Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071300
Gene name
Locationscaffold_4:1471702..1474915
Strand+
Gene length (bp)3213
Transcript length (bp)2106
Coding sequence length (bp)2106
Protein length (aa) 702

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17168 DUF5127 Domain of unknown function (DUF5127) 1.7E-78 103 333
PF16335 DUF4965 Domain of unknown function (DUF4965) 1.3E-75 338 515
PF08760 DUF1793 Domain of unknown function (DUF1793) 1.1E-68 521 687
PF16334 DUF4964 Domain of unknown function (DUF4964) 6.2E-09 21 85

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2U4L7|GTAA_ASPOR Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gtaA PE=1 SV=2 1 687 0.0E+00
sp|D4AMT2|GTAA_ARTBC Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05535/05536 PE=1 SV=2 22 694 2.0E-121

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071300
MHWLLYLLSCVGTIHAAVTWNAEPFNPPSFPLAVRTPYLSAWLPQGSGAALNDVWPTFWTGQTLGWAGFVKVDNN
AYSFLGTPNVPNAAFSKAVQKSSKFTATQTTFVLSAGPVDLTITFLSPVEATDLLKQSTPFAYMAVSASSTDGAA
HRVQVYSDISAEWVSGNNGLAANWTTSTGSVITHQVQLVNQAVLSEVNDHTQYGSAFYSTLSTSGVTWQSGEDIS
VRAQFINNGRLPNTRDTNFRAIDDAWPVFAISHDLGNVRAATTPVVTSVGHIRDPALRYIVAGGGTQLRSSYFLS
RFSRPADLISEFLNDFPEALDRSNALDAKVNSDASRISSDYAAIVALSVRQAIAATEITISRNSNGSFNVNDIII
FMKEISSNGNINTVDVIFPTWPLLLYLNPQLGKFLLEGLFRYQATGQYPNKYSIHDLGASYPNALGHNDGRDERM
PVEESGNMIIMSLSYVQRTNDQSQIRQYSALLDQWAQFLIEDSLIPENQISTDDFAGPLANQTNLAIKGIVGIKA
MSEIASLLGDQAKSNNYSAIAADYVTQWRGLARSTRGPHLTLSYNDADSWGLTYNLFGDKLLGLNLFPQDVYTTQ
TAWYKTVARPFGVPLDTRHTYTKTDWEIWTASIATDTSVRDLLISSVRKYASSGLASQPFGDWYETTNGAPQGFR
ARPVVGGHLALVSQVSSVCLLSYSST*
Coding >AgabiH97|071300
ATGCACTGGCTGTTGTACTTGTTGTCATGCGTTGGCACTATTCATGCTGCAGTGACCTGGAATGCAGAGCCATTC
AACCCGCCTTCCTTTCCTCTGGCAGTTAGAACACCTTACTTGTCTGCGTGGCTTCCACAGGGATCCGGCGCCGCT
TTGAATGATGTTTGGCCAACATTTTGGACTGGACAGACTCTTGGTTGGGCCGGCTTCGTCAAAGTGGATAATAAT
GCTTATAGCTTCCTCGGTACCCCCAACGTTCCCAATGCCGCCTTCTCTAAGGCCGTCCAGAAGAGCTCCAAGTTC
ACTGCCACCCAAACCACCTTTGTTCTCTCCGCTGGCCCCGTGGATCTCACCATCACTTTTTTAAGTCCTGTCGAG
GCGACGGACCTTTTGAAACAATCAACTCCATTTGCGTATATGGCTGTTTCCGCCTCTTCAACAGATGGCGCTGCT
CACCGCGTTCAGGTATACTCAGATATCAGCGCTGAATGGGTATCTGGGAACAATGGTCTTGCAGCTAATTGGACG
ACATCAACTGGATCCGTGATTACCCATCAAGTGCAGCTCGTCAATCAGGCTGTGCTTTCCGAGGTCAACGATCAC
ACGCAATACGGATCCGCCTTTTACTCGACTCTCTCGACCTCTGGGGTTACTTGGCAAAGTGGGGAGGACATTTCG
GTCCGCGCCCAATTCATTAACAATGGGAGACTTCCAAACACGCGAGATACTAACTTCCGTGCGATTGATGATGCT
TGGCCTGTTTTCGCGATATCCCATGACCTCGGGAATGTGAGGGCAGCCACCACACCTGTCGTCACCTCTGTTGGC
CATATTAGAGATCCAGCATTGAGATATATCGTTGCTGGAGGTGGGACTCAGCTTCGGAGCTCGTATTTCCTCAGC
CGGTTTTCTAGGCCGGCAGATCTGATTTCAGAATTCTTGAATGACTTCCCTGAGGCACTTGATCGGTCCAATGCC
CTCGACGCCAAAGTAAACAGTGACGCATCTAGGATCTCATCAGATTATGCCGCCATTGTTGCTCTATCGGTCAGA
CAGGCTATAGCCGCCACTGAGATTACCATTTCTCGGAACAGCAACGGGTCATTTAACGTAAACGATATCATTATA
TTCATGAAAGAGATTTCAAGTAATGGAAACATCAACACTGTCGATGTGATCTTTCCTACTTGGCCACTTCTATTA
TATCTGAACCCTCAACTCGGGAAATTCCTACTCGAAGGTCTTTTCAGGTATCAGGCCACTGGTCAATACCCCAAT
AAATACAGTATCCATGACCTTGGTGCGAGTTACCCTAATGCCCTCGGGCATAATGATGGTCGGGACGAACGAATG
CCTGTTGAAGAAAGCGGGAACATGATCATTATGTCCCTTAGCTATGTTCAAAGGACCAATGACCAGTCGCAGATC
CGGCAATATTCTGCCCTTCTCGATCAGTGGGCTCAATTCTTGATTGAAGACTCCCTCATTCCGGAAAATCAGATC
AGCACCGATGATTTCGCTGGACCATTGGCGAATCAGACCAACCTAGCTATCAAGGGAATAGTCGGTATTAAAGCA
ATGTCAGAGATAGCATCACTGCTAGGTGACCAGGCCAAGAGCAATAACTATTCTGCCATCGCTGCTGATTACGTC
ACTCAATGGCGCGGTCTCGCAAGGTCGACTAGAGGTCCACATTTGACGCTCTCGTATAATGATGCGGACAGCTGG
GGCTTGACATATAACCTATTTGGTGATAAACTCCTGGGGCTCAACTTATTCCCTCAAGACGTCTATACAACACAA
ACGGCATGGTACAAAACTGTAGCCCGACCATTCGGCGTCCCCCTTGATACACGTCATACGTACACCAAAACAGAC
TGGGAAATCTGGACCGCAAGCATTGCCACGGATACTTCTGTACGTGATTTGTTGATCTCTTCCGTCAGAAAATAC
GCATCAAGTGGGCTGGCGTCACAACCATTTGGAGACTGGTACGAGACAACAAATGGTGCTCCACAGGGATTCCGT
GCCCGCCCGGTAGTCGGAGGTCATCTCGCTCTTGTGAGTCAAGTTTCAAGTGTTTGTCTGCTATCATACTCATCG
ACGTAA
Transcript >AgabiH97|071300
ATGCACTGGCTGTTGTACTTGTTGTCATGCGTTGGCACTATTCATGCTGCAGTGACCTGGAATGCAGAGCCATTC
AACCCGCCTTCCTTTCCTCTGGCAGTTAGAACACCTTACTTGTCTGCGTGGCTTCCACAGGGATCCGGCGCCGCT
TTGAATGATGTTTGGCCAACATTTTGGACTGGACAGACTCTTGGTTGGGCCGGCTTCGTCAAAGTGGATAATAAT
GCTTATAGCTTCCTCGGTACCCCCAACGTTCCCAATGCCGCCTTCTCTAAGGCCGTCCAGAAGAGCTCCAAGTTC
ACTGCCACCCAAACCACCTTTGTTCTCTCCGCTGGCCCCGTGGATCTCACCATCACTTTTTTAAGTCCTGTCGAG
GCGACGGACCTTTTGAAACAATCAACTCCATTTGCGTATATGGCTGTTTCCGCCTCTTCAACAGATGGCGCTGCT
CACCGCGTTCAGGTATACTCAGATATCAGCGCTGAATGGGTATCTGGGAACAATGGTCTTGCAGCTAATTGGACG
ACATCAACTGGATCCGTGATTACCCATCAAGTGCAGCTCGTCAATCAGGCTGTGCTTTCCGAGGTCAACGATCAC
ACGCAATACGGATCCGCCTTTTACTCGACTCTCTCGACCTCTGGGGTTACTTGGCAAAGTGGGGAGGACATTTCG
GTCCGCGCCCAATTCATTAACAATGGGAGACTTCCAAACACGCGAGATACTAACTTCCGTGCGATTGATGATGCT
TGGCCTGTTTTCGCGATATCCCATGACCTCGGGAATGTGAGGGCAGCCACCACACCTGTCGTCACCTCTGTTGGC
CATATTAGAGATCCAGCATTGAGATATATCGTTGCTGGAGGTGGGACTCAGCTTCGGAGCTCGTATTTCCTCAGC
CGGTTTTCTAGGCCGGCAGATCTGATTTCAGAATTCTTGAATGACTTCCCTGAGGCACTTGATCGGTCCAATGCC
CTCGACGCCAAAGTAAACAGTGACGCATCTAGGATCTCATCAGATTATGCCGCCATTGTTGCTCTATCGGTCAGA
CAGGCTATAGCCGCCACTGAGATTACCATTTCTCGGAACAGCAACGGGTCATTTAACGTAAACGATATCATTATA
TTCATGAAAGAGATTTCAAGTAATGGAAACATCAACACTGTCGATGTGATCTTTCCTACTTGGCCACTTCTATTA
TATCTGAACCCTCAACTCGGGAAATTCCTACTCGAAGGTCTTTTCAGGTATCAGGCCACTGGTCAATACCCCAAT
AAATACAGTATCCATGACCTTGGTGCGAGTTACCCTAATGCCCTCGGGCATAATGATGGTCGGGACGAACGAATG
CCTGTTGAAGAAAGCGGGAACATGATCATTATGTCCCTTAGCTATGTTCAAAGGACCAATGACCAGTCGCAGATC
CGGCAATATTCTGCCCTTCTCGATCAGTGGGCTCAATTCTTGATTGAAGACTCCCTCATTCCGGAAAATCAGATC
AGCACCGATGATTTCGCTGGACCATTGGCGAATCAGACCAACCTAGCTATCAAGGGAATAGTCGGTATTAAAGCA
ATGTCAGAGATAGCATCACTGCTAGGTGACCAGGCCAAGAGCAATAACTATTCTGCCATCGCTGCTGATTACGTC
ACTCAATGGCGCGGTCTCGCAAGGTCGACTAGAGGTCCACATTTGACGCTCTCGTATAATGATGCGGACAGCTGG
GGCTTGACATATAACCTATTTGGTGATAAACTCCTGGGGCTCAACTTATTCCCTCAAGACGTCTATACAACACAA
ACGGCATGGTACAAAACTGTAGCCCGACCATTCGGCGTCCCCCTTGATACACGTCATACGTACACCAAAACAGAC
TGGGAAATCTGGACCGCAAGCATTGCCACGGATACTTCTGTACGTGATTTGTTGATCTCTTCCGTCAGAAAATAC
GCATCAAGTGGGCTGGCGTCACAACCATTTGGAGACTGGTACGAGACAACAAATGGTGCTCCACAGGGATTCCGT
GCCCGCCCGGTAGTCGGAGGTCATCTCGCTCTTGTGAGTCAAGTTTCAAGTGTTTGTCTGCTATCATACTCATCG
ACGTAA
Gene >AgabiH97|071300
ATGCACTGGCTGTTGTACTTGTTGTCATGCGTTGGCACTATTCATGCTGCAGTGACCTGGAATGCAGAGCCATTC
AACCCGCCTTCCTTTCCTCTGGCAGTTAGAACACCTTACTTGTCTGCGTGGCTTCCACAGGGATCCGGTACGTGA
ATGCCTAATATTCTCAAACGTATACTTACTGTCGAATCTAGGCGCCGCTTTGAATGATGTTTGGCCAACATTTTG
GACTGGACAGGTGGGTGAAGCAGTCTGTCTACGAGGGACATACTTTGCTATAGGTTATTAGACTCTTGGTTGGGC
CGGCTTCGTCAAAGTGGATAATAATGCTTATAGCTTCCTCGGTACCCCCAACGTTCCCAATGCCGCCTTCTCTAA
GGCCGTCCAGAAGAGCTCCAAGGTGATCAGTATATTTTCAGGCAACATTTTTCTCTCGTTACTCACCACTTCCAC
AGTTCACTGCCACCCAAACCACCTTTGTTCTCTCCGCTGGCCCCGTGGATCTCACCATCACTTTTTTAAGTCCTG
TCGAGGTGAATAATTTGATTTTCTCTTGTATCAAACATGTCTAATCGTCTTGTAGGCGACGGACCTTTTGAAACA
ATCAACTCCATTTGCGTATATGGCTGTTTCCGCCTCTTCAACAGATGGCGCTGCTCACCGCGTTCAGGTATACTC
AGATATCAGCGCTGAATGGGTATCTGGGAACAATGGTCTTGCAGCTAATTGGACGACATCAACTGGATCCGTGAT
TACCCATCAAGTGCAGCTCGTCAATCAGGCTGTGCTTTCCGAGGTCAACGATCACACGCAATGTATGATTCTTTC
GCCTAGGCGTCCTTCAAGTAATACTAATACTCGTAGACGGATCCGCCTTTTACTCGACTCTCTCGGTAGGTGTAT
CGAATCTACAGATTGACGTATGCTGATTCCCTCCTGTCCAAAGACCTCTGGGGTTACTTGGCAAAGTGGGGAGGA
CATTTCGGTCCGCGCCCAATTCATTAACAATGGGAGACTTCCAAACACGCGAGATACTAACTTCCGTGCGATTGA
TGATGCTTGGCCTGTTTTCGCGATATCCCATGACCTCGGGAATGTGAGGGCAGCCACCACACCTGTCGTCACCTC
TGTTGGCCATATTAGAGATCCAGCATTGAGATATATCGTTGCTGGAGGTGGGACTCAGCTTCGGAGCTCGTATTT
CCTCAGCCGGTTTTCTAGGCCGGCAGATCTGGTAAGTACTACCTGTACAATGTAGATCTGCCCTTCATACCCGGG
TTGGCAGATTTCAGAATTCTTGAATGACTTCCCTGAGGCACTTGATCGGTCCAATGCCCTCGACGCCAAAGTAAA
CAGTGACGCATCTAGGATCTCATCAGATTATGCCGCCATTGTTGCTCTATCGGTCAGACAGGCTATAGCCGCCAC
TGAGATTACCATTTCTCGGAACAGCAACGGGTCATTTAACGTAAACGATATCATTATATTCATGAAAGGTCAGTA
TCAATGCTTAAAATGCCTTTATCCAGTTTTGTTGATCCCAAATATTTAGAGATTTCAAGTAATGGAGTGCGAATC
AAAGTTCCTATCAAGTTGACAGGCTACAGCTAACCCCACTTTACTACGCTTAGAACATCAACACTGTCGATGTGA
TCTTTCCTACTTGGCCACTTCTATTATATCTGAACCCTCAACTCGGGAAATTCCTACTCGAAGGTCTTTTCAGGT
ATCAGGCCACTGGTCAATACCCCAATAAATACAGTATCCATGACCTTGGTTGGCTTTTCCTCTTCCCCTCTTTTC
CACAGACTGACATTACACAGGTGCGAGTTACCCTAATGCCCTCGGGCATAATGATGGTCGGGACGAACGAATGCC
TGTTGAAGGTCCGTCCTCCCAGCGCTCCGAATATACTGATCTCATTTCCGAGTAGAAAGCGGGAACATGATCATT
ATGTCCCTTAGCTATGTTCAAAGGACCAATGACCAGTCGCAGATCCGGCAATATGTAGGTGACCTCAAAATTTTC
GCTCTTCTCACTTGTGATTCACAATCTCTCTAGTCTGCCCTTCTCGATCAGTGGGCTCAATTCTTGATTGAAGAC
TCCCTCATTCCGGAAAATCAGATCAGCACCGATGATTTCGCTGGACCATTGGCGAATCAGACCAACCTAGCTATC
AAGGGAATAGTCGGTATTAAAGCAATGTCAGAGATAGCATCACTGCTAGGTGACCAGGCCAAGAGCAATAACTAT
TCTGTACGTATACCGAAAGGTTACTTTGCTAAACCGGGGTTTTGACCAACGGTTCCGGTCACAGGCCATCGCTGC
TGATTACGTCACTCAATGGCGCGGTCTCGCAAGGTCGACTAGAGGTCCACATTTGACGCTCTCGGTATGAAGTCC
TATCCTTATTTATCCCAAAATTGACGTTTGTCCAGTATAATGATGCGGACAGGTATGTTGAATTTATCTGGCTGC
CAAAGCCACTTCTGATAGTCTCATTTCAGCTGGGGCTTGACATATAACCTATTTGGTGATAAACTCCTGGGGCTC
AACTTATTCCCTCAAGACGTCTATACAACACGTGAGTCGAGCCCTCATACTTTACTATCCGCGATTGACGTCTTT
TTAGAAACGGCATGGTACAAAACTGTAGCCCGTACGTAAGCGCATCTACTCTTGTAAGACATAAACTAACTTGAG
TTAGGACCATTCGGCGTCCCCCTTGATACACGGTAAGTTTATTCAACATTCGTCTTGTGATACAATGTCCTGAGC
GGCATAAATTTGTAGTCATACGTACACCAAAACAGGTACGCCGGTCTCTGCATAGGCCAACCTAAGTCATTACCA
TTGCATTGTCTGACTAATTCTTCGTTGTCCTCATCGTTGTGTGTCGAACGAATACCATGTACTGACTAGACTGGG
AAATCTGGACCGCAAGCATTGCCACGGATACTTCTGTACGTGATTTGTTGATCTCTTCCGTCAGAAAATACGCAT
CAAGTGGGCTGGCGTCACAACCATTTGGAGACTGGTACGAGACAACAAATGGTGCTCCACAGGGATTCCGTGCCC
GCCCGGTAGTCGGAGGTCATCTCGGTAAGTGGAGATGTAATGTAATCATGTCCTCGATGACTGACCGTCTGTTCT
GATGCTTTAGCTCTTGTGAGTCAAGTTTCAAGTGTTTGTCTGCTATCATACTCATCGACGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail