Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071520
Gene name
Locationscaffold_4:1528345..1530126
Strand-
Gene length (bp)1781
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 3.0E-62 43 424
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 2.2E-05 107 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14209|YDT4_SCHPO Uncharacterized aminotransferase C6B12.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6B12.04c PE=3 SV=1 30 430 3.0E-141
sp|P47039|BNA3_YEAST Probable kynurenine--oxoglutarate transaminase BNA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA3 PE=1 SV=1 43 431 1.0E-122
sp|Q54KM6|KAT_DICDI Kynurenine--oxoglutarate transaminase OS=Dictyostelium discoideum GN=ccbl PE=3 SV=1 22 429 8.0E-110
sp|Q7T3E5|KAT3_DANRE Kynurenine--oxoglutarate transaminase 3 OS=Danio rerio GN=ccbl2 PE=2 SV=2 22 420 2.0E-91
sp|Q08415|KAT1_RAT Kynurenine--oxoglutarate transaminase 1, mitochondrial OS=Rattus norvegicus GN=Ccbl1 PE=1 SV=1 15 429 6.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14209|YDT4_SCHPO Uncharacterized aminotransferase C6B12.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6B12.04c PE=3 SV=1 30 430 3.0E-141
sp|P47039|BNA3_YEAST Probable kynurenine--oxoglutarate transaminase BNA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA3 PE=1 SV=1 43 431 1.0E-122
sp|Q54KM6|KAT_DICDI Kynurenine--oxoglutarate transaminase OS=Dictyostelium discoideum GN=ccbl PE=3 SV=1 22 429 8.0E-110
sp|Q7T3E5|KAT3_DANRE Kynurenine--oxoglutarate transaminase 3 OS=Danio rerio GN=ccbl2 PE=2 SV=2 22 420 2.0E-91
sp|Q08415|KAT1_RAT Kynurenine--oxoglutarate transaminase 1, mitochondrial OS=Rattus norvegicus GN=Ccbl1 PE=1 SV=1 15 429 6.0E-88
sp|Q6YP21|KAT3_HUMAN Kynurenine--oxoglutarate transaminase 3 OS=Homo sapiens GN=CCBL2 PE=1 SV=1 26 422 8.0E-88
sp|Q8BTY1|KAT1_MOUSE Kynurenine--oxoglutarate transaminase 1 OS=Mus musculus GN=Ccbl1 PE=1 SV=1 18 424 9.0E-87
sp|Q0P5G4|KAT3_BOVIN Kynurenine--oxoglutarate transaminase 3 OS=Bos taurus GN=CCBL2 PE=2 SV=1 25 422 2.0E-84
sp|Q58FK9|KAT3_RAT Kynurenine--oxoglutarate transaminase 3 OS=Rattus norvegicus GN=Ccbl2 PE=2 SV=1 26 425 6.0E-83
sp|Q71RI9|KAT3_MOUSE Kynurenine--oxoglutarate transaminase 3 OS=Mus musculus GN=Ccbl2 PE=1 SV=1 26 425 8.0E-83
sp|Q16773|KAT1_HUMAN Kynurenine--oxoglutarate transaminase 1 OS=Homo sapiens GN=CCBL1 PE=1 SV=1 32 428 3.0E-81
sp|Q9V0L2|AAT_PYRAB Aspartate aminotransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspC PE=3 SV=1 43 427 2.0E-63
sp|P9WPZ5|DAPC_MYCTU Probable N-succinyldiaminopimelate aminotransferase DapC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dapC PE=1 SV=1 19 429 4.0E-62
sp|P9WPZ4|DAPC_MYCTO Probable N-succinyldiaminopimelate aminotransferase DapC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dapC PE=1 SV=1 19 429 4.0E-62
sp|H3ZPU1|ARAT2_THELN Aromatic-amino-acid aminotransferase 2 OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=OCC_04737 PE=1 SV=1 44 429 3.0E-55
sp|P77806|YBDL_ECOLI Methionine aminotransferase OS=Escherichia coli (strain K12) GN=ybdL PE=1 SV=1 27 427 3.0E-53
sp|Q56232|AAT_THET8 Aspartate aminotransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=aspC PE=1 SV=1 43 427 3.0E-51
sp|O33822|AAT_THEAQ Aspartate aminotransferase OS=Thermus aquaticus GN=aspC PE=3 SV=1 43 426 2.0E-50
sp|O58489|AAT_PYRHO Aspartate aminotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspC PE=3 SV=1 43 426 2.0E-47
sp|Q60317|AAT_METJA Probable aspartate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0001 PE=3 SV=1 43 352 4.0E-46
sp|Q9X0Y2|AAT_THEMA Aspartate aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aspC PE=1 SV=1 43 425 1.0E-44
sp|Q795M6|YUGH_BACSU Putative aminotransferase YugH OS=Bacillus subtilis (strain 168) GN=yugH PE=3 SV=1 45 426 2.0E-43
sp|Q9HUI9|ARUH_PSEAE Arginine--pyruvate transaminase AruH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruH PE=1 SV=1 47 351 6.0E-43
sp|P16524|PATA_BACSU Putative N-acetyl-LL-diaminopimelate aminotransferase OS=Bacillus subtilis (strain 168) GN=patA PE=1 SV=3 43 425 1.0E-41
sp|E9L7A5|PAT_PETHY Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Petunia hybrida PE=1 SV=1 45 432 2.0E-41
sp|Q4J8X2|AAT_SULAC Aspartate aminotransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=aspC PE=3 SV=1 44 423 5.0E-40
sp|Q55128|AAT_SYNY3 Aspartate aminotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aspC PE=3 SV=1 43 424 7.0E-40
sp|O67781|AAT_AQUAE Aspartate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=aspC PE=3 SV=1 43 422 8.0E-40
sp|P14909|AAT_SULSO Aspartate aminotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspC PE=1 SV=2 44 430 2.0E-39
sp|Q59228|AAT_GEOSE Aspartate aminotransferase OS=Geobacillus stearothermophilus GN=aspC PE=3 SV=1 43 426 3.0E-39
sp|P53001|AAT1_BACSU Aspartate aminotransferase OS=Bacillus subtilis (strain 168) GN=aspB PE=3 SV=1 43 426 1.0E-38
sp|Q9SIE1|PAT_ARATH Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase OS=Arabidopsis thaliana GN=PAT PE=1 SV=2 45 426 2.0E-38
sp|P23034|AAT_BACY2 Aspartate aminotransferase OS=Bacillus sp. (strain YM-2) PE=1 SV=1 43 352 4.0E-38
sp|O66630|DAPAT_AQUAE LL-diaminopimelate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=dapL PE=3 SV=1 43 428 1.0E-37
sp|Q972A2|AAT_SULTO Aspartate aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspC PE=3 SV=1 44 426 4.0E-37
sp|Q5F4K8|PAT_PINPS Aspartate aminotransferase OS=Pinus pinaster GN=AAT PE=1 SV=1 13 353 3.0E-36
sp|Q06191|AATB_RHIML Aspartate aminotransferase B OS=Rhizobium meliloti GN=aatB PE=3 SV=1 45 412 1.0E-35
sp|P58350|AATB_RHIME Aspartate aminotransferase B OS=Rhizobium meliloti (strain 1021) GN=aatB PE=3 SV=1 45 413 2.0E-35
sp|Q60013|AAT_STRVG Aspartate aminotransferase OS=Streptomyces virginiae GN=aspC PE=3 SV=1 44 427 7.0E-35
sp|Q92JE7|AAT_RICCN Aspartate aminotransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=aatA PE=3 SV=1 43 426 1.0E-34
sp|Q4UND3|AAT_RICFE Aspartate aminotransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=aatA PE=3 SV=1 43 426 2.0E-34
sp|Q02635|AATA_RHIME Aspartate aminotransferase A OS=Rhizobium meliloti (strain 1021) GN=aatA PE=3 SV=1 43 347 8.0E-34
sp|Q58097|MFNC_METJA (5-formylfuran-3-yl)methyl phosphate transaminase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=mfnC PE=1 SV=2 44 426 3.0E-33
sp|Q68XV9|AAT_RICTY Aspartate aminotransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=aatA PE=3 SV=1 43 354 7.0E-33
sp|Q1RGV0|AAT_RICBR Aspartate aminotransferase OS=Rickettsia bellii (strain RML369-C) GN=aatA PE=3 SV=1 43 426 9.0E-33
sp|B2A250|DAPAT_NATTJ LL-diaminopimelate aminotransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=dapL PE=3 SV=1 43 423 4.0E-32
sp|Q9ZE56|AAT_RICPR Aspartate aminotransferase OS=Rickettsia prowazekii (strain Madrid E) GN=aatA PE=3 SV=2 43 354 4.0E-32
sp|B8DJJ6|DAPAT_DESVM LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dapL PE=3 SV=1 43 427 2.0E-31
sp|Q72BI1|DAPAT_DESVH LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dapL PE=3 SV=1 43 427 2.0E-30
sp|P77434|ALAC_ECOLI Glutamate-pyruvate aminotransferase AlaC OS=Escherichia coli (strain K12) GN=alaC PE=1 SV=1 43 420 3.0E-30
sp|A1VDD3|DAPAT_DESVV LL-diaminopimelate aminotransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dapL PE=3 SV=1 43 427 4.0E-30
sp|Q30ZX9|DAPAT_DESAG LL-diaminopimelate aminotransferase OS=Desulfovibrio alaskensis (strain G20) GN=dapL PE=3 SV=1 43 427 4.0E-30
sp|C6BUK3|DAPAT_DESAD LL-diaminopimelate aminotransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dapL PE=3 SV=1 43 427 2.0E-29
sp|A0LEA5|DAPAT_SYNFM LL-diaminopimelate aminotransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dapL PE=1 SV=1 43 427 2.0E-29
sp|O86459|AAT_RHILP Aspartate aminotransferase OS=Rhizobium leguminosarum bv. phaseoli GN=aspC PE=3 SV=1 43 347 9.0E-29
sp|P0A961|ALAA_SHIFL Glutamate-pyruvate aminotransferase AlaA OS=Shigella flexneri GN=alaA PE=3 SV=1 76 356 1.0E-28
sp|P0A959|ALAA_ECOLI Glutamate-pyruvate aminotransferase AlaA OS=Escherichia coli (strain K12) GN=alaA PE=1 SV=1 76 356 1.0E-28
sp|P0A960|ALAA_ECOL6 Glutamate-pyruvate aminotransferase AlaA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=alaA PE=3 SV=1 76 356 1.0E-28
sp|Q3AC10|DAPAT_CARHZ LL-diaminopimelate aminotransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dapL PE=3 SV=1 43 426 2.0E-27
sp|P71348|ALAA_HAEIN Glutamate-pyruvate aminotransferase AlaA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=alaA PE=3 SV=1 76 356 2.0E-27
sp|Q2RK33|DAPAT_MOOTA LL-diaminopimelate aminotransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=dapL PE=1 SV=1 43 347 7.0E-27
sp|O07587|AAT3_BACSU Putative aspartate aminotransferase YhdR OS=Bacillus subtilis (strain 168) GN=yhdR PE=3 SV=1 76 348 2.0E-26
sp|B1I544|DAPAT_DESAP LL-diaminopimelate aminotransferase OS=Desulforudis audaxviator (strain MP104C) GN=dapL PE=3 SV=1 43 347 2.0E-25
sp|B8CX89|DAPAT_HALOH LL-diaminopimelate aminotransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dapL PE=3 SV=1 43 425 2.0E-25
sp|O87320|AATC_RHIME Putative aminotransferase AatC OS=Rhizobium meliloti (strain 1021) GN=aatC PE=3 SV=2 43 346 7.0E-25
sp|P33447|ATTY_TRYCR Tyrosine aminotransferase OS=Trypanosoma cruzi PE=1 SV=2 65 351 7.0E-25
sp|Q3MDN5|DAPT2_ANAVT LL-diaminopimelate aminotransferase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dapL2 PE=3 SV=1 43 279 3.0E-24
sp|Q7NDX4|DAPAT_GLOVI LL-diaminopimelate aminotransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=dapL PE=1 SV=1 43 356 4.0E-24
sp|P9WQ91|AAT_MYCTU Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aspC PE=1 SV=1 76 275 8.0E-24
sp|P9WQ90|AAT_MYCTO Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aspC PE=3 SV=1 76 275 8.0E-24
sp|P63499|AAT_MYCBO Probable aspartate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aspC PE=3 SV=1 76 275 8.0E-24
sp|P39643|AAT2_BACSU Probable aspartate aminotransferase OS=Bacillus subtilis (strain 168) GN=ywfG PE=3 SV=1 44 354 1.0E-23
sp|O31665|MTNE_BACSU Transaminase MtnE OS=Bacillus subtilis (strain 168) GN=mtnE PE=3 SV=1 43 432 2.0E-23
sp|Q8YP73|DAPT2_NOSS1 LL-diaminopimelate aminotransferase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dapL2 PE=3 SV=1 43 273 2.0E-23
sp|Q3Z8H5|DAPAT_DEHM1 LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dapL PE=3 SV=1 43 347 4.0E-23
sp|A5FRC5|DAPAT_DEHMB LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dapL PE=3 SV=1 43 360 1.0E-22
sp|Q3ZXC8|DAPAT_DEHMC LL-diaminopimelate aminotransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=dapL PE=3 SV=1 43 360 8.0E-22
sp|Q8QZR1|ATTY_MOUSE Tyrosine aminotransferase OS=Mus musculus GN=Tat PE=1 SV=1 60 368 9.0E-22
sp|P04694|ATTY_RAT Tyrosine aminotransferase OS=Rattus norvegicus GN=Tat PE=1 SV=1 60 368 2.0E-21
sp|Q9LVY1|TAT_ARATH Tyrosine aminotransferase OS=Arabidopsis thaliana GN=TAT PE=2 SV=1 33 272 1.0E-20
sp|Q58365|HIS8_METJA Histidinol-phosphate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisC PE=3 SV=1 41 376 5.0E-20
sp|O93744|AAT_THEKO Aspartate aminotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aspC PE=3 SV=1 29 370 3.0E-19
sp|Q58CZ9|ATTY_BOVIN Tyrosine aminotransferase OS=Bos taurus GN=TAT PE=2 SV=1 60 368 3.0E-19
sp|P17735|ATTY_HUMAN Tyrosine aminotransferase OS=Homo sapiens GN=TAT PE=1 SV=1 60 404 6.0E-19
sp|Q54K95|ATTY_DICDI Tyrosine aminotransferase OS=Dictyostelium discoideum GN=tat PE=3 SV=1 74 424 2.0E-18
sp|Q9FN30|TAT2_ARATH Probable aminotransferase TAT2 OS=Arabidopsis thaliana GN=At5g53970 PE=2 SV=1 45 430 3.0E-18
sp|P36692|AAT_STRGR Probable aspartate aminotransferase (Fragment) OS=Streptomyces griseus GN=aspC PE=3 SV=2 44 227 3.0E-18
sp|Q9SIV0|SUR1_ARATH S-alkyl-thiohydroximate lyase SUR1 OS=Arabidopsis thaliana GN=SUR1 PE=1 SV=1 62 334 5.0E-18
sp|Q84CG1|CAMYS_STRVI Capreomycidine synthase OS=Streptomyces vinaceus GN=vioD PE=1 SV=1 107 326 6.0E-18
sp|Q9SK47|TAT3_ARATH Probable aminotransferase TAT3 OS=Arabidopsis thaliana GN=TAT3 PE=2 SV=1 74 314 8.0E-18
sp|Q46E46|HIS8_METBF Histidinol-phosphate aminotransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisC PE=3 SV=1 41 376 1.0E-17
sp|Q58786|DAPAT_METJA LL-diaminopimelate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dapL PE=1 SV=1 37 349 2.0E-17
sp|Q67Y55|TAT1_ARATH Probable aminotransferase TAT1 OS=Arabidopsis thaliana GN=At4g28420 PE=2 SV=1 60 281 5.0E-17
sp|Q8TUE9|HIS8_METAC Histidinol-phosphate aminotransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisC PE=3 SV=1 41 376 5.0E-16
sp|Q2IS68|HIS8_RHOP2 Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=hisC PE=3 SV=1 64 349 5.0E-16
sp|Q9ST02|NAATA_HORVU Nicotianamine aminotransferase A OS=Hordeum vulgare GN=naat-A PE=1 SV=2 74 352 7.0E-16
sp|Q9ST03|NAATB_HORVU Nicotianamine aminotransferase B OS=Hordeum vulgare GN=naat-B PE=1 SV=2 106 352 1.0E-15
sp|Q9ZQI7|ALD1_ARATH Aminotransferase ALD1 OS=Arabidopsis thaliana GN=ALD1 PE=1 SV=2 45 337 5.0E-15
sp|A6UTL8|HIS8_META3 Histidinol-phosphate aminotransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisC PE=3 SV=1 41 376 5.0E-15
sp|Q89UL9|HIS82_BRADU Histidinol-phosphate aminotransferase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisC2 PE=3 SV=1 64 359 7.0E-15
sp|A6VGF6|HIS8_METM7 Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisC PE=3 SV=1 41 377 2.0E-14
sp|Q0BVW4|HIS8_GRABC Histidinol-phosphate aminotransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=hisC PE=3 SV=1 45 353 3.0E-14
sp|Q8PX17|HIS8_METMA Histidinol-phosphate aminotransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisC PE=3 SV=1 41 376 3.0E-14
sp|Q31GD4|HIS82_THICR Histidinol-phosphate aminotransferase 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=hisC2 PE=3 SV=1 105 374 5.0E-14
sp|Q0C348|HIS8_HYPNA Histidinol-phosphate aminotransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisC PE=3 SV=1 105 355 6.0E-14
sp|Q08432|CBL_BACSU Cystathionine beta-lyase PatB OS=Bacillus subtilis (strain 168) GN=patB PE=1 SV=1 52 352 7.0E-14
sp|A9AA96|HIS8_METM6 Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisC PE=3 SV=1 41 377 7.0E-14
sp|A6UPL6|HIS8_METVS Histidinol-phosphate aminotransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hisC PE=3 SV=1 112 377 1.0E-13
sp|Q6LX26|DAPAT_METMP LL-diaminopimelate aminotransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=dapL PE=1 SV=1 43 349 1.0E-13
sp|P61003|HIS8_METMP Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=hisC PE=3 SV=1 65 377 2.0E-13
sp|B3Q8Z5|HIS8_RHOPT Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisC PE=3 SV=1 64 339 2.0E-13
sp|P61002|HIS8_RHOPA Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisC PE=3 SV=1 64 339 2.0E-13
sp|A4FWW1|HIS8_METM5 Histidinol-phosphate aminotransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisC PE=3 SV=1 41 377 3.0E-13
sp|C0ZCE7|HIS8_BREBN Histidinol-phosphate aminotransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hisC PE=3 SV=1 105 351 3.0E-13
sp|Q9CBM9|CBL_MYCLE Putative cystathionine beta-lyase OS=Mycobacterium leprae (strain TN) GN=ML1794 PE=3 SV=1 41 358 6.0E-13
sp|Q970Z4|HIS8_SULTO Histidinol-phosphate aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hisC PE=3 SV=2 43 337 6.0E-13
sp|Q07IG8|HIS8_RHOP5 Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=hisC PE=3 SV=1 64 349 7.0E-13
sp|Q8GYY0|1A112_ARATH Probable aminotransferase ACS12 OS=Arabidopsis thaliana GN=ACS12 PE=2 SV=2 44 271 9.0E-13
sp|Q9SUR6|CORI3_ARATH Cystine lyase CORI3 OS=Arabidopsis thaliana GN=CORI3 PE=1 SV=1 74 333 9.0E-13
sp|B8D707|HIS8_BUCAT Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=hisC PE=3 SV=1 105 318 1.0E-12
sp|B8D8Q3|HIS8_BUCA5 Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=hisC PE=3 SV=1 105 318 1.0E-12
sp|P57202|HIS8_BUCAI Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hisC PE=3 SV=1 105 318 1.0E-12
sp|Q8TVG3|HIS8_METKA Histidinol-phosphate aminotransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisC PE=3 SV=1 41 376 1.0E-12
sp|Q4FP52|HIS8_PELUB Histidinol-phosphate aminotransferase OS=Pelagibacter ubique (strain HTCC1062) GN=hisC PE=3 SV=1 77 362 2.0E-12
sp|Q1QQD5|HIS8_NITHX Histidinol-phosphate aminotransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisC PE=3 SV=1 78 349 2.0E-12
sp|Q20YH9|HIS8_RHOPB Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=hisC PE=3 SV=1 78 357 2.0E-12
sp|A8MEH2|HIS8_ALKOO Histidinol-phosphate aminotransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=hisC PE=3 SV=1 99 304 3.0E-12
sp|Q5HR08|HIS8_STAEQ Histidinol-phosphate aminotransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisC PE=3 SV=1 54 320 3.0E-12
sp|Q8CTG8|HIS8_STAES Histidinol-phosphate aminotransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisC PE=3 SV=1 54 320 3.0E-12
sp|A5UKY0|HIS8_METS3 Histidinol-phosphate aminotransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hisC PE=3 SV=1 43 376 4.0E-12
sp|Q8VYP2|TAT4_ARATH Probable aminotransferase TAT4 OS=Arabidopsis thaliana GN=At4g23590 PE=2 SV=1 171 271 4.0E-12
sp|P9WQ83|CBL_MYCTU Putative cystathionine beta-lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2294 PE=1 SV=1 41 356 7.0E-12
sp|P9WQ82|CBL_MYCTO Putative cystathionine beta-lyase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2351 PE=3 SV=1 41 356 7.0E-12
sp|P63503|CBL_MYCBO Putative cystathionine beta-lyase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2316 PE=3 SV=1 41 356 7.0E-12
sp|B8FP20|HIS8_DESHD Histidinol-phosphate aminotransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hisC PE=3 SV=1 42 278 1.0E-11
sp|Q0W253|HIS8_METAR Histidinol-phosphate aminotransferase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisC PE=3 SV=1 64 274 1.0E-11
sp|B3QP11|HIS8_CHLP8 Histidinol-phosphate aminotransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisC PE=3 SV=1 107 272 1.0E-11
sp|Q12U08|HIS8_METBU Histidinol-phosphate aminotransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hisC PE=3 SV=1 41 275 2.0E-11
sp|Q2W047|HIS8_MAGSA Histidinol-phosphate aminotransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisC PE=3 SV=1 64 277 2.0E-11
sp|Q5L6M0|DAPAT_CHLAB LL-diaminopimelate aminotransferase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dapL PE=3 SV=1 61 304 2.0E-11
sp|Q9KCA8|HIS8_BACHD Histidinol-phosphate aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisC PE=3 SV=1 55 352 2.0E-11
sp|Q131B9|HIS8_RHOPS Histidinol-phosphate aminotransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=hisC PE=3 SV=1 64 349 3.0E-11
sp|Q73AX7|HIS81_BACC1 Histidinol-phosphate aminotransferase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisC1 PE=3 SV=1 66 319 3.0E-11
sp|Q8R5U4|COBD_CALS4 Putative threonine-phosphate decarboxylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobD PE=3 SV=1 36 279 3.0E-11
sp|Q3SV41|HIS8_NITWN Histidinol-phosphate aminotransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisC PE=3 SV=1 78 358 4.0E-11
sp|P52892|ALAT_YEAST Probable alanine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALT2 PE=1 SV=1 62 393 4.0E-11
sp|P23256|MALY_ECOLI Protein MalY OS=Escherichia coli (strain K12) GN=malY PE=1 SV=1 103 261 5.0E-11
sp|A1JTV9|HIS8_YERE8 Histidinol-phosphate aminotransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hisC PE=3 SV=1 106 310 5.0E-11
sp|Q10MQ2|DAPAT_ORYSJ Probable LL-diaminopimelate aminotransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=AGD2 PE=2 SV=1 45 336 5.0E-11
sp|Q24QJ1|HIS8_DESHY Histidinol-phosphate aminotransferase OS=Desulfitobacterium hafniense (strain Y51) GN=hisC PE=3 SV=1 42 334 5.0E-11
sp|Q6ABU3|PATR_PROAC Putative phenylalanine aminotransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pat PE=3 SV=1 105 377 6.0E-11
sp|Q93QC6|CBL_CORGT Cystathionine beta-lyase OS=Corynebacterium glutamicum GN=metC PE=1 SV=1 57 358 6.0E-11
sp|C6DF75|HIS8_PECCP Histidinol-phosphate aminotransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hisC PE=3 SV=1 106 349 7.0E-11
sp|B6EJ89|HIS8_ALISL Histidinol-phosphate aminotransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=hisC PE=3 SV=1 106 278 8.0E-11
sp|Q2NEQ0|HIS8_METST Histidinol-phosphate aminotransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisC PE=3 SV=1 104 396 8.0E-11
sp|Q6D410|HIS8_PECAS Histidinol-phosphate aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hisC PE=3 SV=1 106 334 1.0E-10
sp|Q6HL37|HIS81_BACHK Histidinol-phosphate aminotransferase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisC1 PE=3 SV=1 66 319 1.0E-10
sp|Q81SV5|HIS81_BACAN Histidinol-phosphate aminotransferase 1 OS=Bacillus anthracis GN=hisC1 PE=3 SV=1 66 319 1.0E-10
sp|Q8KD01|HIS8_CHLTE Histidinol-phosphate aminotransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisC PE=3 SV=1 101 278 1.0E-10
sp|Q9LQ10|1A110_ARATH Probable aminotransferase ACS10 OS=Arabidopsis thaliana GN=ACS10 PE=1 SV=1 35 351 1.0E-10
sp|B0UN04|HIS8_METS4 Histidinol-phosphate aminotransferase OS=Methylobacterium sp. (strain 4-46) GN=hisC PE=3 SV=1 57 274 1.0E-10
sp|Q63DL4|HIS81_BACCZ Histidinol-phosphate aminotransferase 1 OS=Bacillus cereus (strain ZK / E33L) GN=hisC1 PE=3 SV=1 66 319 2.0E-10
sp|Q8EQB9|HIS82_OCEIH Histidinol-phosphate aminotransferase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisC2 PE=3 SV=1 97 348 2.0E-10
sp|P61004|PATR_CORDI Putative phenylalanine aminotransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pat PE=3 SV=1 106 278 2.0E-10
sp|Q8U9W3|HIS8_AGRFC Histidinol-phosphate aminotransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hisC PE=3 SV=1 64 278 2.0E-10
sp|C0R1Z0|HIS8_BRAHW Histidinol-phosphate aminotransferase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=hisC PE=3 SV=1 105 359 2.0E-10
sp|Q2RL44|HIS8_MOOTA Histidinol-phosphate aminotransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=hisC PE=3 SV=1 64 352 2.0E-10
sp|Q5LNM6|HIS8_RUEPO Histidinol-phosphate aminotransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisC PE=3 SV=2 63 336 3.0E-10
sp|P34037|HIS8_ZYMMO Histidinol-phosphate aminotransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisC PE=3 SV=3 81 349 3.0E-10
sp|A1BGB4|HIS8_CHLPD Histidinol-phosphate aminotransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisC PE=3 SV=1 107 292 3.0E-10
sp|B3ECG2|HIS8_CHLL2 Histidinol-phosphate aminotransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisC PE=3 SV=1 107 273 3.0E-10
sp|C1AIM6|PATR_MYCBT Putative phenylalanine aminotransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pat PE=3 SV=1 42 278 3.0E-10
sp|A1KQA5|PATR_MYCBP Putative phenylalanine aminotransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pat PE=3 SV=1 42 278 3.0E-10
sp|Q7TVQ0|PATR_MYCBO Putative phenylalanine aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pat PE=3 SV=1 42 278 3.0E-10
sp|B5FDA0|HIS8_VIBFM Histidinol-phosphate aminotransferase OS=Vibrio fischeri (strain MJ11) GN=hisC PE=3 SV=1 106 282 4.0E-10
sp|Q11DR9|HIS8_CHESB Histidinol-phosphate aminotransferase OS=Chelativorans sp. (strain BNC1) GN=hisC PE=3 SV=1 63 359 5.0E-10
sp|P95957|Y104_SULSO Uncharacterized aminotransferase SSO0104 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0104 PE=3 SV=1 107 396 5.0E-10
sp|P0DI07|HIS6B_ARATH Histidinol-phosphate aminotransferase 2, chloroplastic OS=Arabidopsis thaliana GN=HISN6B PE=1 SV=1 41 353 5.0E-10
sp|B9DHD3|HIS6A_ARATH Histidinol-phosphate aminotransferase 1, chloroplastic OS=Arabidopsis thaliana GN=HISN6A PE=1 SV=1 41 353 5.0E-10
sp|A8LK96|HIS8_DINSH Histidinol-phosphate aminotransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisC PE=3 SV=1 85 279 5.0E-10
sp|Q00257|1A12_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima GN=ACS2 PE=2 SV=1 107 409 6.0E-10
sp|A3Q7J9|PATR_MYCSJ Putative phenylalanine aminotransferase OS=Mycobacterium sp. (strain JLS) GN=pat PE=3 SV=1 42 278 6.0E-10
sp|Q9ZHE5|HIS8_BUCAP Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisC PE=3 SV=1 103 278 6.0E-10
sp|Q4L4E7|HIS8_STAHJ Histidinol-phosphate aminotransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hisC PE=3 SV=1 64 320 6.0E-10
sp|Q9S9U6|1A111_ARATH 1-aminocyclopropane-1-carboxylate synthase 11 OS=Arabidopsis thaliana GN=ACS11 PE=1 SV=1 85 397 6.0E-10
sp|Q8NXN3|HIS8_STAAW Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain MW2) GN=hisC PE=3 SV=1 43 320 6.0E-10
sp|Q6GBA6|HIS8_STAAS Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain MSSA476) GN=hisC PE=3 SV=1 43 320 6.0E-10
sp|Q3AAT6|HIS82_CARHZ Histidinol-phosphate aminotransferase 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisC2 PE=3 SV=1 60 382 6.0E-10
sp|Q9KSX2|HIS8_VIBCH Histidinol-phosphate aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisC PE=3 SV=1 106 315 7.0E-10
sp|P61005|PATR_MYCPA Putative phenylalanine aminotransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pat PE=3 SV=1 106 309 8.0E-10
sp|A0Q9F3|PATR_MYCA1 Putative phenylalanine aminotransferase OS=Mycobacterium avium (strain 104) GN=pat PE=3 SV=1 106 309 9.0E-10
sp|Q6GIR8|HIS8_STAAR Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain MRSA252) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|Q6HHF6|HIS82_BACHK Histidinol-phosphate aminotransferase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisC2 PE=3 SV=1 74 302 1.0E-09
sp|A0PVN0|PATR_MYCUA Putative phenylalanine aminotransferase OS=Mycobacterium ulcerans (strain Agy99) GN=pat PE=3 SV=1 42 280 1.0E-09
sp|B2IDA4|HIS8_BEII9 Histidinol-phosphate aminotransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=hisC PE=3 SV=1 64 274 1.0E-09
sp|B1JPW1|HIS8_YERPY Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=hisC PE=3 SV=1 106 350 1.0E-09
sp|A7FJH1|HIS8_YERP3 Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=hisC PE=3 SV=1 106 350 1.0E-09
sp|P9WML5|PATR_MYCTU Putative phenylalanine aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pat PE=1 SV=1 42 278 1.0E-09
sp|P9WML4|PATR_MYCTO Putative phenylalanine aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pat PE=3 SV=1 42 278 1.0E-09
sp|A5U9A1|PATR_MYCTA Putative phenylalanine aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pat PE=3 SV=1 42 278 1.0E-09
sp|A4TKK4|HIS8_YERPP Histidinol-phosphate aminotransferase OS=Yersinia pestis (strain Pestoides F) GN=hisC PE=3 SV=1 106 310 1.0E-09
sp|Q1CGX0|HIS8_YERPN Histidinol-phosphate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hisC PE=3 SV=1 106 310 1.0E-09
sp|A9R2K5|HIS8_YERPG Histidinol-phosphate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=hisC PE=3 SV=1 106 310 1.0E-09
sp|Q8ZFX6|HIS8_YERPE Histidinol-phosphate aminotransferase OS=Yersinia pestis GN=hisC PE=3 SV=1 106 310 1.0E-09
sp|Q1C9R1|HIS8_YERPA Histidinol-phosphate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hisC PE=3 SV=1 106 310 1.0E-09
sp|Q6LT75|HIS8_PHOPR Histidinol-phosphate aminotransferase OS=Photobacterium profundum GN=hisC PE=3 SV=1 74 282 1.0E-09
sp|B2UPR9|HIS8_AKKM8 Histidinol-phosphate aminotransferase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=hisC PE=3 SV=1 84 275 1.0E-09
sp|A4XMY1|HIS8_CALS8 Histidinol-phosphate aminotransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hisC PE=3 SV=1 105 352 1.0E-09
sp|Q66C50|HIS8_YERPS Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hisC PE=3 SV=1 106 310 1.0E-09
sp|B2JZM8|HIS8_YERPB Histidinol-phosphate aminotransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=hisC PE=3 SV=1 106 310 1.0E-09
sp|Q8D8Q1|HIS8_VIBVU Histidinol-phosphate aminotransferase OS=Vibrio vulnificus (strain CMCP6) GN=hisC PE=3 SV=1 106 315 1.0E-09
sp|Q9PK04|DAPAT_CHLMU LL-diaminopimelate aminotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dapL PE=3 SV=1 45 335 1.0E-09
sp|Q1AY33|HIS8_RUBXD Histidinol-phosphate aminotransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=hisC PE=3 SV=1 105 356 1.0E-09
sp|A8YZZ5|HIS8_STAAT Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|P67725|HIS8_STAAN Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain N315) GN=hisC PE=1 SV=1 43 320 1.0E-09
sp|P67724|HIS8_STAAM Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|A6QF32|HIS8_STAAE Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain Newman) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|Q5HHU9|HIS8_STAAC Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain COL) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|A5IQS7|HIS8_STAA9 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain JH9) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|Q2G087|HIS8_STAA8 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|Q2FIR7|HIS8_STAA3 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain USA300) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|A6TZK2|HIS8_STAA2 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain JH1) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|A7WZL0|HIS8_STAA1 Histidinol-phosphate aminotransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hisC PE=3 SV=1 43 320 1.0E-09
sp|Q58874|Y1479_METJA Uncharacterized aminotransferase MJ1479 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1479 PE=3 SV=1 57 325 1.0E-09
sp|Q9ZBY8|PATR_STRCO Putative phenylalanine aminotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pat PE=3 SV=1 128 309 2.0E-09
sp|Q84I53|HIS8_BUCDN Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=hisC PE=3 SV=1 105 318 2.0E-09
sp|Q92MG0|HIS81_RHIME Histidinol-phosphate aminotransferase 1 OS=Rhizobium meliloti (strain 1021) GN=hisC1 PE=3 SV=1 57 279 2.0E-09
sp|Q736A5|HIS82_BACC1 Histidinol-phosphate aminotransferase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisC2 PE=3 SV=1 74 301 2.0E-09
sp|Q7MLS5|HIS8_VIBVY Histidinol-phosphate aminotransferase OS=Vibrio vulnificus (strain YJ016) GN=hisC PE=3 SV=1 106 315 2.0E-09
sp|Q8NTT4|PATR_CORGL Probable phenylalanine aminotransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pat PE=3 SV=1 43 278 2.0E-09
sp|Q2GAI1|HIS8_NOVAD Histidinol-phosphate aminotransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=hisC PE=3 SV=1 73 349 2.0E-09
sp|B4S8L6|HIS8_PROA2 Histidinol-phosphate aminotransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisC PE=3 SV=1 107 292 2.0E-09
sp|Q6MDE0|DAPAT_PARUW LL-diaminopimelate aminotransferase OS=Protochlamydia amoebophila (strain UWE25) GN=dapL PE=1 SV=2 45 415 2.0E-09
sp|P96681|YDFD_BACSU Uncharacterized HTH-type transcriptional regulator YdfD OS=Bacillus subtilis (strain 168) GN=ydfD PE=3 SV=1 43 351 2.0E-09
sp|Q51687|HIS8_PARDP Histidinol-phosphate aminotransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=hisC PE=3 SV=2 107 278 2.0E-09
sp|B8IRU5|HIS8_METNO Histidinol-phosphate aminotransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=hisC PE=3 SV=1 85 271 2.0E-09
sp|Q8YJK3|HIS8_BRUME Histidinol-phosphate aminotransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisC PE=3 SV=2 78 359 2.0E-09
sp|Q5LAZ9|HIS8_BACFN Histidinol-phosphate aminotransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisC PE=3 SV=1 105 372 2.0E-09
sp|B6IYQ0|HIS8_RHOCS Histidinol-phosphate aminotransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=hisC PE=3 SV=1 64 359 2.0E-09
sp|A7ICA9|HIS8_XANP2 Histidinol-phosphate aminotransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=hisC PE=3 SV=1 85 278 2.0E-09
sp|C3LU31|HIS8_VIBCM Histidinol-phosphate aminotransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=hisC PE=3 SV=1 106 315 2.0E-09
sp|A5F2A2|HIS8_VIBC3 Histidinol-phosphate aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=hisC PE=3 SV=1 106 315 2.0E-09
sp|Q1GET3|HIS8_RUEST Histidinol-phosphate aminotransferase OS=Ruegeria sp. (strain TM1040) GN=hisC PE=3 SV=1 102 336 3.0E-09
sp|Q28TL1|HIS8_JANSC Histidinol-phosphate aminotransferase OS=Jannaschia sp. (strain CCS1) GN=hisC PE=3 SV=1 61 278 3.0E-09
sp|Q8FY98|HIS8_BRUSU Histidinol-phosphate aminotransferase OS=Brucella suis biovar 1 (strain 1330) GN=hisC PE=3 SV=1 78 359 3.0E-09
sp|A5VSV7|HIS8_BRUO2 Histidinol-phosphate aminotransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hisC PE=3 SV=2 78 359 3.0E-09
sp|Q57AR7|HIS8_BRUAB Histidinol-phosphate aminotransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=hisC PE=3 SV=1 78 359 3.0E-09
sp|Q2YR81|HIS8_BRUA2 Histidinol-phosphate aminotransferase OS=Brucella abortus (strain 2308) GN=hisC PE=3 SV=1 78 359 3.0E-09
sp|Q163G3|HIS8_ROSDO Histidinol-phosphate aminotransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisC PE=3 SV=1 105 348 4.0E-09
sp|A7GN55|HIS8_BACCN Histidinol-phosphate aminotransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisC PE=3 SV=1 57 309 4.0E-09
sp|A4QAL4|PATR_CORGB Putative phenylalanine aminotransferase OS=Corynebacterium glutamicum (strain R) GN=pat PE=3 SV=1 43 278 4.0E-09
sp|B2HLJ8|PATR_MYCMM Putative phenylalanine aminotransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pat PE=3 SV=1 42 278 4.0E-09
sp|Q8KZ92|HIS8_BACNA Histidinol-phosphate aminotransferase OS=Bacillus subtilis subsp. natto GN=hisC PE=3 SV=1 57 279 4.0E-09
sp|Q1B1Z8|PATR_MYCSS Putative phenylalanine aminotransferase OS=Mycobacterium sp. (strain MCS) GN=pat PE=3 SV=1 42 278 5.0E-09
sp|A1UN51|PATR_MYCSK Putative phenylalanine aminotransferase OS=Mycobacterium sp. (strain KMS) GN=pat PE=3 SV=1 42 278 5.0E-09
sp|A1A2H6|HIS8_BIFAA Histidinol-phosphate aminotransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=hisC PE=3 SV=1 42 278 5.0E-09
sp|B3DXN2|HIS8_METI4 Histidinol-phosphate aminotransferase OS=Methylacidiphilum infernorum (isolate V4) GN=hisC PE=3 SV=1 97 356 5.0E-09
sp|Q88UE6|HIS8_LACPL Histidinol-phosphate aminotransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisC PE=3 SV=1 105 360 6.0E-09
sp|Q5E637|HIS8_VIBF1 Histidinol-phosphate aminotransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hisC PE=3 SV=1 106 282 6.0E-09
sp|Q87QL0|HIS8_VIBPA Histidinol-phosphate aminotransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisC PE=3 SV=1 106 315 7.0E-09
sp|Q98G10|HIS82_RHILO Histidinol-phosphate aminotransferase 2 OS=Rhizobium loti (strain MAFF303099) GN=hisC2 PE=3 SV=1 84 359 7.0E-09
sp|Q49VS0|HIS8_STAS1 Histidinol-phosphate aminotransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisC PE=3 SV=1 54 320 7.0E-09
sp|P17731|HIS8_BACSU Histidinol-phosphate aminotransferase OS=Bacillus subtilis (strain 168) GN=hisC PE=3 SV=3 57 279 7.0E-09
sp|B1VP97|PATR_STRGG Putative phenylalanine aminotransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pat PE=3 SV=1 120 309 9.0E-09
sp|Q3B3L3|HIS8_CHLL7 Histidinol-phosphate aminotransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisC PE=3 SV=1 45 278 9.0E-09
sp|Q64RE8|HIS8_BACFR Histidinol-phosphate aminotransferase OS=Bacteroides fragilis (strain YCH46) GN=hisC PE=3 SV=1 105 372 9.0E-09
sp|Q81FQ1|HIS81_BACCR Histidinol-phosphate aminotransferase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisC1 PE=3 SV=1 66 318 9.0E-09
sp|B7GHJ8|HIS8_ANOFW Histidinol-phosphate aminotransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hisC PE=3 SV=1 85 413 1.0E-08
sp|Q987C8|HIS81_RHILO Histidinol-phosphate aminotransferase 1 OS=Rhizobium loti (strain MAFF303099) GN=hisC1 PE=3 SV=1 76 272 1.0E-08
sp|Q96QU6|1A1L1_HUMAN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Homo sapiens GN=ACCS PE=1 SV=1 41 427 1.0E-08
sp|P18485|1A12_SOLLC 1-aminocyclopropane-1-carboxylate synthase 2 OS=Solanum lycopersicum GN=ACS2 PE=1 SV=2 44 351 1.0E-08
sp|B0K625|HIS8_THEPX Histidinol-phosphate aminotransferase OS=Thermoanaerobacter sp. (strain X514) GN=hisC PE=3 SV=1 54 393 1.0E-08
sp|Q84I51|HIS8_BUCSC Histidinol-phosphate aminotransferase OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=hisC PE=3 SV=1 107 284 1.0E-08
sp|B0K735|HIS8_THEP3 Histidinol-phosphate aminotransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisC PE=3 SV=1 54 393 1.0E-08
sp|A7MX17|HIS8_VIBCB Histidinol-phosphate aminotransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=hisC PE=3 SV=1 106 315 2.0E-08
sp|P37821|1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica GN=ACS-1 PE=1 SV=2 85 354 2.0E-08
sp|B0BC25|DAPAT_CHLTB LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dapL PE=3 SV=1 97 335 2.0E-08
sp|B0B7W0|DAPAT_CHLT2 LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dapL PE=3 SV=1 97 335 2.0E-08
sp|B4SGL8|HIS8_PELPB Histidinol-phosphate aminotransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisC PE=3 SV=1 107 273 2.0E-08
sp|Q8N5Z0|AADAT_HUMAN Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Homo sapiens GN=AADAT PE=1 SV=2 106 279 2.0E-08
sp|A5N7Q7|HIS8_CLOK5 Histidinol-phosphate aminotransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=hisC PE=3 SV=1 107 373 2.0E-08
sp|B9E168|HIS8_CLOK1 Histidinol-phosphate aminotransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=hisC PE=3 SV=1 107 373 2.0E-08
sp|O84395|DAPAT_CHLTR LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dapL PE=1 SV=2 97 335 3.0E-08
sp|Q3KLW3|DAPAT_CHLTA LL-diaminopimelate aminotransferase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dapL PE=3 SV=1 97 335 3.0E-08
sp|Q67KI2|HIS8_SYMTH Histidinol-phosphate aminotransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisC PE=3 SV=1 76 376 3.0E-08
sp|Q63A05|HIS82_BACCZ Histidinol-phosphate aminotransferase 2 OS=Bacillus cereus (strain ZK / E33L) GN=hisC2 PE=3 SV=1 74 302 3.0E-08
sp|A7MJP4|HIS8_CROS8 Histidinol-phosphate aminotransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=hisC PE=3 SV=1 106 278 3.0E-08
sp|Q81P62|HIS82_BACAN Histidinol-phosphate aminotransferase 2 OS=Bacillus anthracis GN=hisC2 PE=3 SV=1 74 302 4.0E-08
sp|A4IQ80|HIS8_GEOTN Histidinol-phosphate aminotransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hisC PE=3 SV=1 63 279 4.0E-08
sp|A5CZ78|HIS8_PELTS Histidinol-phosphate aminotransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisC PE=3 SV=1 84 316 4.0E-08
sp|B8I5V1|HIS8_CLOCE Histidinol-phosphate aminotransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisC PE=3 SV=1 35 353 4.0E-08
sp|Q47KH1|PATR_THEFY Putative phenylalanine aminotransferase OS=Thermobifida fusca (strain YX) GN=pat PE=3 SV=1 74 278 4.0E-08
sp|Q10DK7|1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=2 SV=1 105 397 4.0E-08
sp|A2XLL2|1A11_ORYSI 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica GN=ACC1 PE=2 SV=2 105 397 4.0E-08
sp|Q4AC99|1A1L2_HUMAN Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Homo sapiens GN=ACCSL PE=2 SV=3 45 271 5.0E-08
sp|C0ZM44|PATR_RHOE4 Putative phenylalanine aminotransferase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=pat PE=3 SV=1 126 278 5.0E-08
sp|A8HZS2|HIS8_AZOC5 Histidinol-phosphate aminotransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=hisC PE=3 SV=1 64 278 5.0E-08
sp|Q9M2Y8|1A19_ARATH 1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana GN=ACS9 PE=1 SV=1 81 304 5.0E-08
sp|B9EAC1|HIS8_MACCJ Histidinol-phosphate aminotransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=hisC PE=3 SV=1 72 278 5.0E-08
sp|Q93ZN9|DAPAT_ARATH LL-diaminopimelate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=DAP PE=1 SV=1 45 335 6.0E-08
sp|Q65RB2|HIS82_MANSM Histidinol-phosphate aminotransferase 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisC2 PE=3 SV=1 107 278 6.0E-08
sp|A8AEK3|HIS8_CITK8 Histidinol-phosphate aminotransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=hisC PE=3 SV=1 106 278 7.0E-08
sp|C1B997|PATR_RHOOB Putative phenylalanine aminotransferase OS=Rhodococcus opacus (strain B4) GN=pat PE=3 SV=1 105 270 7.0E-08
sp|Q0S962|PATR_RHOJR Putative phenylalanine aminotransferase OS=Rhodococcus jostii (strain RHA1) GN=pat PE=3 SV=2 120 273 7.0E-08
sp|Q8G4S8|HIS8_BIFLO Histidinol-phosphate aminotransferase OS=Bifidobacterium longum (strain NCC 2705) GN=hisC PE=3 SV=1 42 278 9.0E-08
sp|Q82FJ1|PATR_STRAW Putative phenylalanine aminotransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pat PE=3 SV=1 105 309 9.0E-08
sp|A1ACN3|HIS8_ECOK1 Histidinol-phosphate aminotransferase OS=Escherichia coli O1:K1 / APEC GN=hisC PE=3 SV=1 106 278 1.0E-07
sp|P77730|YDCR_ECOLI Uncharacterized HTH-type transcriptional regulator YdcR OS=Escherichia coli (strain K12) GN=ydcR PE=3 SV=1 79 324 1.0E-07
sp|P17736|HIS8_HALVD Histidinol-phosphate aminotransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=hisC PE=3 SV=1 106 275 1.0E-07
sp|Q57004|HIS82_HAEIN Histidinol-phosphate aminotransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisC2 PE=3 SV=1 105 272 1.0E-07
sp|B9DK21|HIS8_STACT Histidinol-phosphate aminotransferase OS=Staphylococcus carnosus (strain TM300) GN=hisC PE=3 SV=1 100 320 1.0E-07
sp|O28255|HIS82_ARCFU Histidinol-phosphate aminotransferase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisC2 PE=3 SV=1 43 349 1.0E-07
sp|A4WUN9|HIS8_RHOS5 Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisC PE=3 SV=1 62 278 2.0E-07
sp|Q253K9|DAPAT_CHLFF LL-diaminopimelate aminotransferase OS=Chlamydophila felis (strain Fe/C-56) GN=dapL PE=3 SV=1 106 303 2.0E-07
sp|A8GC78|HIS8_SERP5 Histidinol-phosphate aminotransferase OS=Serratia proteamaculans (strain 568) GN=hisC PE=3 SV=1 106 322 2.0E-07
sp|Q28DB5|ALAT2_XENTR Alanine aminotransferase 2 OS=Xenopus tropicalis GN=gpt2 PE=2 SV=1 172 425 2.0E-07
sp|A7Z614|HIS8_BACMF Histidinol-phosphate aminotransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hisC PE=3 SV=1 57 279 2.0E-07
sp|O28277|HIS81_ARCFU Histidinol-phosphate aminotransferase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisC1 PE=3 SV=1 64 286 2.0E-07
sp|Q37001|1A15_ARATH 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana GN=ACS5 PE=1 SV=1 81 354 2.0E-07
sp|A5UGY2|HIS8_HAEIG Histidinol-phosphate aminotransferase OS=Haemophilus influenzae (strain PittGG) GN=hisC PE=3 SV=1 74 278 2.0E-07
sp|Q4QN73|HIS81_HAEI8 Histidinol-phosphate aminotransferase 1 OS=Haemophilus influenzae (strain 86-028NP) GN=hisC1 PE=3 SV=2 74 278 2.0E-07
sp|A5UA19|HIS8_HAEIE Histidinol-phosphate aminotransferase OS=Haemophilus influenzae (strain PittEE) GN=hisC PE=3 SV=1 74 278 2.0E-07
sp|Q8AAB8|DAPAT_BACTN LL-diaminopimelate aminotransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dapL PE=3 SV=1 43 282 2.0E-07
sp|B1HTD4|HIS8_LYSSC Histidinol-phosphate aminotransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=hisC PE=3 SV=1 68 358 3.0E-07
sp|Q6GM82|ALAT2_XENLA Alanine aminotransferase 2 OS=Xenopus laevis GN=gpt2 PE=2 SV=1 172 425 3.0E-07
sp|Q10334|ALAT_SCHPO Putative alanine aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.08 PE=3 SV=1 105 271 3.0E-07
sp|Q6ABX6|PATR_LEIXX Putative phenylalanine aminotransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pat PE=3 SV=1 91 348 3.0E-07
sp|B9LNJ8|HIS8_HALLT Histidinol-phosphate aminotransferase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=hisC PE=3 SV=1 106 275 3.0E-07
sp|Q7UZZ3|DAPAT_PROMP LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dapL PE=3 SV=1 35 277 3.0E-07
sp|B1XKF6|DAPAT_SYNP2 LL-diaminopimelate aminotransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=dapL PE=3 SV=1 45 277 3.0E-07
sp|P44423|HIS81_HAEIN Histidinol-phosphate aminotransferase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisC1 PE=3 SV=1 74 278 4.0E-07
sp|P31531|1A1C_SOYBN 1-aminocyclopropane-1-carboxylate synthase OS=Glycine max GN=ACS1 PE=2 SV=1 80 431 4.0E-07
sp|A6GY79|HIS8_FLAPJ Histidinol-phosphate aminotransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=hisC PE=3 SV=1 104 371 4.0E-07
sp|Q98B00|HIS83_RHILO Histidinol-phosphate aminotransferase 3 OS=Rhizobium loti (strain MAFF303099) GN=hisC3 PE=3 SV=1 54 278 4.0E-07
sp|A1TGS6|PATR_MYCVP Putative phenylalanine aminotransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pat PE=3 SV=1 42 278 4.0E-07
sp|Q9SAR0|1A16_ARATH 1-aminocyclopropane-1-carboxylate synthase 6 OS=Arabidopsis thaliana GN=ACS6 PE=1 SV=2 58 354 4.0E-07
sp|Q5E9H2|1A1L1_BOVIN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Bos taurus GN=ACCS PE=2 SV=1 41 427 5.0E-07
sp|Q824A4|DAPAT_CHLCV LL-diaminopimelate aminotransferase OS=Chlamydophila caviae (strain GPIC) GN=dapL PE=3 SV=1 61 303 5.0E-07
sp|Q3J7H2|HIS82_NITOC Histidinol-phosphate aminotransferase 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisC2 PE=3 SV=1 60 273 5.0E-07
sp|Q8ABA8|HIS8_BACTN Histidinol-phosphate aminotransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisC PE=3 SV=1 107 371 5.0E-07
sp|O27624|HIS8_METTH Histidinol-phosphate aminotransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisC PE=3 SV=1 31 321 5.0E-07
sp|Q7VQW9|HIS8_BLOFL Histidinol-phosphate aminotransferase OS=Blochmannia floridanus GN=hisC PE=3 SV=1 106 374 5.0E-07
sp|Q81C43|HIS82_BACCR Histidinol-phosphate aminotransferase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisC2 PE=3 SV=1 106 302 6.0E-07
sp|Q5QZ49|HIS81_IDILO Histidinol-phosphate aminotransferase 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hisC1 PE=3 SV=1 106 272 6.0E-07
sp|P39389|YJIR_ECOLI Uncharacterized HTH-type transcriptional regulator YjiR OS=Escherichia coli (strain K12) GN=yjiR PE=3 SV=1 81 407 6.0E-07
sp|Q1LT68|HIS8_BAUCH Histidinol-phosphate aminotransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=hisC PE=3 SV=1 105 282 6.0E-07
sp|B5BFB9|HIS8_SALPK Histidinol-phosphate aminotransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=hisC PE=3 SV=1 106 278 7.0E-07
sp|Q5PDP4|HIS8_SALPA Histidinol-phosphate aminotransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hisC PE=3 SV=1 106 278 7.0E-07
sp|Q9T065|1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1 105 354 7.0E-07
sp|Q43309|1A14_ARATH 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana GN=ACS4 PE=1 SV=1 107 427 7.0E-07
sp|A9MSC2|HIS8_SALPB Histidinol-phosphate aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=hisC PE=3 SV=1 106 278 8.0E-07
sp|B4SX42|HIS8_SALNS Histidinol-phosphate aminotransferase OS=Salmonella newport (strain SL254) GN=hisC PE=3 SV=1 106 278 8.0E-07
sp|A0PXP5|HIS8_CLONN Histidinol-phosphate aminotransferase OS=Clostridium novyi (strain NT) GN=hisC PE=3 SV=1 104 279 8.0E-07
sp|Q4QLD1|HIS82_HAEI8 Histidinol-phosphate aminotransferase 2 OS=Haemophilus influenzae (strain 86-028NP) GN=hisC2 PE=3 SV=1 105 272 8.0E-07
sp|P55683|HIS8_RHISN Histidinol-phosphate aminotransferase OS=Rhizobium sp. (strain NGR234) GN=hisC PE=3 SV=1 34 278 8.0E-07
sp|Q42881|1A13_SOLLC 1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1 85 397 9.0E-07
sp|A2BT75|DAPAT_PROMS LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus (strain AS9601) GN=dapL PE=3 SV=1 34 277 9.0E-07
sp|A7HCR6|HIS8_ANADF Histidinol-phosphate aminotransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=hisC PE=3 SV=1 106 270 9.0E-07
sp|Q3UX83|1A1L2_MOUSE Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Mus musculus GN=Accsl PE=2 SV=1 76 271 9.0E-07
sp|A2AIG8|1A1L1_MOUSE 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Mus musculus GN=Accs PE=2 SV=1 41 351 1.0E-06
sp|P27486|1A1C_DIACA 1-aminocyclopropane-1-carboxylate synthase OS=Dianthus caryophyllus GN=ACS2 PE=2 SV=1 81 397 1.0E-06
sp|Q323J1|HIS8_SHIBS Histidinol-phosphate aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=hisC PE=3 SV=1 106 278 1.0E-06
sp|Q9A671|HIS81_CAUCR Histidinol-phosphate aminotransferase 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisC1 PE=3 SV=1 61 348 1.0E-06
sp|A7ZNJ3|HIS8_ECO24 Histidinol-phosphate aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hisC PE=3 SV=1 106 278 1.0E-06
sp|B7NQG9|HIS8_ECO7I Histidinol-phosphate aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hisC PE=3 SV=1 106 278 1.0E-06
sp|Q2SBJ7|HIS8_HAHCH Histidinol-phosphate aminotransferase OS=Hahella chejuensis (strain KCTC 2396) GN=hisC PE=3 SV=1 68 364 1.0E-06
sp|A3PEY9|DAPAT_PROM0 LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=dapL PE=3 SV=1 35 277 1.0E-06
sp|Q6AQK2|HIS8_DESPS Histidinol-phosphate aminotransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisC PE=3 SV=1 105 304 1.0E-06
sp|P52893|ALAM_YEAST Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALT1 PE=1 SV=1 76 393 2.0E-06
sp|Q3BUF6|HIS8_XANC5 Histidinol-phosphate aminotransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hisC PE=3 SV=1 78 355 2.0E-06
sp|B9KPH4|HIS8_RHOSK Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisC PE=3 SV=1 62 278 2.0E-06
sp|Q9HQS0|HIS8_HALSA Histidinol-phosphate aminotransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisC PE=3 SV=3 75 298 2.0E-06
sp|B0R4Q4|HIS8_HALS3 Histidinol-phosphate aminotransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisC PE=3 SV=1 75 298 2.0E-06
sp|Q318P3|DAPAT_PROM9 LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=dapL PE=3 SV=1 34 277 2.0E-06
sp|Q9FEW2|HIS8_NICPL Histidinol-phosphate aminotransferase, chloroplastic OS=Nicotiana plumbaginifolia GN=HPA PE=1 SV=1 41 279 2.0E-06
sp|Q3Z879|HIS8_DEHM1 Histidinol-phosphate aminotransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisC PE=3 SV=1 106 351 2.0E-06
sp|B2TYF9|HIS8_SHIB3 Histidinol-phosphate aminotransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hisC PE=3 SV=1 106 278 2.0E-06
sp|Q32EF0|HIS8_SHIDS Histidinol-phosphate aminotransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hisC PE=3 SV=1 106 278 2.0E-06
sp|Q5WGR9|HIS8_BACSK Histidinol-phosphate aminotransferase OS=Bacillus clausii (strain KSM-K16) GN=hisC PE=3 SV=1 104 277 2.0E-06
sp|Q8BGT5|ALAT2_MOUSE Alanine aminotransferase 2 OS=Mus musculus GN=Gpt2 PE=1 SV=1 66 430 2.0E-06
sp|B7LUF2|HIS8_ESCF3 Histidinol-phosphate aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hisC PE=3 SV=1 106 278 2.0E-06
sp|O82030|HIS8_TOBAC Histidinol-phosphate aminotransferase, chloroplastic OS=Nicotiana tabacum GN=HPA PE=2 SV=1 41 279 2.0E-06
sp|Q3AMU5|DAPAT_SYNSC LL-diaminopimelate aminotransferase OS=Synechococcus sp. (strain CC9605) GN=dapL PE=3 SV=1 35 277 2.0E-06
sp|Q5QWQ9|HIS82_IDILO Histidinol-phosphate aminotransferase 2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hisC2 PE=3 SV=1 105 279 2.0E-06
sp|O26158|DAPAT_METTH LL-diaminopimelate aminotransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dapL PE=1 SV=1 39 338 2.0E-06
sp|Q92A83|HIS8_LISIN Histidinol-phosphate aminotransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisC PE=1 SV=1 63 351 2.0E-06
sp|Q9PBC6|HIS8_XYLFA Histidinol-phosphate aminotransferase OS=Xylella fastidiosa (strain 9a5c) GN=hisC PE=3 SV=1 84 355 3.0E-06
sp|Q11VM5|HIS8_CYTH3 Histidinol-phosphate aminotransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hisC PE=3 SV=1 102 371 3.0E-06
sp|B7L9P8|HIS8_ECO55 Histidinol-phosphate aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=hisC PE=3 SV=1 106 278 3.0E-06
sp|Q3J445|HIS8_RHOS4 Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisC PE=3 SV=1 62 278 3.0E-06
sp|B5YU77|HIS8_ECO5E Histidinol-phosphate aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hisC PE=3 SV=1 106 278 3.0E-06
sp|Q9S5G6|HIS8_ECO57 Histidinol-phosphate aminotransferase OS=Escherichia coli O157:H7 GN=hisC PE=3 SV=1 106 278 3.0E-06
sp|Q83KJ6|HIS8_SHIFL Histidinol-phosphate aminotransferase OS=Shigella flexneri GN=hisC PE=3 SV=1 106 278 3.0E-06
sp|Q0T3A6|HIS8_SHIF8 Histidinol-phosphate aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=hisC PE=3 SV=1 106 278 3.0E-06
sp|B7MWU0|HIS8_ECO81 Histidinol-phosphate aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=hisC PE=3 SV=1 106 278 3.0E-06
sp|B2GBR8|HIS8_LACF3 Histidinol-phosphate aminotransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=hisC PE=3 SV=1 60 353 3.0E-06
sp|Q00379|1A12_CUCPE 1-aminocyclopropane-1-carboxylate synthase 2 OS=Cucurbita pepo GN=ACS2 PE=2 SV=1 80 351 3.0E-06
sp|A5UN82|DAPAT_METS3 LL-diaminopimelate aminotransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=dapL PE=3 SV=1 39 427 3.0E-06
sp|Q8Y5X8|HIS8_LISMO Histidinol-phosphate aminotransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisC PE=3 SV=1 63 278 3.0E-06
sp|Q930J0|HIS83_RHIME Histidinol-phosphate aminotransferase 3 OS=Rhizobium meliloti (strain 1021) GN=hisC3 PE=3 SV=1 104 272 4.0E-06
sp|Q3ARM7|HIS8_CHLCH Histidinol-phosphate aminotransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisC PE=3 SV=1 45 273 4.0E-06
sp|C5D3D2|HIS8_GEOSW Histidinol-phosphate aminotransferase OS=Geobacillus sp. (strain WCH70) GN=hisC PE=3 SV=1 43 279 4.0E-06
sp|B7MDH5|HIS8_ECO45 Histidinol-phosphate aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hisC PE=3 SV=1 106 278 4.0E-06
sp|Q65S79|HIS81_MANSM Histidinol-phosphate aminotransferase 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisC1 PE=3 SV=2 106 272 4.0E-06
sp|P53090|ARO8_YEAST Aromatic/aminoadipate aminotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO8 PE=1 SV=1 104 348 4.0E-06
sp|Q46IX2|DAPAT_PROMT LL-diaminopimelate aminotransferase OS=Prochlorococcus marinus (strain NATL2A) GN=dapL PE=3 SV=1 33 277 5.0E-06
sp|A3PIA4|HIS8_RHOS1 Histidinol-phosphate aminotransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=hisC PE=3 SV=1 62 278 5.0E-06
sp|B1LP20|HIS8_ECOSM Histidinol-phosphate aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hisC PE=3 SV=1 106 278 6.0E-06
sp|Q15RU8|HIS8_PSEA6 Histidinol-phosphate aminotransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hisC PE=3 SV=1 106 282 6.0E-06
sp|Q5V4K3|HIS8_HALMA Histidinol-phosphate aminotransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisC PE=3 SV=1 41 276 6.0E-06
sp|Q2NFU1|DAPAT_METST LL-diaminopimelate aminotransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=dapL PE=3 SV=1 35 337 6.0E-06
sp|Q8FNZ1|HIS8_COREF Histidinol-phosphate aminotransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisC PE=3 SV=1 80 385 6.0E-06
sp|P52894|ALA2_HORVU Alanine aminotransferase 2 OS=Hordeum vulgare PE=1 SV=1 72 237 6.0E-06
sp|Q3AW44|DAPAT_SYNS9 LL-diaminopimelate aminotransferase OS=Synechococcus sp. (strain CC9902) GN=dapL PE=3 SV=1 35 277 6.0E-06
sp|A0PP15|HIS8_MYCUA Histidinol-phosphate aminotransferase OS=Mycobacterium ulcerans (strain Agy99) GN=hisC PE=3 SV=1 56 308 6.0E-06
sp|Q5KXV3|HIS8_GEOKA Histidinol-phosphate aminotransferase OS=Geobacillus kaustophilus (strain HTA426) GN=hisC PE=3 SV=1 104 279 7.0E-06
sp|Q64SY6|DAPAT_BACFR LL-diaminopimelate aminotransferase OS=Bacteroides fragilis (strain YCH46) GN=dapL PE=3 SV=1 43 337 7.0E-06
sp|A5FVN2|HIS8_ACICJ Histidinol-phosphate aminotransferase OS=Acidiphilium cryptum (strain JF-5) GN=hisC PE=3 SV=1 45 351 7.0E-06
sp|Q9S7E9|GGT2_ARATH Glutamate--glyoxylate aminotransferase 2 OS=Arabidopsis thaliana GN=GGAT2 PE=1 SV=1 67 236 8.0E-06
sp|Q5LC03|DAPAT_BACFN LL-diaminopimelate aminotransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dapL PE=1 SV=1 43 337 8.0E-06
sp|Q06429|1A11_ARATH 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Arabidopsis thaliana GN=ACS1 PE=1 SV=2 81 425 8.0E-06
sp|A5GW23|DAPAT_SYNR3 LL-diaminopimelate aminotransferase OS=Synechococcus sp. (strain RCC307) GN=dapL PE=3 SV=1 42 278 9.0E-06
sp|B2HQA3|HIS8_MYCMM Histidinol-phosphate aminotransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hisC PE=3 SV=1 56 308 9.0E-06
sp|Q0AM22|HIS8_MARMM Histidinol-phosphate aminotransferase OS=Maricaulis maris (strain MCS10) GN=hisC PE=3 SV=1 81 358 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0070279 vitamin B6 binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0019842 vitamin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071520
MSSTANNNQDRSNLIPFSSRLREGRALALDVWTIYNALNLPPDCINLGQGYMNFAPPKWITEAAEQALNSVAPNH
YSHPRGRIRLREAIKNFYDPLFNRSLNVDSEILITSGANEGMYSVLTAFLEQGDEVILFEPFFDQYLPSVTFNGG
KPVYVPLHPPASHIKKPTSDDWTIDMDELRRAVTPRTKIIIVNTPHNPVGKVFTRKELQGIADIAEEFNLLVMSD
EVYDSLVFDNKEHVRMANLPGMWDRTVTVGSAGKAFAATGWRIGWLIGPKNLIQPTLAATTRIVFCSVSPLQEAA
AAGLEQANQRNFFQIQRNEYTERRTVLTDVFDKLGLRYTLPEGSYFILLDISNVEFPEDYPFPESVMGRGRDFRA
CWFMAMEIGVSSIPVSEFYCEEHANLGEAYARFAFCKDVDNLKAAAERFQKIKKYIK*
Coding >AgabiH97|071520
ATGTCTTCTACGGCTAACAATAACCAGGACCGATCCAACCTCATCCCTTTCTCTTCCCGCCTCAGGGAGGGTAGG
GCACTTGCTCTCGATGTTTGGACCATCTACAATGCTCTCAATCTTCCCCCTGATTGTATTAATCTCGGCCAGGGA
TATATGAATTTCGCACCCCCGAAGTGGATCACAGAAGCTGCAGAGCAAGCTCTCAACTCCGTCGCGCCAAACCAC
TACTCTCATCCCCGAGGACGTATCCGTCTGCGCGAGGCTATCAAGAATTTCTATGATCCACTCTTCAACAGGAGT
CTCAATGTCGATTCAGAGATCTTGATCACGAGCGGTGCCAATGAAGGCATGTACTCCGTTTTGACCGCGTTTCTA
GAACAAGGAGATGAGGTCATTTTGTTTGAACCCTTCTTCGACCAATACCTTCCTTCCGTTACATTCAATGGAGGA
AAACCCGTTTACGTTCCTTTACATCCTCCCGCTTCTCATATCAAGAAGCCGACTAGTGACGACTGGACCATTGAC
ATGGACGAACTCAGGCGTGCTGTCACTCCCCGCACAAAAATCATCATCGTCAATACACCTCACAATCCCGTTGGC
AAAGTATTTACGCGGAAAGAGCTACAAGGCATTGCCGATATCGCTGAAGAGTTTAACCTTCTCGTAATGTCAGAC
GAAGTTTACGATTCTTTGGTTTTTGACAACAAAGAACATGTGCGCATGGCCAATCTCCCAGGCATGTGGGATCGC
ACAGTGACTGTCGGCTCTGCAGGAAAAGCATTTGCCGCCACCGGTTGGCGAATTGGTTGGCTTATCGGACCAAAG
AATCTCATCCAACCGACTCTTGCCGCAACAACCAGAATTGTCTTTTGCTCCGTATCCCCATTGCAAGAGGCTGCT
GCTGCTGGTCTCGAACAAGCAAACCAACGCAACTTCTTCCAAATTCAGCGTAACGAATATACGGAACGCCGCACT
GTCCTTACCGATGTCTTTGACAAGCTCGGTCTGAGGTATACTCTCCCTGAAGGCAGCTACTTCATTCTTCTGGAT
ATCTCCAACGTTGAGTTTCCTGAAGACTATCCCTTCCCCGAGAGCGTTATGGGTCGCGGCCGTGACTTCAGGGCT
TGCTGGTTCATGGCAATGGAAATCGGAGTTTCTTCTATCCCTGTTAGCGAGTTCTACTGTGAAGAGCACGCCAAC
CTCGGAGAAGCTTATGCGCGATTTGCCTTCTGCAAGGATGTTGATAATCTGAAAGCTGCTGCGGAACGCTTTCAG
AAAATCAAGAAGTACATAAAATGA
Transcript >AgabiH97|071520
ATGTCTTCTACGGCTAACAATAACCAGGACCGATCCAACCTCATCCCTTTCTCTTCCCGCCTCAGGGAGGGTAGG
GCACTTGCTCTCGATGTTTGGACCATCTACAATGCTCTCAATCTTCCCCCTGATTGTATTAATCTCGGCCAGGGA
TATATGAATTTCGCACCCCCGAAGTGGATCACAGAAGCTGCAGAGCAAGCTCTCAACTCCGTCGCGCCAAACCAC
TACTCTCATCCCCGAGGACGTATCCGTCTGCGCGAGGCTATCAAGAATTTCTATGATCCACTCTTCAACAGGAGT
CTCAATGTCGATTCAGAGATCTTGATCACGAGCGGTGCCAATGAAGGCATGTACTCCGTTTTGACCGCGTTTCTA
GAACAAGGAGATGAGGTCATTTTGTTTGAACCCTTCTTCGACCAATACCTTCCTTCCGTTACATTCAATGGAGGA
AAACCCGTTTACGTTCCTTTACATCCTCCCGCTTCTCATATCAAGAAGCCGACTAGTGACGACTGGACCATTGAC
ATGGACGAACTCAGGCGTGCTGTCACTCCCCGCACAAAAATCATCATCGTCAATACACCTCACAATCCCGTTGGC
AAAGTATTTACGCGGAAAGAGCTACAAGGCATTGCCGATATCGCTGAAGAGTTTAACCTTCTCGTAATGTCAGAC
GAAGTTTACGATTCTTTGGTTTTTGACAACAAAGAACATGTGCGCATGGCCAATCTCCCAGGCATGTGGGATCGC
ACAGTGACTGTCGGCTCTGCAGGAAAAGCATTTGCCGCCACCGGTTGGCGAATTGGTTGGCTTATCGGACCAAAG
AATCTCATCCAACCGACTCTTGCCGCAACAACCAGAATTGTCTTTTGCTCCGTATCCCCATTGCAAGAGGCTGCT
GCTGCTGGTCTCGAACAAGCAAACCAACGCAACTTCTTCCAAATTCAGCGTAACGAATATACGGAACGCCGCACT
GTCCTTACCGATGTCTTTGACAAGCTCGGTCTGAGGTATACTCTCCCTGAAGGCAGCTACTTCATTCTTCTGGAT
ATCTCCAACGTTGAGTTTCCTGAAGACTATCCCTTCCCCGAGAGCGTTATGGGTCGCGGCCGTGACTTCAGGGCT
TGCTGGTTCATGGCAATGGAAATCGGAGTTTCTTCTATCCCTGTTAGCGAGTTCTACTGTGAAGAGCACGCCAAC
CTCGGAGAAGCTTATGCGCGATTTGCCTTCTGCAAGGATGTTGATAATCTGAAAGCTGCTGCGGAACGCTTTCAG
AAAATCAAGAAGTACATAAAATGA
Gene >AgabiH97|071520
ATGTCTTCTACGGCTAACAATAACCAGGACCGATCCAACCTCATCCCTTTCTCTTCCCGCCTCAGGGAGGGTAGG
GCACTTGCTCTCGATGTTTGGACCATCTACAAGTAGTCTTTCTCGTCTGCCCATGCTCGATACATTTTCAAAATT
TCCCATAGTGCTCTCAATCTTCCCCCTGATTGTATTAATCTCGGCCAGGGATATATGAATTTCGCACCCCCGAAG
TGGATCACAGAAGCTGCAGAGCAAGCTCTCAACTCCGTCGCGCCAAACCACTACTCTCATCCCCGAGGACGTATC
CGTCTGCGCGAGGCTATCAAGAATTTCTATGATCCACTCTTCAACAGGAGTCTCAATGTCGATTCAGAGATCTTG
ATCACGAGCGGTGCCAATGAAGGTATGTGTAGTTCGCTTTGCAGGGTTGAAGCATTGTCTGAAAGTTATATACTT
GCAGGCATGTACTCCGTTTTGACCGCGTTTCTAGAACAAGGAGATGAGGTCATTTTGTTTGAACCCTTCTTCGAC
CAATACCTTCCTTCCGTTACATTCAATGGAGGAAAACCCGTTTACGTTCCTTTACATCCTCCCGCTTCTCATATC
AAGAAGCCGACTAGTGACGACTGGACCATTGACATGGACGAACTCAGGTGTGTCATTGTAATTCCTATGAATCTA
TTGCGTGTACCTCATCCGAATCCAATGTTACTGCTGCTTGAAGGCGTGCTGTCACTCCCCGCACAAAAATCATCA
TCGTCAATACACCTCACAATCCCGTTGGCAAAGTATTTACGCGGAAAGAGCTACAAGGCATTGCCGATATCGCTG
AAGAGTTTAACCTTCTCGTAATGTCAGACGAAGTTGTGAGTATAAATGTCGCCTCGATCTCGTATAATGGTCCCT
GAAAGGCGAATAATGTCAGTACGATTCTTTGGTTTTTGACAACAAAGAACATGTGCGCATGGCCAATCTCCCAGG
CATGTGGGATCGCACAGTGACTGTCGGCTCTGCAGGAAGTGAGTACCTCATCCTCTGCCGTCGAATAGATTATCA
TAACACTCCACATGATAAACAATCATGTACTAACCCATCGCTCAGAAGCATTTGCCGCCACCGGTTGGCGAATTG
GTTGGCTTATCGGACCAAAGAATCTCATCCAACCGACTCTTGCCGCAACAACCAGAATTGTCTTTTGCTCCGTAT
CCCCATTGCAAGAGGCTGCTGCTGCTGGTCTCGAACAAGCAAACCAACGCAACTTCTTCCAAATTCAGCGTAACG
AATATACGGAACGCCGCACTGTCCTTACCGATGTCTTTGACAAGCTCGGTCTGAGGTATACTCTCCCTGAAGGCA
GCTACTTCATTCTTCTGGTCTGTCTGTATATCATTCACCTTCATTGTACCCGTTAACCTGGCCCTTCACTTTTAG
GATATCTCCAACGTTGAGTTTCCTGAAGACTATCCCTTCCCCGAGAGCGTTATGGGTCGCGGCCGTGACTTCAGG
TAAGTTCTGTGCTGTTGTTACAGAGGGCGCCATACACAGTGTTCTCCCAGGGCTTGCTGGTTCATGGCAATGGAA
ATCGGAGTTTCTTCTATCCCTGTTAGCGAGGTGAGCTAGGATATCCGATCTCTCGAGTATTTTGACTGAGCGCAA
TTTGCTAGTTCTACTGTGAAGAGCACGCCAACCTCGGAGAAGCTTATGCGCGATTTGCCTTCTGCAAGGATGTTG
ATAATCTGAAAGCTGCTGCGGAACGCTTTCAGAAAATCAAGAAGTACATAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail