Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071260
Gene name
Locationscaffold_4:1463116..1465804
Strand+
Gene length (bp)2688
Transcript length (bp)2298
Coding sequence length (bp)2298
Protein length (aa) 766

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01717 Meth_synt_2 Cobalamin-independent synthase, Catalytic domain 3.5E-145 436 758
PF08267 Meth_synt_1 Cobalamin-independent synthase, N-terminal domain 1.3E-108 4 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT19|METE_SCHPO Probable 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met26 PE=1 SV=1 1 765 0.0E+00
sp|P82610|METE_CANAL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MET6 PE=1 SV=2 1 764 0.0E+00
sp|Q87BY8|METE_XYLFT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|B2I621|METE_XYLF2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain M23) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q9PB72|METE_XYLFA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=metE PE=3 SV=1 1 761 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT19|METE_SCHPO Probable 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met26 PE=1 SV=1 1 765 0.0E+00
sp|P82610|METE_CANAL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MET6 PE=1 SV=2 1 764 0.0E+00
sp|Q87BY8|METE_XYLFT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|B2I621|METE_XYLF2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain M23) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q9PB72|METE_XYLFA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|B0U3F5|METE_XYLFM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain M12) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|P05694|METE_YEAST 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET6 PE=1 SV=4 1 764 0.0E+00
sp|Q11PV4|METE_CYTH3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A5FJR8|METE_FLAJ1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=metE PE=3 SV=1 7 762 0.0E+00
sp|Q9AAW1|METE_CAUCR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metE PE=3 SV=1 2 763 0.0E+00
sp|Q9AMV8|METE_BRADU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=metE PE=3 SV=2 5 761 0.0E+00
sp|Q11EU7|METE_CHESB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chelativorans sp. (strain BNC1) GN=metE PE=3 SV=1 5 761 0.0E+00
sp|Q2KYF3|METE_BORA1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella avium (strain 197N) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|Q98A73|METE_RHILO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhizobium loti (strain MAFF303099) GN=metE PE=3 SV=1 5 763 0.0E+00
sp|Q6N765|METE_RHOPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|A7HQP6|METE_PARL1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|B3QGC4|METE_RHOPT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|Q7W791|METE_BORPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metE PE=3 SV=2 1 758 0.0E+00
sp|Q7WKM7|METE_BORBR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q7VVU3|METE_BORPE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q3SGL1|METE_THIDA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=metE PE=3 SV=1 1 764 0.0E+00
sp|A4XSY1|METE_PSEMY 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas mendocina (strain ymp) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q7MZ74|METE_PHOLL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metE PE=3 SV=1 3 763 0.0E+00
sp|Q2S338|METE_SALRD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|Q54X49|METE_DICDI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Dictyostelium discoideum GN=metE PE=1 SV=1 1 765 0.0E+00
sp|Q2SMS4|METE_HAHCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|A1TYT7|METE_MARHV 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|P45331|METE_HAEIN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q8Z3B6|METE_SALTI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella typhi GN=metE PE=3 SV=3 2 762 0.0E+00
sp|A4TR46|METE_YERPP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pestis (strain Pestoides F) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q1CNC1|METE_YERPN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q8ZAL3|METE_YERPE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pestis GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q1CBG7|METE_YERPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q9JZQ2|METE_NEIMB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metE PE=1 SV=1 8 754 0.0E+00
sp|Q9L6N1|METE_SALTY 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metE PE=3 SV=3 2 762 0.0E+00
sp|B4TBQ7|METE_SALHS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella heidelberg (strain SL476) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q1R4A4|METE_ECOUT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B1LM00|METE_ECOSM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B7NV51|METE_ECO7I 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B7MH94|METE_ECO45 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B5FNW1|METE_SALDC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella dublin (strain CT_02021853) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A1KTL3|METE_NEIMF 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=metE PE=3 SV=1 8 754 0.0E+00
sp|Q9JUT6|METE_NEIMA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=metE PE=3 SV=1 8 754 0.0E+00
sp|Q5F863|METE_NEIG1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=metE PE=3 SV=1 8 754 0.0E+00
sp|Q0TAP6|METE_ECOL5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q66FT7|METE_YERPS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q32A07|METE_SHIDS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B5QW68|METE_SALEP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A1AHZ7|METE_ECOK1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O1:K1 / APEC GN=metE PE=3 SV=1 2 758 0.0E+00
sp|A7FDD3|METE_YERP3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q31UF9|METE_SHIBS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B4TNX3|METE_SALSV 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A9MY90|METE_SALPB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B2TVH5|METE_SHIB3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B5EZU1|METE_SALA4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella agona (strain SL483) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B5XYJ1|METE_KLEP3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q57HP2|METE_SALCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B7LU25|METE_ESCF3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B7M634|METE_ECO8A 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O8 (strain IAI1) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q3YVD7|METE_SHISS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella sonnei (strain Ss046) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B6I4H1|METE_ECOSE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain SE11) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B7NFD2|METE_ECOLU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B1IW76|METE_ECOLC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|A8A6T6|METE_ECOHS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B5RFN3|METE_SALG2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A4VNE5|METE_PSEU5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=metE PE=3 SV=1 1 754 0.0E+00
sp|Q8FBM1|METE_ECOL6 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metE PE=3 SV=3 2 758 0.0E+00
sp|A7ZU36|METE_ECO24 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|A4WFZ2|METE_ENT38 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Enterobacter sp. (strain 638) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A6TGK9|METE_KLEP7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=metE PE=3 SV=1 2 763 0.0E+00
sp|P25665|METE_ECOLI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain K12) GN=metE PE=1 SV=6 2 758 0.0E+00
sp|B1XAJ3|METE_ECODH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q83IW0|METE_SHIFL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella flexneri GN=metE PE=3 SV=1 2 758 0.0E+00
sp|A9MIY8|METE_SALAR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q0SZ21|METE_SHIF8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|B4SZ67|METE_SALNS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella newport (strain SL254) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q3SNK1|METE_NITWN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=metE PE=3 SV=1 5 761 0.0E+00
sp|A9M4E3|METE_NEIM0 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=metE PE=3 SV=1 8 754 0.0E+00
sp|Q1QZS5|METE_CHRSD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A0B2Z3|METE_BURCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q1BQX8|METE_BURCA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q8X8L5|METE_ECO57 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O157:H7 GN=metE PE=3 SV=3 2 758 0.0E+00
sp|B5YY78|METE_ECO5E 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|Q4KE22|METE_PSEF5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B1K5S8|METE_BURCC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|B5BIX4|METE_SALPK 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q5PKP9|METE_SALPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A9IKD8|METE_BORPD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q39AN3|METE_BURL3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q02L76|METE_PSEAB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B4EWC2|METE_PROMH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Proteus mirabilis (strain HI4320) GN=metE PE=3 SV=1 2 763 0.0E+00
sp|A8ACX7|METE_CITK8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B0UU16|METE_HISS2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Histophilus somni (strain 2336) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B7VAU6|METE_PSEA8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|P57703|METE_PSEAE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A1JIE5|METE_YERE8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|B5ELU7|METE_ACIF5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metE PE=3 SV=1 7 765 0.0E+00
sp|B7J432|METE_ACIF2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=metE PE=3 SV=1 7 765 0.0E+00
sp|B2JNZ4|METE_BURP8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|B1Z0R8|METE_BURA4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A3N1F9|METE_ACTP2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|O50008|METE1_ARATH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1 OS=Arabidopsis thaliana GN=MS1 PE=1 SV=1 4 765 0.0E+00
sp|B4EJ37|METE_BURCJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|A5UBH4|METE_HAEIE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus influenzae (strain PittEE) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q82UP6|METE_NITEU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q9F187|METE_CUPNE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Cupriavidus necator GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q0B6M7|METE_BURCM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|B1J2V4|METE_PSEPW 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas putida (strain W619) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|A5UFD9|METE_HAEIG 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus influenzae (strain PittGG) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q0K0V6|METE_CUPNH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|Q0I3P2|METE_HAES1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus somnus (strain 129Pt) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B0BQ96|METE_ACTPJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B3GY43|METE_ACTP7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q1I4X3|METE_PSEE4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas entomophila (strain L48) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|P93263|METE_MESCR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mesembryanthemum crystallinum GN=METE PE=2 SV=1 4 765 0.0E+00
sp|Q9SRV5|METE2_ARATH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 OS=Arabidopsis thaliana GN=MS2 PE=1 SV=1 4 761 0.0E+00
sp|A4JJS1|METE_BURVG 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|A6V1K5|METE_PSEA7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=metE PE=3 SV=1 1 747 0.0E+00
sp|P57843|METE_PASMU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pasteurella multocida (strain Pm70) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|A8G8B2|METE_SERP5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Serratia proteamaculans (strain 568) GN=metE PE=3 SV=1 2 765 0.0E+00
sp|A7MQM1|METE_CROS8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q6DAS2|METE_PECAS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q42699|METE_CATRO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Catharanthus roseus GN=METE PE=2 SV=1 4 765 0.0E+00
sp|Q0VR89|METE_ALCBS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=metE PE=3 SV=1 7 762 0.0E+00
sp|Q83A62|METE_COXBU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A9KDA0|METE_COXBN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B2VI65|METE_ERWT9 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A1AXN4|METE_RUTMC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=metE PE=3 SV=1 1 763 0.0E+00
sp|B6J6H8|METE_COXB1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q13MI3|METE_BURXL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia xenovorans (strain LB400) GN=metE PE=3 SV=1 1 754 0.0E+00
sp|B5FFR4|METE_VIBFM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio fischeri (strain MJ11) GN=metE PE=3 SV=1 2 764 0.0E+00
sp|Q2NWV8|METE_SODGM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Sodalis glossinidius (strain morsitans) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q5E430|METE_VIBF1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=metE PE=3 SV=1 2 764 0.0E+00
sp|Q3A7E2|METE_PELCD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=metE PE=3 SV=1 2 758 0.0E+00
sp|A9N9C7|METE_COXBR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B6J3R8|METE_COXB2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q21N29|METE_SACD2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=metE PE=3 SV=1 7 765 0.0E+00
sp|Q87XJ9|METE_PSESM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q0WNZ5|METE3_ARATH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 3, chloroplastic OS=Arabidopsis thaliana GN=MS3 PE=1 SV=1 4 761 0.0E+00
sp|Q2QLY4|METE2_ORYSJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os12g0624000 PE=2 SV=1 4 765 0.0E+00
sp|Q93J59|METE_STRCO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=metE PE=3 SV=1 5 761 0.0E+00
sp|Q3JAD5|METE_NITOC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=metE PE=3 SV=1 1 761 0.0E+00
sp|Q8KA71|METE_BUCAP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q2QLY5|METE1_ORYSJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os12g0623900 PE=2 SV=1 4 765 0.0E+00
sp|Q725Q3|METE_DESVH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=metE PE=3 SV=1 7 761 0.0E+00
sp|B1VV57|METE_STRGG 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=metE PE=3 SV=1 5 761 0.0E+00
sp|Q89B24|METE_BUCBP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|Q1LU68|METE_BAUCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q8XS05|METE_RALSO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|B2TBS1|METE_BURPP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=metE PE=3 SV=1 1 754 0.0E+00
sp|Q7NS23|METE_CHRVO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|Q8CWK1|METE_VIBVU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|Q491V4|METE_BLOPB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=metE PE=3 SV=1 2 764 0.0E+00
sp|Q42662|METE_PLESU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Plectranthus scutellarioides GN=MET PE=1 SV=2 4 765 0.0E+00
sp|A4SNB5|METE_AERS4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Aeromonas salmonicida (strain A449) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q7MJM6|METE_VIBVY 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|Q0A6U0|METE_ALKEH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q6LSD6|METE_PHOPR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Photobacterium profundum GN=metE PE=3 SV=1 3 764 0.0E+00
sp|Q058E7|METE_BUCCC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=metE PE=3 SV=1 4 764 0.0E+00
sp|P57142|METE_BUCAI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q0S6X7|METE_RHOJR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodococcus jostii (strain RHA1) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|B2UJ81|METE_RALPJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ralstonia pickettii (strain 12J) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|Q73WJ9|METE_MYCPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|Q82LG4|METE_STRAW 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=metE PE=3 SV=1 5 765 0.0E+00
sp|Q9KRD8|METE_VIBCH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metE PE=3 SV=1 1 764 0.0E+00
sp|A0QC69|METE_MYCA1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium avium (strain 104) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|Q8EIM0|METE_SHEON 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|Q605M0|METE_METCA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|A2RKK4|METE_LACLM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|A1T007|METE_PSYIN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Psychromonas ingrahamii (strain 37) GN=metE PE=3 SV=1 7 761 0.0E+00
sp|Q02YT3|METE_LACLS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|Q9CG55|METE_LACLA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metE PE=3 SV=1 5 762 0.0E+00
sp|Q87NA1|METE_VIBPA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|A7MRX1|METE_VIBCB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=metE PE=3 SV=1 4 765 0.0E+00
sp|Q8KRG6|METE_VIBHA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio harveyi GN=metE PE=3 SV=1 4 758 0.0E+00
sp|A1A1F4|METE_BIFAA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=metE PE=3 SV=1 3 752 0.0E+00
sp|P9WK07|METE_MYCTU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metE PE=1 SV=1 4 761 0.0E+00
sp|P9WK06|METE_MYCTO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|A5U1I0|METE_MYCTA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|A1KHS4|METE_MYCBP 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|P65341|METE_MYCBO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|B8DUK6|METE_BIFA0 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|O05564|METE_MYCLE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mycobacterium leprae (strain TN) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|Q7VRI8|METE_BLOFL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Blochmannia floridanus GN=metE PE=3 SV=1 2 763 0.0E+00
sp|B7GRV8|METE_BIFLS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=metE PE=3 SV=1 3 752 0.0E+00
sp|A4J5C3|METE_DESRM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=metE PE=3 SV=1 6 761 0.0E+00
sp|A5G0M4|METE_ACICJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=metE PE=3 SV=1 1 758 0.0E+00
sp|A3CL11|METE_STRSV 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus sanguinis (strain SK36) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|Q8G651|METE_BIFLO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=metE PE=3 SV=1 3 752 0.0E+00
sp|B3DS65|METE_BIFLD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=metE PE=3 SV=1 3 752 0.0E+00
sp|A1V6R3|METE_BURMS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia mallei (strain SAVP1) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q62LZ2|METE_BURMA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A2S4V8|METE_BURM9 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A3MHJ9|METE_BURM7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q3JPU6|METE_BURP1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A3NY08|METE_BURP0 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A3NC70|METE_BURP6 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia pseudomallei (strain 668) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q63RX6|METE_BURPS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|A4VXA1|METE_STRSY 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|A8AV19|METE_STRGC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|B8DMM2|METE_DESVM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|Q2SY55|METE_BURTA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|B5E298|METE_STRP4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|B5YJD3|METE_THEYD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q97S31|METE_STRPN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|B1IAA7|METE_STRPI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q8DQT2|METE_STRR6 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=metE PE=3 SV=2 4 762 0.0E+00
sp|Q04LT6|METE_STRP2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q03L46|METE_STRTD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|A8FCD2|METE_BACP2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=metE PE=3 SV=1 1 765 0.0E+00
sp|A9VFA6|METE_BACWK 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|P80877|METE_BACSU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus subtilis (strain 168) GN=metE PE=1 SV=4 2 761 0.0E+00
sp|Q5HTR3|METE_CAMJR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni (strain RM1221) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q8Y6K3|METE_LISMO 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|C1EQ20|METE_BACC3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain 03BB102) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|A0RI12|METE_BACAH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|A7H2H6|METE_CAMJD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|A1W0I5|METE_CAMJJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q819H7|METE_BACCR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|B7IVP2|METE_BACC2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain G9842) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|C3LI71|METE_BACAC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|A8FMQ7|METE_CAMJ8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|Q6KNA9|METE_BACAN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus anthracis GN=metE PE=3 SV=1 2 761 0.0E+00
sp|C3P710|METE_BACAA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus anthracis (strain A0248) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|B9IWL4|METE_BACCQ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain Q1) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|B7HMX7|METE_BACC7 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain AH187) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q9PN94|METE_CAMJE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|B7H8Z2|METE_BACC4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain B4264) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q731W2|METE_BACC1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q8NRB3|METE_CORGL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|A4QDA4|METE_CORGB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Corynebacterium glutamicum (strain R) GN=metE PE=3 SV=1 4 762 0.0E+00
sp|B7JKY0|METE_BACC0 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain AH820) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q71YY6|METE_LISMF 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|C1KVY0|METE_LISMC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|A7Z3U1|METE_BACMF 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=metE PE=3 SV=1 2 765 0.0E+00
sp|A7GS30|METE_BACCN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=metE PE=3 SV=1 4 761 0.0E+00
sp|Q6HEG3|METE_BACHK 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q8FQB2|METE_COREF 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metE PE=3 SV=1 4 763 0.0E+00
sp|Q635S6|METE_BACCZ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q92AX9|METE_LISIN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|A0AJD5|METE_LISW6 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=metE PE=3 SV=1 3 764 0.0E+00
sp|Q117R7|METE_TRIEI 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q65KT8|METE_BACLD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metE PE=3 SV=1 2 765 0.0E+00
sp|Q2JKE8|METE_SYNJB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=metE PE=3 SV=1 4 757 0.0E+00
sp|P65343|METE_STAAN 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain N315) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|P65342|METE_STAAM 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A5IPT7|METE_STAA9 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain JH9) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A6TYK8|METE_STAA2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain JH1) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A7WY46|METE_STAA1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q5HS05|METE_STAEQ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q8NY94|METE_STAAW 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain MW2) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q6GCB6|METE_STAAS 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q6GJW2|METE_STAAR 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q8CMP5|METE_STAES 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A8YZI1|METE_STAAT 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|A6QE38|METE_STAAE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain Newman) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q5HIT8|METE_STAAC 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain COL) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q2G122|METE_STAA8 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q2FJQ7|METE_STAA3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain USA300) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q2YVH7|METE_STAAB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q4L330|METE_STAHJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metE PE=3 SV=1 2 761 0.0E+00
sp|Q9KFP1|METE_BACHD 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metE PE=3 SV=1 2 754 0.0E+00
sp|O67606|METE_AQUAE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Aquifex aeolicus (strain VF5) GN=metE PE=3 SV=1 1 762 0.0E+00
sp|Q8CWX6|METE_STRMU 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=metE PE=1 SV=1 1 762 0.0E+00
sp|Q88X63|METE_LACPL 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metE PE=3 SV=1 2 756 0.0E+00
sp|A5IMS4|METE_THEP1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=metE PE=3 SV=1 7 764 0.0E+00
sp|P65345|METE_STRA5 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|P65344|METE_STRA3 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|Q8DJY0|METE_THEEB 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=metE PE=3 SV=1 2 762 0.0E+00
sp|Q3JYS3|METE_STRA1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=metE PE=3 SV=1 1 763 0.0E+00
sp|B1LC63|METE_THESQ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermotoga sp. (strain RQ2) GN=metE PE=3 SV=1 7 764 0.0E+00
sp|Q9X112|METE_THEMA 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=metE PE=1 SV=1 7 764 0.0E+00
sp|A9B0A2|METE_HERA2 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=metE PE=3 SV=1 4 761 3.0E-180
sp|Q39586|METE_CHLRE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chlamydomonas reinhardtii PE=2 SV=1 1 761 9.0E-169
sp|Q9YA91|METE_AERPE Methionine synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=metE PE=3 SV=1 435 764 3.0E-48
sp|C3MWZ5|METE_SULIM Methionine synthase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=metE PE=3 SV=1 433 762 3.0E-45
sp|C3MR07|METE_SULIL Methionine synthase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=metE PE=3 SV=1 433 762 3.0E-45
sp|C4KID3|METE_SULIK Methionine synthase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=metE PE=3 SV=1 433 762 3.0E-45
sp|C3MZ55|METE_SULIA Methionine synthase OS=Sulfolobus islandicus (strain M.16.27) GN=metE PE=3 SV=1 433 762 3.0E-45
sp|C3NGG0|METE_SULIN Methionine synthase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=metE PE=3 SV=1 433 762 3.0E-45
sp|C3N775|METE_SULIY Methionine synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=metE PE=3 SV=1 433 762 3.0E-45
sp|Q980A9|METE_SULSO Methionine synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=metE PE=3 SV=1 433 762 5.0E-45
sp|Q4JAI4|METE_SULAC Methionine synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=metE PE=3 SV=1 436 762 4.0E-43
sp|Q975N4|METE_SULTO Methionine synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=metE PE=3 SV=1 433 762 8.0E-43
sp|Q5JH51|METE_THEKO Methionine synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=metE PE=3 SV=1 431 765 7.0E-31
sp|Q8TH63|METE_PYRFU Methionine synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=metE PE=3 SV=1 431 762 4.0E-30
sp|O58816|METE_PYRHO Methionine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=metE PE=3 SV=1 431 762 4.0E-27
sp|Q9V085|METE_PYRAB Methionine synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=metE PE=3 SV=1 431 762 2.0E-26
sp|Q979L4|METE_THEVO Methionine synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=metE PE=3 SV=2 438 754 1.0E-24
sp|P57704|METE_THEAC Methionine synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=metE PE=3 SV=1 438 763 6.0E-24
sp|Q58868|METE_METJA Methionine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=metE PE=3 SV=2 438 761 8.0E-13
sp|O26869|METE_METTH Methionine synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=metE PE=3 SV=1 438 757 2.0E-12
sp|P55299|METE_METTM Methionine synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=metE PE=1 SV=3 438 757 7.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003871 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity Yes
GO:0009086 methionine biosynthetic process Yes
GO:0008652 cellular amino acid biosynthetic process Yes
GO:0043167 ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0043169 cation binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0046872 metal ion binding No
GO:0006520 cellular amino acid metabolic process No
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0008168 methyltransferase activity No
GO:0009058 biosynthetic process No
GO:0006790 sulfur compound metabolic process No
GO:0006555 methionine metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0042085 5-methyltetrahydropteroyltri-L-glutamate-dependent methyltransferase activity No
GO:0044272 sulfur compound biosynthetic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0044249 cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0006082 organic acid metabolic process No
GO:0008172 S-methyltransferase activity No
GO:0000097 sulfur amino acid biosynthetic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0009066 aspartate family amino acid metabolic process No
GO:0000096 sulfur amino acid metabolic process No
GO:0009067 aspartate family amino acid biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071260
MVLSSVLGFPRIGANREIKKAVEAYWAGKTSAEDLQKVAAEVRKTSWTSVKNHRVDFVPSGEFSLYDHVLDHSAA
FNVIPQRYVGLGLTPLDVYFAMGRGRQSEGVDVPASEMKKWFDSNYHYVVPELSEETDLKLIYNKALEEFKEAKE
AGITTRPVVLGPVSFLVLGKSAKSAQPGFRPISLLPKLIPVYKQLLSELKAAGAEWVQIDEPILALDSAAALEKE
YTASFTELAPVSPKIMLTTYFSRLDSNVRFIAKLPVAGLHIDLDRAPDQLTEVANAVKNTPIVLSLGLVSGRNIW
KTDFGAAIKLAQTAIDILGAGRVIVATSSSLLHTPVTLASENKLTAEQKDWFSFALEKAEEVAVIAAVLSGSQDA
SVTAALEANRVSINKRREFEKNSDDTVRKRVAAITPDQLNRKSPFPVRKETQAKHLNLPKFPTTTIGSFPQTKEI
RQARAKFNKGELTKEEYETFIKKEIEHVVRFQESIDLDILVHGEPERNDMVQYFGELLNGFVFTQNAWVQSYGSR
YVRPPIIVSDVSRPGPMTVKWSSYAQSLTKKPMKGMLTGPVTILNWSFPRADISREMQSKQLALALRDEVIDLEN
AGIHAIQVDEPAIREGLPLRRADWDGYLEWAVDSFKLATAGVTDQLQTHSHFCYSDFDDIFPSIQRLDADVISIE
ASKSDMKLLNTFKHYGYSNQIGPGVYDIHSPRVPGDQEIKDRLQAMLSILPDSLVFVNPDCGLKTRGWKETEASL
KNLVAGAKWARQNYA*
Coding >AgabiH97|071260
ATGGTTCTGTCAAGTGTTCTAGGATTTCCTCGTATCGGAGCTAACCGTGAAATAAAAAAGGCTGTCGAAGCATAC
TGGGCTGGTAAAACCTCTGCTGAAGACCTCCAAAAAGTGGCTGCGGAGGTGAGGAAGACCAGCTGGACTTCGGTC
AAAAATCATCGCGTCGACTTTGTTCCTAGCGGTGAATTCTCTCTCTATGATCATGTTCTTGATCACTCTGCCGCT
TTCAATGTCATTCCCCAGCGTTATGTTGGTCTCGGATTGACCCCTCTTGATGTTTACTTTGCTATGGGTCGTGGA
CGTCAATCCGAGGGTGTCGACGTCCCCGCTTCCGAGATGAAGAAATGGTTTGACTCAAACTACCATTATGTCGTT
CCCGAGTTGTCAGAGGAGACCGATTTAAAGCTCATCTATAACAAGGCTCTTGAGGAGTTCAAAGAAGCCAAGGAG
GCTGGTATCACCACTCGTCCTGTTGTTCTCGGCCCTGTCTCTTTCCTTGTTCTAGGAAAGAGTGCCAAATCCGCT
CAGCCTGGGTTCCGACCCATTTCCCTCCTGCCTAAACTCATTCCCGTCTACAAGCAACTTCTTTCGGAGCTGAAA
GCCGCGGGTGCTGAGTGGGTCCAGATTGATGAACCGATCTTGGCACTTGATAGCGCTGCCGCCCTCGAGAAGGAG
TATACTGCTTCATTCACTGAGCTTGCACCTGTTTCTCCTAAGATCATGCTCACCACTTACTTTTCCCGCCTCGAT
TCCAACGTGAGGTTCATCGCCAAGCTACCCGTCGCTGGTCTTCACATCGATCTCGATCGCGCCCCTGATCAACTC
ACTGAGGTCGCCAATGCAGTTAAGAACACTCCTATTGTACTTTCGTTGGGCCTCGTTTCCGGCCGCAACATATGG
AAAACCGATTTCGGCGCTGCTATCAAGCTCGCTCAAACTGCTATTGACATCCTTGGTGCTGGTCGTGTCATTGTT
GCCACCTCGTCTTCCCTCCTACACACTCCTGTTACTCTTGCCTCTGAGAATAAGCTGACTGCAGAGCAGAAGGAT
TGGTTCTCCTTCGCCCTCGAGAAAGCTGAAGAAGTCGCTGTTATCGCCGCCGTTCTTTCCGGCTCTCAAGATGCC
TCGGTCACAGCCGCTCTAGAGGCTAACAGAGTTTCTATCAACAAGCGTCGTGAGTTTGAGAAGAACTCCGATGAC
ACTGTTCGCAAGCGCGTTGCGGCCATCACCCCTGATCAACTGAATCGCAAGAGCCCCTTCCCGGTTCGAAAAGAA
ACCCAGGCCAAGCATCTTAATCTCCCCAAGTTCCCCACTACCACTATCGGTTCCTTCCCTCAAACAAAGGAAATT
CGTCAAGCCCGTGCCAAGTTTAACAAGGGTGAGCTCACCAAAGAGGAGTATGAAACGTTCATCAAAAAAGAAATC
GAGCATGTCGTGCGCTTCCAAGAGAGTATTGACCTGGATATTCTTGTCCACGGAGAGCCTGAACGAAACGACATG
GTTCAATACTTCGGTGAACTCCTTAACGGTTTCGTCTTCACTCAGAACGCCTGGGTGCAGAGCTACGGTTCTCGC
TATGTGCGCCCTCCCATTATCGTTTCAGATGTCAGTCGTCCCGGTCCCATGACCGTTAAGTGGAGTAGCTACGCC
CAGAGCCTCACCAAGAAACCCATGAAGGGCATGTTAACTGGTCCCGTCACCATTCTCAACTGGTCATTCCCTCGG
GCCGACATCTCACGTGAAATGCAGTCCAAGCAGCTCGCCCTCGCACTCCGCGACGAGGTTATCGATCTTGAGAAT
GCTGGAATTCATGCTATTCAGGTCGACGAGCCCGCTATCCGTGAAGGTCTTCCCCTCCGCCGGGCTGACTGGGAT
GGCTATCTTGAGTGGGCTGTAGACTCTTTCAAGCTTGCAACAGCTGGTGTCACTGATCAACTTCAGACTCACTCT
CACTTTTGCTACTCTGACTTTGACGATATTTTCCCGTCTATTCAACGCCTTGACGCTGATGTTATTTCGATCGAG
GCTTCCAAGAGTGACATGAAACTGCTCAATACCTTTAAGCACTATGGCTATTCCAACCAGATTGGTCCGGGTGTC
TATGATATCCATTCACCCCGTGTTCCCGGTGATCAGGAGATTAAAGACCGCCTTCAGGCCATGCTTAGCATTCTG
CCAGACTCTCTTGTCTTTGTTAACCCTGACTGCGGTCTCAAGACGCGCGGCTGGAAAGAGACGGAAGCTTCTCTG
AAGAACCTTGTTGCAGGCGCCAAGTGGGCTCGTCAAAACTACGCTTGA
Transcript >AgabiH97|071260
ATGGTTCTGTCAAGTGTTCTAGGATTTCCTCGTATCGGAGCTAACCGTGAAATAAAAAAGGCTGTCGAAGCATAC
TGGGCTGGTAAAACCTCTGCTGAAGACCTCCAAAAAGTGGCTGCGGAGGTGAGGAAGACCAGCTGGACTTCGGTC
AAAAATCATCGCGTCGACTTTGTTCCTAGCGGTGAATTCTCTCTCTATGATCATGTTCTTGATCACTCTGCCGCT
TTCAATGTCATTCCCCAGCGTTATGTTGGTCTCGGATTGACCCCTCTTGATGTTTACTTTGCTATGGGTCGTGGA
CGTCAATCCGAGGGTGTCGACGTCCCCGCTTCCGAGATGAAGAAATGGTTTGACTCAAACTACCATTATGTCGTT
CCCGAGTTGTCAGAGGAGACCGATTTAAAGCTCATCTATAACAAGGCTCTTGAGGAGTTCAAAGAAGCCAAGGAG
GCTGGTATCACCACTCGTCCTGTTGTTCTCGGCCCTGTCTCTTTCCTTGTTCTAGGAAAGAGTGCCAAATCCGCT
CAGCCTGGGTTCCGACCCATTTCCCTCCTGCCTAAACTCATTCCCGTCTACAAGCAACTTCTTTCGGAGCTGAAA
GCCGCGGGTGCTGAGTGGGTCCAGATTGATGAACCGATCTTGGCACTTGATAGCGCTGCCGCCCTCGAGAAGGAG
TATACTGCTTCATTCACTGAGCTTGCACCTGTTTCTCCTAAGATCATGCTCACCACTTACTTTTCCCGCCTCGAT
TCCAACGTGAGGTTCATCGCCAAGCTACCCGTCGCTGGTCTTCACATCGATCTCGATCGCGCCCCTGATCAACTC
ACTGAGGTCGCCAATGCAGTTAAGAACACTCCTATTGTACTTTCGTTGGGCCTCGTTTCCGGCCGCAACATATGG
AAAACCGATTTCGGCGCTGCTATCAAGCTCGCTCAAACTGCTATTGACATCCTTGGTGCTGGTCGTGTCATTGTT
GCCACCTCGTCTTCCCTCCTACACACTCCTGTTACTCTTGCCTCTGAGAATAAGCTGACTGCAGAGCAGAAGGAT
TGGTTCTCCTTCGCCCTCGAGAAAGCTGAAGAAGTCGCTGTTATCGCCGCCGTTCTTTCCGGCTCTCAAGATGCC
TCGGTCACAGCCGCTCTAGAGGCTAACAGAGTTTCTATCAACAAGCGTCGTGAGTTTGAGAAGAACTCCGATGAC
ACTGTTCGCAAGCGCGTTGCGGCCATCACCCCTGATCAACTGAATCGCAAGAGCCCCTTCCCGGTTCGAAAAGAA
ACCCAGGCCAAGCATCTTAATCTCCCCAAGTTCCCCACTACCACTATCGGTTCCTTCCCTCAAACAAAGGAAATT
CGTCAAGCCCGTGCCAAGTTTAACAAGGGTGAGCTCACCAAAGAGGAGTATGAAACGTTCATCAAAAAAGAAATC
GAGCATGTCGTGCGCTTCCAAGAGAGTATTGACCTGGATATTCTTGTCCACGGAGAGCCTGAACGAAACGACATG
GTTCAATACTTCGGTGAACTCCTTAACGGTTTCGTCTTCACTCAGAACGCCTGGGTGCAGAGCTACGGTTCTCGC
TATGTGCGCCCTCCCATTATCGTTTCAGATGTCAGTCGTCCCGGTCCCATGACCGTTAAGTGGAGTAGCTACGCC
CAGAGCCTCACCAAGAAACCCATGAAGGGCATGTTAACTGGTCCCGTCACCATTCTCAACTGGTCATTCCCTCGG
GCCGACATCTCACGTGAAATGCAGTCCAAGCAGCTCGCCCTCGCACTCCGCGACGAGGTTATCGATCTTGAGAAT
GCTGGAATTCATGCTATTCAGGTCGACGAGCCCGCTATCCGTGAAGGTCTTCCCCTCCGCCGGGCTGACTGGGAT
GGCTATCTTGAGTGGGCTGTAGACTCTTTCAAGCTTGCAACAGCTGGTGTCACTGATCAACTTCAGACTCACTCT
CACTTTTGCTACTCTGACTTTGACGATATTTTCCCGTCTATTCAACGCCTTGACGCTGATGTTATTTCGATCGAG
GCTTCCAAGAGTGACATGAAACTGCTCAATACCTTTAAGCACTATGGCTATTCCAACCAGATTGGTCCGGGTGTC
TATGATATCCATTCACCCCGTGTTCCCGGTGATCAGGAGATTAAAGACCGCCTTCAGGCCATGCTTAGCATTCTG
CCAGACTCTCTTGTCTTTGTTAACCCTGACTGCGGTCTCAAGACGCGCGGCTGGAAAGAGACGGAAGCTTCTCTG
AAGAACCTTGTTGCAGGCGCCAAGTGGGCTCGTCAAAACTACGCTTGA
Gene >AgabiH97|071260
ATGGTTCTGTCAAGTGTTCTAGGATTTCCTCGTATCGGTGAGTCTCGATCTTTCGCGTTCGGCTTTGATGTTTCC
CTTGACATCCTTTTTCTGATTGTGACATATATAGGAGCTAACCGTGAAATAAAAAAGGCTGTCGAAGCATACTGG
GCTGGTAAAACCTCTGCTGAAGACCTCCAAAAAGTGGCTGCGGAGGTGAGGAAGACCAGCTGGACTTCGGTCAAA
AATCATCGCGTCGACTTTGTTCCTAGGTGTGTTTACAACTGATCAATCAGGTCAGCACAAAGGTCTAAAAATGTT
ACACAGCGGTGAATTCTCTCTCTATGATCATGTTCTTGATCACTCTGCCGCTTTCAATGTCATTCCCCAGCGTTA
TGTTGGTCTCGGATTGACCCCTCTTGATGTTTACTTTGCTATGGGTCGTGGACGTCAATCCGAGGGTGTCGACGT
CCCCGCTTCCGAGATGAAGAAATGGCAAGTGTCAACTATGTCGATATTTAAATGAATATTAATCATCTTGTAGGT
TTGACTCAAACTACCATTATGTCGTTCCCGAGTTGTCAGAGGAGACCGATTTAAAGCTCATCTATAACAAGGCTC
TTGAGGAGTTCAAAGAAGCCAAGGAGGCTGGTATCACCACTCGTCCTGTTGTTCTCGGCCCTGTCTCTTTCCTTG
TTCTAGGAAAGAGTGCCAAATCCGCTCAGCCTGGGTTCCGACCCATTTCCCTCCTGCCTAAACTCATTCCCGTCT
ACAAGCAACTTCTTTCGGAGCTGAAAGCCGCGGGTGCTGAGTGGGTCCAGATTGATGAACCGATCTTGGCACTTG
ATAGCGCTGCCGCCCTCGAGAAGGAGTATACTGCTTCATTCACTGAGCTTGCACCTGTTTCTCCTAAGATCATGC
TCACCACTTACTTTTCCCGCCTCGATTCCAACGTGAGGTTCATCGCCAAGCTACCCGTCGCTGGTCTTCACATCG
ATCTCGATCGCGCCCCTGATCAACTCACTGAGGTCGCCAATGCAGTTAAGAACACTCCTATTGTACTTTCGTTGG
GCCTCGTTTCCGGCCGCAACATATGGAAAACCGATTTCGGCGCTGCTATCAAGCTCGCTCAAACTGCTATTGACA
TCCTTGGTGCTGGTCGTGTCATTGTTGCCACCTCGTCTTCCCTCCTACACACTCCTGTTACTCTTGCCTCTGAGA
ATAAGCTGACTGCAGAGCAGAAGGATTGGTTCTCCTTCGCCCTCGAGAAAGCTGAAGAAGTCGCTGTTATCGCCG
CCGTTCTTTCCGGCTCTCAAGATGCCTCGGTCACAGCCGCTCTAGAGGCTAACAGAGTTTCTATCAACAAGCGTC
GTGAGTTTGAGAAGAACTCCGATGACACTGTTCGCAAGCGCGTTGCGGCCATCACCCCTGATCAACTGAATCGCA
AGAGCCCCTTCCCGGTTCGAAAAGAAACCCAGGCCAAGCATCTTAATCTCCCCAAGTTCCCCACTACCACTATCG
GTTCCTTCCCTGTTCGCACGTTTCCCTTGATGTGGTGGTCCAAATACTAACATCTAGTGTATAGCAAACAAAGGA
AATTCGTCAAGCCCGTGCCAAGTTTAACAAGGGTGAGCTCACCAAAGAGGAGTATGAAACGTTCATCAAAAAAGA
AATCGAGCATGTCGTGCGCTTCCAAGAGAGTATTGACCTGGATATTCTTGTCCACGGAGAGCCTGAACGAAACGA
CATGGTTCAATACTTCGGTGAACTCCTTAACGGTTTCGTCTTCACTCAGAACGCCTGGGTGCAGAGCTACGGTTC
TCGGTATGTTCACGTTTATATCTGATTCAGTTGTATCTCATTTACCGCCACTCTATCAGCTATGTGCGCCCTCCC
ATTATCGTTTCAGATGTCAGTCGTCCCGGTCCCATGACCGTTAAGTGGAGTAGCTACGCCCAGAGCCTCACCAAG
AAACCCATGAAGGGCATGTTAACTGGTCCCGTCACCATTCTCAACTGGTCATTCCCTCGGGCCGACATCTCACGT
GAAATGCAGTCCAAGCAGCTCGCCCTCGCACTCCGCGACGAGGTTATCGATCTTGAGAATGCTGGAATTCATGCT
ATTCAGGTCGACGAGCCCGCTATCCGTGAAGGTGTAAGTTGTTTTACCTTCGTTTTGAAGGATTATAGTGATTGA
TACTCTGTAGCTTCCCCTCCGCCGGGCTGACTGGGATGGCTATCTTGAGTGGGCTGTAGACTCTTTCAAGCTTGC
AACAGCTGGTGTCACTGATCAACTTCAGACTCACTCTCACTTTTGCTACTCTGACTTTGACGATATTTTCCCGTC
TATTCAACGCCTTGACGCTGATGTTATTTCGATCGAGGCTTCCAAGAGTGACATGAAACTGCTCAATACCTTTAA
GCACTATGGCTATTCCAACCAGATTGGTCCGGGTGTCTATGATATCCATTCACCCCGTGTTCCCGGTGATCAGGA
GATTAAAGACCGCCTTCAGGCCATGCTTAGCATTCTGCCAGACTCTCTTGTCTTTGTTAACCCTGTAAGAAGTCT
TGATGCTCTCTCCTAATCAAACATTCACCGGCTACCATATAGGACTGCGGTCTCAAGACGCGCGGCTGGAAAGAG
ACGGAAGCTTCTCTGAAGAACCTTGTTGCAGGCGCCAAGTGGGCTCGTCAAAACTACGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail