCCAACGTTGAGTTTCCTGAAGACTATCCCTTCCCCGAGAGCGTTATGGGTCGCGGCCGTGACTTCAGG TAAGTTCTGTGCTGTTGTTACAGAGGGCGCCATACACAGTGTTCTCCCAGGGCTTGCTGGTTCATGGCAATGGAA ATCGGAGTTTCTTCTATCCCTGTTAGCGAGGTGAGCTAGGATATCCGATCTCTCGAGTATTTTGACTGAGCGCAA TTTGCTAGTTCTACTGTGAAGAGCACGCCAACCTCGGAGAAGCTTATGCGCGATTTGCCTTCTGCAAGGATGTTG ATAATCTGAAAGCTGCTGCGGAACGCTTTCAGAAAATCAAGAAGTACATAAAATGA |