Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071220
Gene name
Locationscaffold_4:1455593..1458023
Strand+
Gene length (bp)2430
Transcript length (bp)2265
Coding sequence length (bp)2265
Protein length (aa) 755

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.8E-49 1 295
PF14492 EFG_III Elongation Factor G, domain III 1.1E-11 414 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2R994|RRF2M_ASPNC Ribosome-releasing factor 2, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mef2 PE=3 SV=1 2 751 2.0E-105
sp|A6Q1M7|EFG_NITSB Elongation factor G OS=Nitratiruptor sp. (strain SB155-2) GN=fusA PE=3 SV=1 1 750 5.0E-101
sp|A6LLL0|EFG_THEM4 Elongation factor G OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=fusA PE=3 SV=1 1 741 2.0E-100
sp|Q6MER8|EFG_PARUW Elongation factor G OS=Protochlamydia amoebophila (strain UWE25) GN=fusA PE=3 SV=1 1 750 2.0E-100
sp|B8NDZ1|RRF2M_ASPFN Ribosome-releasing factor 2, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mef2 PE=3 SV=1 2 751 5.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2R994|RRF2M_ASPNC Ribosome-releasing factor 2, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mef2 PE=3 SV=1 2 751 2.0E-105
sp|A6Q1M7|EFG_NITSB Elongation factor G OS=Nitratiruptor sp. (strain SB155-2) GN=fusA PE=3 SV=1 1 750 5.0E-101
sp|A6LLL0|EFG_THEM4 Elongation factor G OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=fusA PE=3 SV=1 1 741 2.0E-100
sp|Q6MER8|EFG_PARUW Elongation factor G OS=Protochlamydia amoebophila (strain UWE25) GN=fusA PE=3 SV=1 1 750 2.0E-100
sp|B8NDZ1|RRF2M_ASPFN Ribosome-releasing factor 2, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mef2 PE=3 SV=1 2 751 5.0E-100
sp|Q7UZY6|EFG_PROMP Elongation factor G OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fusA PE=3 SV=1 1 745 1.0E-99
sp|A9BHA8|EFG_PETMO Elongation factor G OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=fusA PE=3 SV=1 1 739 2.0E-99
sp|A3PEZ8|EFG_PROM0 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9301) GN=fusA PE=3 SV=1 1 745 8.0E-99
sp|Q318N4|EFG_PROM9 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9312) GN=fusA PE=3 SV=1 1 745 9.0E-99
sp|A5GW13|EFG_SYNR3 Elongation factor G OS=Synechococcus sp. (strain RCC307) GN=fusA PE=3 SV=1 1 745 9.0E-99
sp|A8G709|EFG_PROM2 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9215) GN=fusA PE=3 SV=1 1 745 1.0E-98
sp|Q0ID58|EFG_SYNS3 Elongation factor G OS=Synechococcus sp. (strain CC9311) GN=fusA PE=3 SV=1 1 745 1.0E-98
sp|B2J5B0|EFG_NOSP7 Elongation factor G OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=fusA PE=3 SV=1 1 745 2.0E-98
sp|A2BT84|EFG_PROMS Elongation factor G OS=Prochlorococcus marinus (strain AS9601) GN=fusA PE=3 SV=1 1 745 2.0E-98
sp|Q0AUH7|EFG2_SYNWW Elongation factor G 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=fusA2 PE=3 SV=1 1 748 2.0E-98
sp|B9K883|EFG_THENN Elongation factor G OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=fusA PE=3 SV=1 1 749 3.0E-98
sp|B7IHU3|EFG_THEAB Elongation factor G OS=Thermosipho africanus (strain TCF52B) GN=fusA PE=3 SV=1 1 741 4.0E-98
sp|A8EW86|EFG_ARCB4 Elongation factor G OS=Arcobacter butzleri (strain RM4018) GN=fusA PE=3 SV=1 1 750 1.0E-97
sp|Q3AW54|EFG_SYNS9 Elongation factor G OS=Synechococcus sp. (strain CC9902) GN=fusA PE=3 SV=1 1 745 1.0E-97
sp|Q3ZZM6|EFG_DEHMC Elongation factor G OS=Dehalococcoides mccartyi (strain CBDB1) GN=fusA PE=3 SV=1 1 753 3.0E-97
sp|A5FRY7|EFG_DEHMB Elongation factor G OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=fusA PE=3 SV=1 1 753 3.0E-97
sp|Q3AMT5|EFG_SYNSC Elongation factor G OS=Synechococcus sp. (strain CC9605) GN=fusA PE=3 SV=1 1 745 3.0E-97
sp|Q7MA53|EFG_WOLSU Elongation factor G OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=fusA PE=3 SV=1 1 739 5.0E-97
sp|Q7U4D2|EFG_SYNPX Elongation factor G OS=Synechococcus sp. (strain WH8102) GN=fusA PE=3 SV=1 1 745 6.0E-97
sp|B6Q1T9|RRF2M_TALMQ Ribosome-releasing factor 2, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mef2 PE=3 SV=1 2 751 9.0E-97
sp|Q72I01|EFG_THET2 Elongation factor G OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=fusA PE=1 SV=1 1 746 1.0E-96
sp|P13551|EFG_THETH Elongation factor G OS=Thermus thermophilus GN=fusA PE=1 SV=1 1 746 1.0E-96
sp|Q5SHN5|EFG_THET8 Elongation factor G OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=fusA PE=1 SV=1 1 746 1.0E-96
sp|A1VYJ8|EFG_CAMJJ Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=fusA PE=3 SV=1 1 750 1.0E-96
sp|Q2JMX8|EFG_SYNJB Elongation factor G OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=fusA PE=3 SV=1 1 745 2.0E-96
sp|Q39Y09|EFG1_GEOMG Elongation factor G 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fusA1 PE=3 SV=1 2 751 2.0E-96
sp|Q8DI43|EFG_THEEB Elongation factor G OS=Thermosynechococcus elongatus (strain BP-1) GN=fusA PE=3 SV=1 1 745 3.0E-96
sp|A5IM80|EFG_THEP1 Elongation factor G OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=fusA PE=3 SV=1 1 749 3.0E-96
sp|Q8YP62|EFG_NOSS1 Elongation factor G OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fusA PE=3 SV=1 1 745 4.0E-96
sp|B1LBP3|EFG_THESQ Elongation factor G OS=Thermotoga sp. (strain RQ2) GN=fusA PE=3 SV=1 1 749 4.0E-96
sp|Q2W2I8|EFG_MAGSA Elongation factor G OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=fusA PE=3 SV=1 2 739 4.0E-96
sp|A7H4P5|EFG_CAMJD Elongation factor G OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=fusA PE=3 SV=1 1 750 4.0E-96
sp|Q5AAV3|RRF2M_CANAL Ribosome-releasing factor 2, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEF2 PE=3 SV=1 2 750 4.0E-96
sp|P38525|EFG_THEMA Elongation factor G OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fusA PE=3 SV=2 1 749 6.0E-96
sp|Q2JUX5|EFG_SYNJA Elongation factor G OS=Synechococcus sp. (strain JA-3-3Ab) GN=fusA PE=3 SV=1 1 745 1.0E-95
sp|Q5HVX6|EFG_CAMJR Elongation factor G OS=Campylobacter jejuni (strain RM1221) GN=fusA PE=3 SV=1 1 750 1.0E-95
sp|Q9PI16|EFG_CAMJE Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=fusA PE=3 SV=1 1 750 1.0E-95
sp|A8FKR7|EFG_CAMJ8 Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=fusA PE=3 SV=1 1 750 1.0E-95
sp|B1GZ80|EFG_UNCTG Elongation factor G OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=fusA PE=3 SV=1 1 739 2.0E-95
sp|A8Z6I6|EFG_CAMC1 Elongation factor G OS=Campylobacter concisus (strain 13826) GN=fusA PE=3 SV=1 1 750 2.0E-95
sp|B9KFH1|EFG_CAMLR Elongation factor G OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=fusA PE=3 SV=1 1 750 3.0E-95
sp|Q3APH0|EFG_CHLCH Elongation factor G OS=Chlorobium chlorochromatii (strain CaD3) GN=fusA PE=3 SV=1 1 750 4.0E-95
sp|B9L7K0|EFG_NAUPA Elongation factor G OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=fusA PE=3 SV=1 1 750 4.0E-95
sp|A5GIP1|EFG_SYNPW Elongation factor G OS=Synechococcus sp. (strain WH7803) GN=fusA PE=3 SV=1 1 745 4.0E-95
sp|A1KRH0|EFG_NEIMF Elongation factor G OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=fusA PE=3 SV=1 2 738 4.0E-95
sp|Q9JX07|EFG_NEIMA Elongation factor G OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fusA PE=3 SV=1 2 738 4.0E-95
sp|A9M3X0|EFG_NEIM0 Elongation factor G OS=Neisseria meningitidis serogroup C (strain 053442) GN=fusA PE=3 SV=1 2 738 4.0E-95
sp|B0RB35|EFG_CLAMS Elongation factor G OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=fusA PE=3 SV=1 1 653 4.0E-95
sp|A5CUB7|EFG_CLAM3 Elongation factor G OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=fusA PE=3 SV=1 1 653 4.0E-95
sp|Q3MDM4|EFG_ANAVT Elongation factor G OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=fusA PE=3 SV=1 1 745 5.0E-95
sp|B4RQX2|EFG_NEIG2 Elongation factor G OS=Neisseria gonorrhoeae (strain NCCP11945) GN=fusA PE=3 SV=1 2 738 5.0E-95
sp|Q5F5S3|EFG_NEIG1 Elongation factor G OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fusA PE=3 SV=1 2 738 5.0E-95
sp|B5EFP7|EFG_GEOBB Elongation factor G OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=fusA PE=3 SV=1 2 731 5.0E-95
sp|A0LRL7|EFG_ACIC1 Elongation factor G OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fusA PE=3 SV=1 1 750 6.0E-95
sp|Q7VJ85|EFG_HELHP Elongation factor G OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=fusA PE=3 SV=1 1 750 6.0E-95
sp|A7GZJ4|EFG_CAMC5 Elongation factor G OS=Campylobacter curvus (strain 525.92) GN=fusA PE=3 SV=1 1 750 8.0E-95
sp|Q9K1I8|EFG_NEIMB Elongation factor G OS=Neisseria meningitidis serogroup B (strain MC58) GN=fusA PE=1 SV=1 2 738 1.0E-94
sp|Q7NEF2|EFG_GLOVI Elongation factor G OS=Gloeobacter violaceus (strain PCC 7421) GN=fusA PE=3 SV=1 1 745 1.0E-94
sp|Q5BB57|RRF2M_EMENI Ribosome-releasing factor 2, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mef2 PE=3 SV=1 2 751 1.0E-94
sp|B9W892|RRF2M_CANDC Ribosome-releasing factor 2, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MEF2 PE=3 SV=1 2 750 1.0E-94
sp|Q3Z983|EFG_DEHM1 Elongation factor G OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=fusA PE=3 SV=1 1 753 1.0E-94
sp|B3E7T2|EFG_GEOLS Elongation factor G OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=fusA PE=3 SV=1 2 751 2.0E-94
sp|A8LC59|EFG_FRASN Elongation factor G OS=Frankia sp. (strain EAN1pec) GN=fusA PE=3 SV=1 2 739 2.0E-94
sp|A0JMI9|RRF2M_DANRE Ribosome-releasing factor 2, mitochondrial OS=Danio rerio GN=gfm2 PE=2 SV=2 1 737 3.0E-94
sp|Q2S3R7|EFG_SALRD Elongation factor G OS=Salinibacter ruber (strain DSM 13855 / M31) GN=fusA PE=3 SV=1 2 750 4.0E-94
sp|P18667|EFG_SYNP6 Elongation factor G OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=fusA PE=3 SV=1 1 745 4.0E-94
sp|Q31PV4|EFG_SYNE7 Elongation factor G OS=Synechococcus elongatus (strain PCC 7942) GN=fusA PE=3 SV=1 1 745 4.0E-94
sp|Q2JFH9|EFG_FRASC Elongation factor G OS=Frankia sp. (strain CcI3) GN=fusA PE=3 SV=1 2 739 5.0E-94
sp|Q6CBI0|RRF2M_YARLI Ribosome-releasing factor 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MEF2 PE=3 SV=1 1 746 5.0E-94
sp|Q748Y8|EFG2_GEOSL Elongation factor G 2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=fusA2 PE=3 SV=1 2 724 5.0E-94
sp|Q0RRS4|EFG_FRAAA Elongation factor G OS=Frankia alni (strain ACN14a) GN=fusA PE=3 SV=1 2 739 6.0E-94
sp|B8MR69|RRF2M_TALSN Ribosome-releasing factor 2, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mef2 PE=3 SV=2 2 753 9.0E-94
sp|Q73R08|EFG1_TREDE Elongation factor G 1 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=fusA1 PE=3 SV=1 1 737 1.0E-93
sp|Q824G0|EFG_CHLCV Elongation factor G OS=Chlamydophila caviae (strain GPIC) GN=fusA PE=3 SV=1 1 750 1.0E-93
sp|Q46IW3|EFG_PROMT Elongation factor G OS=Prochlorococcus marinus (strain NATL2A) GN=fusA PE=3 SV=1 1 745 1.0E-93
sp|P74228|EFG2_SYNY3 Elongation factor G 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusB PE=3 SV=1 1 745 1.0E-93
sp|Q01W89|EFG_SOLUE Elongation factor G OS=Solibacter usitatus (strain Ellin6076) GN=fusA PE=3 SV=1 1 751 1.0E-93
sp|C1A6Q2|EFG_GEMAT Elongation factor G OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=fusA PE=3 SV=1 2 751 2.0E-93
sp|B4SBU4|EFG_PELPB Elongation factor G OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=fusA PE=3 SV=1 1 750 2.0E-93
sp|A5DTX8|RRF2M_LODEL Ribosome-releasing factor 2, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MEF2 PE=3 SV=1 2 748 2.0E-93
sp|Q5WZL5|EFG_LEGPL Elongation factor G OS=Legionella pneumophila (strain Lens) GN=fusA PE=3 SV=1 2 512 2.0E-93
sp|Q7VA04|EFG_PROMA Elongation factor G OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=fusA PE=3 SV=1 1 512 2.0E-93
sp|Q7NAV3|EFG_MYCGA Elongation factor G OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=fusA PE=3 SV=2 1 738 2.0E-93
sp|Q6MJ13|EFG1_BDEBA Elongation factor G 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=fusA1 PE=3 SV=1 2 753 3.0E-93
sp|P40173|EFG1_STRCO Elongation factor G 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusA PE=3 SV=2 1 745 3.0E-93
sp|A5IHR7|EFG_LEGPC Elongation factor G OS=Legionella pneumophila (strain Corby) GN=fusA PE=3 SV=1 2 512 3.0E-93
sp|Q0SFF3|EFG_RHOJR Elongation factor G OS=Rhodococcus jostii (strain RHA1) GN=fusA PE=3 SV=1 1 739 3.0E-93
sp|Q5X862|EFG_LEGPA Elongation factor G OS=Legionella pneumophila (strain Paris) GN=fusA PE=3 SV=1 2 512 4.0E-93
sp|Q118Z3|EFG1_TRIEI Elongation factor G 1 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA1 PE=3 SV=1 1 739 4.0E-93
sp|Q5L6S5|EFG_CHLAB Elongation factor G OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=fusA PE=3 SV=1 1 750 4.0E-93
sp|Q5ZYP6|EFG_LEGPH Elongation factor G OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fusA PE=3 SV=1 2 512 5.0E-93
sp|A2BYN5|EFG_PROM5 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9515) GN=fusA PE=3 SV=1 1 745 5.0E-93
sp|A7HM55|EFG_FERNB Elongation factor G OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=fusA PE=3 SV=1 1 749 5.0E-93
sp|A2C4U6|EFG_PROM1 Elongation factor G OS=Prochlorococcus marinus (strain NATL1A) GN=fusA PE=3 SV=1 1 745 5.0E-93
sp|C1AYS4|EFG_RHOOB Elongation factor G OS=Rhodococcus opacus (strain B4) GN=fusA PE=3 SV=1 1 739 5.0E-93
sp|Q6CK29|RRF2M_KLULA Ribosome-releasing factor 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEF2 PE=3 SV=1 1 748 7.0E-93
sp|Q253F1|EFG_CHLFF Elongation factor G OS=Chlamydophila felis (strain Fe/C-56) GN=fusA PE=3 SV=1 1 750 8.0E-93
sp|Q3B6G4|EFG_CHLL7 Elongation factor G OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=fusA PE=3 SV=1 1 739 8.0E-93
sp|Q8R602|EFG_FUSNN Elongation factor G OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fusA PE=3 SV=1 2 753 9.0E-93
sp|Q67JU0|EFG_SYMTH Elongation factor G OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=fusA PE=3 SV=1 1 739 9.0E-93
sp|C0ZVT6|EFG_RHOE4 Elongation factor G OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=fusA PE=3 SV=1 1 739 1.0E-92
sp|Q754I9|RRF2M_ASHGO Ribosome-releasing factor 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEF2 PE=3 SV=1 1 750 1.0E-92
sp|B3QR64|EFG_CHLP8 Elongation factor G OS=Chlorobaculum parvum (strain NCIB 8327) GN=fusA PE=3 SV=1 1 753 2.0E-92
sp|B4SKW0|EFG_STRM5 Elongation factor G OS=Stenotrophomonas maltophilia (strain R551-3) GN=fusA PE=3 SV=1 2 729 2.0E-92
sp|A8F4Q8|EFG_PSELT Elongation factor G OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=fusA PE=3 SV=1 1 741 2.0E-92
sp|Q8KAG9|EFG_CHLTE Elongation factor G OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=fusA-1 PE=3 SV=1 1 753 2.0E-92
sp|Q211E5|EFG_RHOPB Elongation factor G OS=Rhodopseudomonas palustris (strain BisB18) GN=fusA PE=3 SV=1 2 738 3.0E-92
sp|Q9Z802|EFG_CHLPN Elongation factor G OS=Chlamydia pneumoniae GN=fusA PE=3 SV=1 1 750 3.0E-92
sp|O94429|RRF2M_SCHPO Ribosome-releasing factor 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mef2 PE=3 SV=1 1 729 3.0E-92
sp|A0RQI0|EFG_CAMFF Elongation factor G OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=fusA PE=3 SV=1 1 750 3.0E-92
sp|O84444|EFG_CHLTR Elongation factor G OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fusA PE=3 SV=1 1 750 4.0E-92
sp|Q3KLR3|EFG_CHLTA Elongation factor G OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=fusA PE=3 SV=1 1 750 4.0E-92
sp|B0BC74|EFG_CHLTB Elongation factor G OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=fusA PE=3 SV=1 1 750 5.0E-92
sp|Q5BJP6|RRF2M_RAT Ribosome-releasing factor 2, mitochondrial OS=Rattus norvegicus GN=Gfm2 PE=2 SV=2 1 740 6.0E-92
sp|B0B809|EFG_CHLT2 Elongation factor G OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=fusA PE=3 SV=1 1 750 9.0E-92
sp|A8F0P0|EFG_RICM5 Elongation factor G OS=Rickettsia massiliae (strain Mtu5) GN=fusA PE=3 SV=2 1 739 9.0E-92
sp|Q7V501|EFG_PROMM Elongation factor G OS=Prochlorococcus marinus (strain MIT 9313) GN=fusA PE=3 SV=1 1 512 9.0E-92
sp|C3KVQ4|EFG_CLOB6 Elongation factor G OS=Clostridium botulinum (strain 657 / Type Ba4) GN=fusA PE=3 SV=1 1 739 1.0E-91
sp|Q9PJV6|EFG_CHLMU Elongation factor G OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fusA PE=3 SV=1 1 750 1.0E-91
sp|A7I3T6|EFG_CAMHC Elongation factor G OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=fusA PE=3 SV=1 1 750 1.0E-91
sp|A1W2Q4|EFG_ACISJ Elongation factor G OS=Acidovorax sp. (strain JS42) GN=fusA PE=3 SV=1 2 745 1.0E-91
sp|A6ZQM4|RRF2M_YEAS7 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=MEF2 PE=3 SV=1 1 751 1.0E-91
sp|A0L5X0|EFG_MAGMM Elongation factor G OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=fusA PE=3 SV=1 1 739 1.0E-91
sp|A3DIZ9|EFG_CLOTH Elongation factor G OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=fusA PE=3 SV=1 2 746 2.0E-91
sp|Q1BDD4|EFG_MYCSS Elongation factor G OS=Mycobacterium sp. (strain MCS) GN=fusA PE=3 SV=1 1 739 2.0E-91
sp|A1UBL0|EFG_MYCSK Elongation factor G OS=Mycobacterium sp. (strain KMS) GN=fusA PE=3 SV=1 1 739 2.0E-91
sp|A3PV95|EFG_MYCSJ Elongation factor G OS=Mycobacterium sp. (strain JLS) GN=fusA PE=3 SV=1 1 739 2.0E-91
sp|A2CC86|EFG_PROM3 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9303) GN=fusA PE=3 SV=1 1 512 2.0E-91
sp|Q8KTB6|EFG_RICMO Elongation factor G OS=Rickettsia montanensis GN=fusA PE=3 SV=1 1 739 2.0E-91
sp|B4S5N0|EFG_PROA2 Elongation factor G OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=fusA PE=3 SV=1 1 750 3.0E-91
sp|P75544|EFG_MYCPN Elongation factor G OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=fusA PE=3 SV=1 1 738 3.0E-91
sp|Q8KTB0|EFG_RICBE Elongation factor G OS=Rickettsia bellii GN=fusA PE=3 SV=1 1 739 3.0E-91
sp|A8GV17|EFG_RICB8 Elongation factor G OS=Rickettsia bellii (strain OSU 85-389) GN=fusA PE=3 SV=1 1 739 3.0E-91
sp|A8M532|EFG_SALAI Elongation factor G OS=Salinispora arenicola (strain CNS-205) GN=fusA PE=3 SV=1 1 739 3.0E-91
sp|Q6ACY9|EFG_LEIXX Elongation factor G OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=fusA PE=3 SV=1 1 724 3.0E-91
sp|B9MB70|EFG_ACIET Elongation factor G OS=Acidovorax ebreus (strain TPSY) GN=fusA PE=3 SV=1 2 745 3.0E-91
sp|C5C0J4|EFG_BEUC1 Elongation factor G OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=fusA PE=3 SV=1 1 750 4.0E-91
sp|B2FQ42|EFG_STRMK Elongation factor G OS=Stenotrophomonas maltophilia (strain K279a) GN=fusA PE=3 SV=1 2 729 4.0E-91
sp|P39677|RRF2M_YEAST Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEF2 PE=1 SV=1 1 751 4.0E-91
sp|B3LQ11|RRF2M_YEAS1 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MEF2 PE=3 SV=1 1 751 4.0E-91
sp|Q4JT40|EFG_CORJK Elongation factor G OS=Corynebacterium jeikeium (strain K411) GN=fusA PE=3 SV=1 1 739 4.0E-91
sp|O51634|EFG2_BORBU Elongation factor G 2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=fusB PE=3 SV=1 1 653 4.0E-91
sp|Q5L400|EFG_GEOKA Elongation factor G OS=Geobacillus kaustophilus (strain HTA426) GN=fusA PE=3 SV=1 2 750 4.0E-91
sp|Q8KTA8|EFG_RICFE Elongation factor G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fusA PE=3 SV=2 1 739 5.0E-91
sp|B2G8Y0|EFG_LACRJ Elongation factor G OS=Lactobacillus reuteri (strain JCM 1112) GN=fusA PE=3 SV=1 2 752 6.0E-91
sp|A5VLK8|EFG_LACRD Elongation factor G OS=Lactobacillus reuteri (strain DSM 20016) GN=fusA PE=3 SV=1 2 752 6.0E-91
sp|B1MGH8|EFG_MYCA9 Elongation factor G OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=fusA PE=3 SV=1 1 739 7.0E-91
sp|B1KSM8|EFG_CLOBM Elongation factor G OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=fusA PE=3 SV=1 1 739 8.0E-91
sp|C1FMV4|EFG_CLOBJ Elongation factor G OS=Clostridium botulinum (strain Kyoto / Type A2) GN=fusA PE=3 SV=1 1 739 8.0E-91
sp|Q1GP96|EFG_SPHAL Elongation factor G OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=fusA PE=3 SV=1 2 739 9.0E-91
sp|A6QNM2|RRF2M_BOVIN Ribosome-releasing factor 2, mitochondrial OS=Bos taurus GN=GFM2 PE=2 SV=1 1 740 9.0E-91
sp|Q47LJ0|EFG_THEFY Elongation factor G OS=Thermobifida fusca (strain YX) GN=fusA PE=3 SV=1 1 739 9.0E-91
sp|Q6MU82|EFG_MYCMS Elongation factor G OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=fusA PE=3 SV=1 2 753 9.0E-91
sp|A3LWR2|RRF2M_PICST Ribosome-releasing factor 2, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MEF2 PE=3 SV=2 2 752 1.0E-90
sp|A8GQV7|EFG_RICRS Elongation factor G OS=Rickettsia rickettsii (strain Sheila Smith) GN=fusA PE=3 SV=1 1 739 1.0E-90
sp|B0BWA2|EFG_RICRO Elongation factor G OS=Rickettsia rickettsii (strain Iowa) GN=fusA PE=3 SV=1 1 739 1.0E-90
sp|A4T1R3|EFG_MYCGI Elongation factor G OS=Mycobacterium gilvum (strain PYR-GCK) GN=fusA PE=3 SV=1 1 739 2.0E-90
sp|Q0SMG2|EFG2_BORAP Elongation factor G 2 OS=Borrelia afzelii (strain PKo) GN=fusA2 PE=3 SV=1 1 653 2.0E-90
sp|Q92J93|EFG_RICCN Elongation factor G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fusA PE=3 SV=1 1 739 2.0E-90
sp|A4SCQ6|EFG_CHLPM Elongation factor G OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=fusA PE=3 SV=1 1 750 2.0E-90
sp|C4K1P6|EFG_RICPU Elongation factor G OS=Rickettsia peacockii (strain Rustic) GN=fusA PE=3 SV=1 1 739 2.0E-90
sp|Q6A6L5|EFG_PROAC Elongation factor G OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=fusA PE=3 SV=1 1 739 2.0E-90
sp|A7GJ77|EFG_CLOBL Elongation factor G OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=fusA PE=3 SV=1 1 739 2.0E-90
sp|B1IGF7|EFG_CLOBK Elongation factor G OS=Clostridium botulinum (strain Okra / Type B1) GN=fusA PE=3 SV=1 1 739 2.0E-90
sp|Q5GWS9|EFG_XANOR Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=fusA PE=3 SV=2 2 738 2.0E-90
sp|Q2NZY2|EFG_XANOM Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fusA PE=3 SV=1 2 738 2.0E-90
sp|Q8KTB4|EFG_RICHE Elongation factor G OS=Rickettsia helvetica GN=fusA PE=3 SV=1 1 739 2.0E-90
sp|Q0BSG5|EFG_GRABC Elongation factor G OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=fusA PE=3 SV=1 1 745 2.0E-90
sp|Q82DQ1|EFG_STRAW Elongation factor G OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=fusA PE=3 SV=1 1 745 3.0E-90
sp|Q8KTB9|EFG_RICPA Elongation factor G OS=Rickettsia parkeri GN=fusA PE=3 SV=1 1 739 3.0E-90
sp|B2GDX1|EFG_LACF3 Elongation factor G OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=fusA PE=3 SV=1 2 752 4.0E-90
sp|A6LPQ8|EFG_CLOB8 Elongation factor G OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=fusA PE=3 SV=1 1 746 4.0E-90
sp|Q9PPW7|EFG_UREPA Elongation factor G OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=fusA PE=3 SV=1 1 502 4.0E-90
sp|B1AJG4|EFG_UREP2 Elongation factor G OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=fusA PE=3 SV=1 1 502 4.0E-90
sp|B3EP64|EFG_CHLPB Elongation factor G OS=Chlorobium phaeobacteroides (strain BS1) GN=fusA PE=3 SV=1 1 750 4.0E-90
sp|Q2RFP4|EFG_MOOTA Elongation factor G OS=Moorella thermoacetica (strain ATCC 39073) GN=fusA PE=3 SV=1 2 739 5.0E-90
sp|Q8KTB8|EFG_RICSI Elongation factor G OS=Rickettsia sibirica GN=fusA PE=3 SV=1 1 739 5.0E-90
sp|Q8PNS6|EFG_XANAC Elongation factor G OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fusA PE=3 SV=1 2 738 6.0E-90
sp|Q6AP74|EFG2_DESPS Elongation factor G 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=fusA2 PE=3 SV=1 1 654 6.0E-90
sp|P41084|EFG_RICPR Elongation factor G OS=Rickettsia prowazekii (strain Madrid E) GN=fusA PE=3 SV=3 1 739 6.0E-90
sp|B7GJ64|EFG_ANOFW Elongation factor G OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=fusA PE=3 SV=1 2 750 6.0E-90
sp|A0PXU3|EFG_CLONN Elongation factor G OS=Clostridium novyi (strain NT) GN=fusA PE=3 SV=1 1 739 7.0E-90
sp|A5I7K9|EFG_CLOBH Elongation factor G OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=fusA PE=3 SV=1 1 739 7.0E-90
sp|A7FZ72|EFG_CLOB1 Elongation factor G OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=fusA PE=3 SV=1 1 739 7.0E-90
sp|Q8R2Q4|RRF2M_MOUSE Ribosome-releasing factor 2, mitochondrial OS=Mus musculus GN=Gfm2 PE=1 SV=2 1 740 7.0E-90
sp|A5EX85|EFG_DICNV Elongation factor G OS=Dichelobacter nodosus (strain VCS1703A) GN=fusA PE=3 SV=1 2 753 7.0E-90
sp|A4XBP9|EFG_SALTO Elongation factor G OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=fusA PE=3 SV=1 1 739 8.0E-90
sp|C1CC62|EFG_STRZJ Elongation factor G OS=Streptococcus pneumoniae (strain JJA) GN=fusA PE=3 SV=1 2 750 8.0E-90
sp|B8ZKU0|EFG_STRPJ Elongation factor G OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=fusA PE=3 SV=1 2 750 8.0E-90
sp|Q7NQF0|EFG_CHRVO Elongation factor G OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=fusA PE=3 SV=1 2 745 9.0E-90
sp|B1I8Z9|EFG_STRPI Elongation factor G OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=fusA PE=3 SV=1 2 750 9.0E-90
sp|Q5GSU1|EFG_WOLTR Elongation factor G OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=fusA PE=3 SV=1 2 739 9.0E-90
sp|Q46WE0|EFG1_CUPPJ Elongation factor G 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=fusA1 PE=3 SV=1 2 741 1.0E-89
sp|Q1H4P0|EFG_METFK Elongation factor G OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=fusA PE=3 SV=1 2 745 1.0E-89
sp|Q969S9|RRF2M_HUMAN Ribosome-releasing factor 2, mitochondrial OS=Homo sapiens GN=GFM2 PE=1 SV=1 1 740 1.0E-89
sp|Q2SSW9|EFG_MYCCT Elongation factor G OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=fusA PE=3 SV=1 2 753 1.0E-89
sp|P64023|EFG_STRR6 Elongation factor G OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fusA PE=3 SV=1 2 750 1.0E-89
sp|P64022|EFG_STRPN Elongation factor G OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=fusA PE=3 SV=1 2 750 1.0E-89
sp|C1CB46|EFG_STRP7 Elongation factor G OS=Streptococcus pneumoniae (strain 70585) GN=fusA PE=3 SV=1 2 750 1.0E-89
sp|B5E6U5|EFG_STRP4 Elongation factor G OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=fusA PE=3 SV=1 2 750 1.0E-89
sp|Q04MH7|EFG_STRP2 Elongation factor G OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=fusA PE=3 SV=1 2 750 1.0E-89
sp|C5BGM8|EFG_EDWI9 Elongation factor G OS=Edwardsiella ictaluri (strain 93-146) GN=fusA PE=3 SV=1 2 738 1.0E-89
sp|B3EH94|EFG_CHLL2 Elongation factor G OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=fusA PE=3 SV=1 1 745 1.0E-89
sp|Q8KTC1|EFG_RICRI Elongation factor G OS=Rickettsia rickettsii GN=fusA PE=3 SV=1 1 739 1.0E-89
sp|A5N4P4|EFG_CLOK5 Elongation factor G OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=fusA PE=3 SV=1 1 739 1.0E-89
sp|B9DYA6|EFG_CLOK1 Elongation factor G OS=Clostridium kluyveri (strain NBRC 12016) GN=fusA PE=3 SV=1 1 739 1.0E-89
sp|Q2G8Y3|EFG_NOVAD Elongation factor G OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=fusA PE=3 SV=1 2 739 2.0E-89
sp|Q9A3K4|EFG_CAUCR Elongation factor G OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fusA PE=3 SV=1 2 653 2.0E-89
sp|B8H414|EFG_CAUCN Elongation factor G OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=fusA PE=3 SV=1 2 653 2.0E-89
sp|C1CPE5|EFG_STRZT Elongation factor G OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=fusA PE=3 SV=1 2 750 2.0E-89
sp|B2ISJ9|EFG_STRPS Elongation factor G OS=Streptococcus pneumoniae (strain CGSP14) GN=fusA PE=3 SV=1 2 750 2.0E-89
sp|Q1WVA0|EFG_LACS1 Elongation factor G OS=Lactobacillus salivarius (strain UCC118) GN=fusA PE=3 SV=1 2 752 2.0E-89
sp|B3CLA3|EFG_WOLPP Elongation factor G OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=fusA PE=3 SV=1 2 660 2.0E-89
sp|Q1RHC3|EFG_RICBR Elongation factor G OS=Rickettsia bellii (strain RML369-C) GN=fusA PE=3 SV=1 1 739 2.0E-89
sp|B1VET0|EFG_CORU7 Elongation factor G OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=fusA PE=3 SV=1 1 750 2.0E-89
sp|Q5R600|RRF2M_PONAB Ribosome-releasing factor 2, mitochondrial OS=Pongo abelii GN=GFM2 PE=2 SV=1 1 731 2.0E-89
sp|C1CIF3|EFG_STRZP Elongation factor G OS=Streptococcus pneumoniae (strain P1031) GN=fusA PE=3 SV=1 2 750 2.0E-89
sp|Q1MPS9|EFG_LAWIP Elongation factor G OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=fusA PE=3 SV=1 2 739 2.0E-89
sp|Q660H9|EFG2_BORBP Elongation factor G 2 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=fusA2 PE=3 SV=1 1 653 2.0E-89
sp|Q3BWY7|EFG_XANC5 Elongation factor G OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fusA PE=3 SV=1 2 738 2.0E-89
sp|C5CC67|EFG_MICLC Elongation factor G OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=fusA PE=3 SV=1 1 750 2.0E-89
sp|A1T4L5|EFG_MYCVP Elongation factor G OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=fusA PE=3 SV=1 1 739 2.0E-89
sp|C3PMH0|EFG_RICAE Elongation factor G OS=Rickettsia africae (strain ESF-5) GN=fusA PE=3 SV=1 1 739 2.0E-89
sp|P13550|EFG_ARTPT Elongation factor G OS=Arthrospira platensis GN=fusA PE=3 SV=1 1 745 2.0E-89
sp|C3PKP1|EFG_CORA7 Elongation factor G OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=fusA PE=3 SV=1 1 750 3.0E-89
sp|Q8NT19|EFG_CORGL Elongation factor G OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=fusA PE=3 SV=1 1 739 3.0E-89
sp|A5ELN0|EFG_BRASB Elongation factor G OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=fusA PE=3 SV=1 2 738 3.0E-89
sp|C5CP58|EFG_VARPS Elongation factor G OS=Variovorax paradoxus (strain S110) GN=fusA PE=3 SV=1 2 745 3.0E-89
sp|B5ZC32|EFG_UREU1 Elongation factor G OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=fusA PE=3 SV=1 1 494 3.0E-89
sp|Q134S6|EFG_RHOPS Elongation factor G OS=Rhodopseudomonas palustris (strain BisB5) GN=fusA PE=3 SV=1 2 738 3.0E-89
sp|A4QBG9|EFG_CORGB Elongation factor G OS=Corynebacterium glutamicum (strain R) GN=fusA PE=3 SV=1 1 739 3.0E-89
sp|A8GMA0|EFG_RICAH Elongation factor G OS=Rickettsia akari (strain Hartford) GN=fusA PE=3 SV=1 1 739 4.0E-89
sp|B1I1I5|EFG_DESAP Elongation factor G OS=Desulforudis audaxviator (strain MP104C) GN=fusA PE=3 SV=1 2 656 4.0E-89
sp|Q4FLL6|EFG_PELUB Elongation factor G OS=Pelagibacter ubique (strain HTCC1062) GN=fusA PE=3 SV=1 2 751 4.0E-89
sp|Q9ZK24|EFG_HELPJ Elongation factor G OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fusA PE=3 SV=3 1 739 4.0E-89
sp|Q4AAQ6|EFG_MYCHJ Elongation factor G OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=fusA PE=3 SV=2 2 731 4.0E-89
sp|Q4A8T7|EFG_MYCH7 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 7448) GN=fusA PE=3 SV=2 2 731 4.0E-89
sp|Q601W8|EFG_MYCH2 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 232) GN=fusA PE=3 SV=1 2 731 4.0E-89
sp|Q8DVV4|EFG_STRMU Elongation factor G OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fusA PE=3 SV=1 2 750 4.0E-89
sp|Q1GBM0|EFG_LACDA Elongation factor G OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=fusA PE=3 SV=1 2 752 4.0E-89
sp|Q6F0J4|EFG_MESFL Elongation factor G OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fusA PE=3 SV=1 2 753 5.0E-89
sp|Q1CS71|EFG_HELPH Elongation factor G OS=Helicobacter pylori (strain HPAG1) GN=fusA PE=3 SV=1 1 739 5.0E-89
sp|Q17VN9|EFG_HELAH Elongation factor G OS=Helicobacter acinonychis (strain Sheeba) GN=fusA PE=3 SV=1 1 739 5.0E-89
sp|Q6FLG2|RRF2M_CANGA Ribosome-releasing factor 2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEF2 PE=3 SV=1 1 751 6.0E-89
sp|Q04C17|EFG_LACDB Elongation factor G OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=fusA PE=3 SV=1 2 752 6.0E-89
sp|Q89J81|EFG_BRADU Elongation factor G OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fusA PE=3 SV=1 2 738 6.0E-89
sp|Q8PC52|EFG_XANCP Elongation factor G OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=fusA PE=3 SV=1 2 738 6.0E-89
sp|B0RU85|EFG_XANCB Elongation factor G OS=Xanthomonas campestris pv. campestris (strain B100) GN=fusA PE=3 SV=1 2 738 6.0E-89
sp|Q4URD6|EFG_XANC8 Elongation factor G OS=Xanthomonas campestris pv. campestris (strain 8004) GN=fusA PE=3 SV=1 2 738 6.0E-89
sp|B3QY21|EFG_CHLT3 Elongation factor G OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=fusA PE=3 SV=1 1 739 6.0E-89
sp|Q2IJ93|EFG1_ANADE Elongation factor G 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=fusA1 PE=3 SV=1 2 724 6.0E-89
sp|B2UUV6|EFG_HELPS Elongation factor G OS=Helicobacter pylori (strain Shi470) GN=fusA PE=3 SV=1 1 739 8.0E-89
sp|B2HSL2|EFG_MYCMM Elongation factor G OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fusA PE=3 SV=1 1 739 8.0E-89
sp|A1BJ37|EFG_CHLPD Elongation factor G OS=Chlorobium phaeobacteroides (strain DSM 266) GN=fusA PE=3 SV=1 1 750 9.0E-89
sp|Q250N5|EFG_DESHY Elongation factor G OS=Desulfitobacterium hafniense (strain Y51) GN=fusA PE=3 SV=1 2 739 9.0E-89
sp|A8AUR6|EFG_STRGC Elongation factor G OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=fusA PE=3 SV=1 2 750 9.0E-89
sp|Q8KTB7|EFG_RICRH Elongation factor G OS=Rickettsia rhipicephali GN=fusA PE=3 SV=1 1 739 1.0E-88
sp|C5D3R4|EFG_GEOSW Elongation factor G OS=Geobacillus sp. (strain WCH70) GN=fusA PE=3 SV=1 2 750 1.0E-88
sp|C1F645|EFG_ACIC5 Elongation factor G OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=fusA PE=3 SV=1 2 745 1.0E-88
sp|B1ZLK1|EFG_METPB Elongation factor G OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=fusA PE=3 SV=1 2 739 1.0E-88
sp|A0PM41|EFG_MYCUA Elongation factor G OS=Mycobacterium ulcerans (strain Agy99) GN=fusA PE=3 SV=1 1 739 1.0E-88
sp|Q3SSW9|EFG_NITWN Elongation factor G OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=fusA PE=3 SV=1 2 738 1.0E-88
sp|Q9SI75|EFGC_ARATH Elongation factor G, chloroplastic OS=Arabidopsis thaliana GN=CPEFG PE=1 SV=1 2 739 1.0E-88
sp|Q2KV83|EFG2_BORA1 Elongation factor G 2 OS=Bordetella avium (strain 197N) GN=fusA2 PE=3 SV=1 2 745 1.0E-88
sp|Q5YPG3|EFG_NOCFA Elongation factor G OS=Nocardia farcinica (strain IFM 10152) GN=fusA PE=3 SV=1 1 739 1.0E-88
sp|Q1LI29|EFG1_CUPMC Elongation factor G 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=fusA1 PE=3 SV=1 2 741 1.0E-88
sp|P56002|EFG_HELPY Elongation factor G OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fusA PE=3 SV=2 1 739 1.0E-88
sp|B6JN34|EFG_HELP2 Elongation factor G OS=Helicobacter pylori (strain P12) GN=fusA PE=3 SV=1 1 739 1.0E-88
sp|B2GIL1|EFG_KOCRD Elongation factor G OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=fusA PE=3 SV=1 1 750 1.0E-88
sp|Q0AXN1|EFG1_SYNWW Elongation factor G 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=fusA1 PE=3 SV=1 1 738 2.0E-88
sp|A1WHC2|EFG_VEREI Elongation factor G OS=Verminephrobacter eiseniae (strain EF01-2) GN=fusA PE=3 SV=1 2 745 2.0E-88
sp|B8G1W3|EFG_DESHD Elongation factor G OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=fusA PE=3 SV=1 2 739 2.0E-88
sp|B5Z8J0|EFG_HELPG Elongation factor G OS=Helicobacter pylori (strain G27) GN=fusA PE=3 SV=1 1 739 2.0E-88
sp|A6W5T4|EFG_KINRD Elongation factor G OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=fusA PE=3 SV=1 1 751 2.0E-88
sp|B8IS82|EFG_METNO Elongation factor G OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=fusA PE=3 SV=1 2 739 2.0E-88
sp|A8YXK3|EFG_LACH4 Elongation factor G OS=Lactobacillus helveticus (strain DPC 4571) GN=fusA PE=3 SV=1 2 752 2.0E-88
sp|A1R8V0|EFG_ARTAT Elongation factor G OS=Arthrobacter aurescens (strain TC1) GN=fusA PE=3 SV=1 1 653 2.0E-88
sp|B0SUQ6|EFG_CAUSK Elongation factor G OS=Caulobacter sp. (strain K31) GN=fusA PE=3 SV=1 2 512 2.0E-88
sp|Q07KL5|EFG_RHOP5 Elongation factor G OS=Rhodopseudomonas palustris (strain BisA53) GN=fusA PE=3 SV=1 2 738 2.0E-88
sp|A5D5I7|EFG_PELTS Elongation factor G OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=fusA PE=3 SV=1 2 741 2.0E-88
sp|A5DB27|RRF2M_PICGU Ribosome-releasing factor 2, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MEF2 PE=3 SV=2 2 742 2.0E-88
sp|A4IJI6|EFG_GEOTN Elongation factor G OS=Geobacillus thermodenitrificans (strain NG80-2) GN=fusA PE=3 SV=1 2 750 2.0E-88
sp|B8D0C1|EFG_HALOH Elongation factor G OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=fusA PE=3 SV=1 2 748 2.0E-88
sp|Q8CQ82|EFG_STAES Elongation factor G OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fusA PE=3 SV=3 2 750 2.0E-88
sp|Q5HRK5|EFG_STAEQ Elongation factor G OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fusA PE=3 SV=3 2 750 2.0E-88
sp|Q13TG7|EFG2_BURXL Elongation factor G 2 OS=Burkholderia xenovorans (strain LB400) GN=fusA2 PE=3 SV=1 2 745 3.0E-88
sp|Q03IS1|EFG_STRTD Elongation factor G OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=fusA PE=3 SV=1 2 750 3.0E-88
sp|Q5M2M6|EFG_STRT2 Elongation factor G OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=fusA PE=3 SV=1 2 750 3.0E-88
sp|Q5LY21|EFG_STRT1 Elongation factor G OS=Streptococcus thermophilus (strain CNRZ 1066) GN=fusA PE=3 SV=1 2 750 3.0E-88
sp|Q5PBH2|EFG_ANAMM Elongation factor G OS=Anaplasma marginale (strain St. Maries) GN=fusA PE=3 SV=1 2 739 3.0E-88
sp|B8I5N7|EFG_CLOCE Elongation factor G OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=fusA PE=3 SV=1 2 739 3.0E-88
sp|B9KHV3|EFG_ANAMF Elongation factor G OS=Anaplasma marginale (strain Florida) GN=fusA PE=3 SV=1 2 739 3.0E-88
sp|Q12GX4|EFG1_POLSJ Elongation factor G 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=fusA1 PE=3 SV=1 2 745 3.0E-88
sp|B6JET0|EFG_OLICO Elongation factor G OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=fusA PE=3 SV=1 2 738 3.0E-88
sp|Q9CDG1|EFG_LACLA Elongation factor G OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=fusA PE=3 SV=1 2 753 4.0E-88
sp|A6Q6I6|EFG_SULNB Elongation factor G OS=Sulfurovum sp. (strain NBC37-1) GN=fusA PE=3 SV=1 1 750 4.0E-88
sp|Q87A35|EFG_XYLFT Elongation factor G OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=fusA PE=3 SV=1 2 738 4.0E-88
sp|B2IA64|EFG_XYLF2 Elongation factor G OS=Xylella fastidiosa (strain M23) GN=fusA PE=3 SV=1 2 738 4.0E-88
sp|Q9PA90|EFG_XYLFA Elongation factor G OS=Xylella fastidiosa (strain 9a5c) GN=fusA PE=3 SV=1 2 738 5.0E-88
sp|Q5FM92|EFG_LACAC Elongation factor G OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fusA PE=3 SV=1 2 752 5.0E-88
sp|A4J108|EFG_DESRM Elongation factor G OS=Desulfotomaculum reducens (strain MI-1) GN=fusA PE=3 SV=1 2 739 5.0E-88
sp|A9WSW6|EFG_RENSM Elongation factor G OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=fusA PE=3 SV=1 1 750 5.0E-88
sp|B3QBY3|EFG_RHOPT Elongation factor G OS=Rhodopseudomonas palustris (strain TIE-1) GN=fusA PE=3 SV=1 2 738 5.0E-88
sp|Q6N4T4|EFG_RHOPA Elongation factor G OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=fusA PE=3 SV=1 2 738 5.0E-88
sp|Q046C7|EFG_LACGA Elongation factor G OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fusA PE=3 SV=1 2 752 5.0E-88
sp|Q8KTB2|EFG_RICTY Elongation factor G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fusA PE=3 SV=2 1 739 6.0E-88
sp|A4FPM8|EFG_SACEN Elongation factor G OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=fusA PE=3 SV=1 1 739 6.0E-88
sp|A8EXK1|EFG_RICCK Elongation factor G OS=Rickettsia canadensis (strain McKiel) GN=fusA PE=3 SV=1 1 739 7.0E-88
sp|Q1BRU5|EFG2_BURCA Elongation factor G 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=fusA2 PE=3 SV=1 2 745 7.0E-88
sp|Q8XV10|EFG1_RALSO Elongation factor G 1 OS=Ralstonia solanacearum (strain GMI1000) GN=fusA PE=3 SV=1 2 741 7.0E-88
sp|Q74L90|EFG_LACJO Elongation factor G OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=fusA PE=3 SV=1 2 752 7.0E-88
sp|Q1ISC5|EFG_KORVE Elongation factor G OS=Koribacter versatilis (strain Ellin345) GN=fusA PE=3 SV=1 2 745 7.0E-88
sp|B0U5X3|EFG_XYLFM Elongation factor G OS=Xylella fastidiosa (strain M12) GN=fusA PE=3 SV=1 2 738 8.0E-88
sp|A3CQM2|EFG_STRSV Elongation factor G OS=Streptococcus sanguinis (strain SK36) GN=fusA PE=3 SV=1 2 750 8.0E-88
sp|Q2GJ60|EFG_ANAPZ Elongation factor G OS=Anaplasma phagocytophilum (strain HZ) GN=fusA PE=3 SV=1 2 739 9.0E-88
sp|Q3SLQ2|EFG_THIDA Elongation factor G OS=Thiobacillus denitrificans (strain ATCC 25259) GN=fusA PE=3 SV=1 2 738 1.0E-87
sp|A5FV42|EFG_ACICJ Elongation factor G OS=Acidiphilium cryptum (strain JF-5) GN=fusA PE=3 SV=1 1 745 1.0E-87
sp|B1LWS3|EFG_METRJ Elongation factor G OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=fusA PE=3 SV=1 2 743 1.0E-87
sp|A7TQJ9|RRF2M_VANPO Ribosome-releasing factor 2, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MEF2 PE=3 SV=1 1 749 1.0E-87
sp|A5V605|EFG_SPHWW Elongation factor G OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=fusA PE=3 SV=1 2 739 1.0E-87
sp|B0TC53|EFG_HELMI Elongation factor G OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=fusA PE=3 SV=1 2 745 1.0E-87
sp|Q3A9R2|EFG_CARHZ Elongation factor G OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=fusA PE=3 SV=1 2 739 1.0E-87
sp|C0R543|EFG_WOLWR Elongation factor G OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=fusA PE=3 SV=1 2 660 1.0E-87
sp|Q73IX7|EFG_WOLPM Elongation factor G OS=Wolbachia pipientis wMel GN=fusA PE=3 SV=1 2 660 1.0E-87
sp|B4R8L3|EFG_PHEZH Elongation factor G OS=Phenylobacterium zucineum (strain HLK1) GN=fusA PE=3 SV=1 2 750 1.0E-87
sp|A2RP72|EFG_LACLM Elongation factor G OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=fusA PE=3 SV=1 2 753 1.0E-87
sp|Q5NQ66|EFG_ZYMMO Elongation factor G OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=fusA PE=3 SV=1 2 739 1.0E-87
sp|Q8D3H2|EFG_WIGBR Elongation factor G OS=Wigglesworthia glossinidia brevipalpis GN=fusA PE=3 SV=1 2 653 2.0E-87
sp|Q88XY8|EFG_LACPL Elongation factor G OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=fusA PE=3 SV=1 2 752 2.0E-87
sp|Q3A6Q0|EFG2_PELCD Elongation factor G 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=fusA2 PE=3 SV=1 2 751 2.0E-87
sp|Q1QN33|EFG_NITHX Elongation factor G OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=fusA PE=3 SV=1 2 738 2.0E-87
sp|Q2IXR3|EFG_RHOP2 Elongation factor G OS=Rhodopseudomonas palustris (strain HaA2) GN=fusA PE=3 SV=1 2 738 2.0E-87
sp|Q839G9|EFG_ENTFA Elongation factor G OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=fusA PE=3 SV=1 2 752 2.0E-87
sp|Q7W2F8|EFG1_BORPA Elongation factor G 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=fusA1 PE=3 SV=1 2 753 2.0E-87
sp|B8HVR8|EFG_CYAP4 Elongation factor G OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=fusA PE=3 SV=1 1 745 2.0E-87
sp|Q73SD2|EFG_MYCPA Elongation factor G OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=fusA PE=3 SV=1 1 739 2.0E-87
sp|A0QL36|EFG_MYCA1 Elongation factor G OS=Mycobacterium avium (strain 104) GN=fusA PE=3 SV=1 1 739 2.0E-87
sp|B0UHX2|EFG_METS4 Elongation factor G OS=Methylobacterium sp. (strain 4-46) GN=fusA PE=3 SV=1 2 739 2.0E-87
sp|C0ZIH5|EFG_BREBN Elongation factor G OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=fusA PE=3 SV=1 2 750 2.0E-87
sp|B1Y7G9|EFG_LEPCP Elongation factor G OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=fusA PE=3 SV=1 2 745 2.0E-87
sp|B4EYV7|EFG_PROMH Elongation factor G OS=Proteus mirabilis (strain HI4320) GN=fusA PE=3 SV=1 2 653 3.0E-87
sp|Q83JC3|EFG_SHIFL Elongation factor G OS=Shigella flexneri GN=fusA PE=3 SV=3 2 738 3.0E-87
sp|Q0SZX7|EFG_SHIF8 Elongation factor G OS=Shigella flexneri serotype 5b (strain 8401) GN=fusA PE=3 SV=1 2 738 3.0E-87
sp|A1TJ04|EFG_ACIAC Elongation factor G OS=Acidovorax citrulli (strain AAC00-1) GN=fusA PE=3 SV=1 2 745 3.0E-87
sp|Q30TP3|EFG_SULDN Elongation factor G OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=fusA PE=3 SV=1 1 750 3.0E-87
sp|Q4L3K8|EFG_STAHJ Elongation factor G OS=Staphylococcus haemolyticus (strain JCSC1435) GN=fusA PE=3 SV=1 2 739 3.0E-87
sp|A1KB30|EFG_AZOSB Elongation factor G OS=Azoarcus sp. (strain BH72) GN=fusA PE=3 SV=1 2 738 3.0E-87
sp|Q3YWT2|EFG_SHISS Elongation factor G OS=Shigella sonnei (strain Ss046) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|Q32B26|EFG_SHIDS Elongation factor G OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|Q31VU9|EFG_SHIBS Elongation factor G OS=Shigella boydii serotype 4 (strain Sb227) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B2U2U7|EFG_SHIB3 Elongation factor G OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B7LS46|EFG_ESCF3 Elongation factor G OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|Q1R5U3|EFG_ECOUT Elongation factor G OS=Escherichia coli (strain UTI89 / UPEC) GN=fusA PE=3 SV=3 2 738 4.0E-87
sp|B1LHE0|EFG_ECOSM Elongation factor G OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B6I240|EFG_ECOSE Elongation factor G OS=Escherichia coli (strain SE11) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|P0A6M8|EFG_ECOLI Elongation factor G OS=Escherichia coli (strain K12) GN=fusA PE=1 SV=2 2 738 4.0E-87
sp|B1IPV9|EFG_ECOLC Elongation factor G OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|P0A6M9|EFG_ECOL6 Elongation factor G OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fusA PE=3 SV=2 2 738 4.0E-87
sp|Q0TCB9|EFG_ECOL5 Elongation factor G OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fusA PE=3 SV=3 2 738 4.0E-87
sp|A1AGM7|EFG_ECOK1 Elongation factor G OS=Escherichia coli O1:K1 / APEC GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|A8A5E7|EFG_ECOHS Elongation factor G OS=Escherichia coli O9:H4 (strain HS) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B1X6J0|EFG_ECODH Elongation factor G OS=Escherichia coli (strain K12 / DH10B) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|C4ZUJ5|EFG_ECOBW Elongation factor G OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B7M1P1|EFG_ECO8A Elongation factor G OS=Escherichia coli O8 (strain IAI1) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B7N0X6|EFG_ECO81 Elongation factor G OS=Escherichia coli O81 (strain ED1a) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B7NLP5|EFG_ECO7I Elongation factor G OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B5YTP7|EFG_ECO5E Elongation factor G OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|P0A6N0|EFG_ECO57 Elongation factor G OS=Escherichia coli O157:H7 GN=fusA PE=3 SV=2 2 738 4.0E-87
sp|B7L4L1|EFG_ECO55 Elongation factor G OS=Escherichia coli (strain 55989 / EAEC) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B7MCV5|EFG_ECO45 Elongation factor G OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|B7UK50|EFG_ECO27 Elongation factor G OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|A7ZSL5|EFG_ECO24 Elongation factor G OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fusA PE=3 SV=1 2 738 4.0E-87
sp|Q39KH0|EFG1_BURL3 Elongation factor G 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=fusA1 PE=3 SV=1 2 745 4.0E-87
sp|C1DAR4|EFG_LARHH Elongation factor G OS=Laribacter hongkongensis (strain HLHK9) GN=fusA PE=3 SV=1 2 745 4.0E-87
sp|A2S7H3|EFG_BURM9 Elongation factor G OS=Burkholderia mallei (strain NCTC 10229) GN=fusA PE=3 SV=1 2 745 4.0E-87
sp|Q2SU24|EFG2_BURTA Elongation factor G 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fusA2 PE=3 SV=1 2 745 4.0E-87
sp|Q63Q08|EFG2_BURPS Elongation factor G 2 OS=Burkholderia pseudomallei (strain K96243) GN=fusA2 PE=3 SV=1 2 745 4.0E-87
sp|Q3JMR0|EFG2_BURP1 Elongation factor G 2 OS=Burkholderia pseudomallei (strain 1710b) GN=fusA2 PE=3 SV=1 2 745 4.0E-87
sp|Q62GK2|EFG2_BURMA Elongation factor G 2 OS=Burkholderia mallei (strain ATCC 23344) GN=fusA2 PE=3 SV=1 2 745 4.0E-87
sp|Q21RV5|EFG_RHOFT Elongation factor G OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=fusA PE=3 SV=1 2 745 4.0E-87
sp|B0S0I4|EFG_FINM2 Elongation factor G OS=Finegoldia magna (strain ATCC 29328) GN=fusA PE=3 SV=1 2 724 4.0E-87
sp|I1K0K6|EFGC2_SOYBN Elongation factor G-2, chloroplastic OS=Glycine max GN=fusA2 PE=3 SV=1 2 739 4.0E-87
sp|B9E8Q1|EFG_MACCJ Elongation factor G OS=Macrococcus caseolyticus (strain JCSC5402) GN=fusA PE=3 SV=1 2 739 5.0E-87
sp|B8HD12|EFG_ARTCA Elongation factor G OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=fusA PE=3 SV=1 1 653 5.0E-87
sp|C0MF25|EFG_STRS7 Elongation factor G OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=fusA PE=3 SV=1 2 750 6.0E-87
sp|C0M937|EFG_STRE4 Elongation factor G OS=Streptococcus equi subsp. equi (strain 4047) GN=fusA PE=3 SV=1 2 750 6.0E-87
sp|A4VSN3|EFG_STRSY Elongation factor G OS=Streptococcus suis (strain 05ZYH33) GN=fusA PE=3 SV=1 2 752 6.0E-87
sp|A4VYX6|EFG_STRS2 Elongation factor G OS=Streptococcus suis (strain 98HAH33) GN=fusA PE=3 SV=1 2 752 6.0E-87
sp|P34811|EFGC1_SOYBN Elongation factor G-1, chloroplastic OS=Glycine max GN=fusA1 PE=3 SV=2 2 739 6.0E-87
sp|A9B746|EFG_HERA2 Elongation factor G OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=fusA PE=3 SV=1 1 731 8.0E-87
sp|Q8K948|EFG_BUCAP Elongation factor G OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fusA PE=3 SV=1 2 657 8.0E-87
sp|A7GK17|EFG_BACCN Elongation factor G OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|B5XJR1|EFG_STRPZ Elongation factor G OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|P0DA85|EFG_STRPQ Elongation factor G OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fus PE=3 SV=1 2 750 1.0E-86
sp|Q48VB6|EFG_STRPM Elongation factor G OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|Q1J8I4|EFG_STRPF Elongation factor G OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|Q1JIM6|EFG_STRPD Elongation factor G OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|Q1JNH7|EFG_STRPC Elongation factor G OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|P69948|EFG_STRP8 Elongation factor G OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fus PE=3 SV=2 2 750 1.0E-86
sp|Q5XDW4|EFG_STRP6 Elongation factor G OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fus PE=1 SV=3 2 750 1.0E-86
sp|P0DA84|EFG_STRP3 Elongation factor G OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fus PE=3 SV=1 2 750 1.0E-86
sp|P69946|EFG_STRP1 Elongation factor G OS=Streptococcus pyogenes serotype M1 GN=fus PE=3 SV=2 2 750 1.0E-86
sp|C4KZQ0|EFG_EXISA Elongation factor G OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|B4U0V9|EFG_STREM Elongation factor G OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|Q7WRC7|EFG1_BORBR Elongation factor G 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fusA1 PE=3 SV=1 2 753 1.0E-86
sp|A5IZ33|EFG_MYCAP Elongation factor G OS=Mycoplasma agalactiae (strain PG2) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|Q8DXS7|EFG_STRA5 Elongation factor G OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|Q3JZB5|EFG_STRA1 Elongation factor G OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|Q4A703|EFG_MYCS5 Elongation factor G OS=Mycoplasma synoviae (strain 53) GN=fusA PE=3 SV=1 2 750 1.0E-86
sp|B3CTE7|EFG_ORITI Elongation factor G OS=Orientia tsutsugamushi (strain Ikeda) GN=fusA PE=3 SV=1 1 740 1.0E-86
sp|A5CF23|EFG_ORITB Elongation factor G OS=Orientia tsutsugamushi (strain Boryong) GN=fusA PE=3 SV=1 1 528 1.0E-86
sp|Q8E3E7|EFG_STRA3 Elongation factor G OS=Streptococcus agalactiae serotype III (strain NEM316) GN=fusA PE=3 SV=1 2 750 2.0E-86
sp|A2RCI2|EFG_STRPG Elongation factor G OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=fusA PE=3 SV=1 2 750 2.0E-86
sp|Q12SW2|EFG1_SHEDO Elongation factor G 1 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fusA1 PE=3 SV=1 2 716 2.0E-86
sp|Q8A474|EFG_BACTN Elongation factor G OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=fusA PE=3 SV=1 2 751 2.0E-86
sp|Q83ES7|EFG_COXBU Elongation factor G OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fusA PE=3 SV=1 2 512 2.0E-86
sp|A9NAM1|EFG_COXBR Elongation factor G OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=fusA PE=3 SV=1 2 512 2.0E-86
sp|B6J5C9|EFG_COXB1 Elongation factor G OS=Coxiella burnetii (strain CbuK_Q154) GN=fusA PE=3 SV=1 2 512 2.0E-86
sp|A6KYJ7|EFG_BACV8 Elongation factor G OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=fusA PE=3 SV=1 2 751 2.0E-86
sp|Q97EH4|EFG_CLOAB Elongation factor G OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=fusA PE=3 SV=1 1 729 2.0E-86
sp|Q123W3|EFG2_POLSJ Elongation factor G 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=fusA2 PE=3 SV=1 2 741 2.0E-86
sp|Q8R7V1|EFG_CALS4 Elongation factor G OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=fusA PE=3 SV=1 1 739 2.0E-86
sp|B5ELX6|EFG_ACIF5 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=fusA PE=3 SV=1 2 739 2.0E-86
sp|B7J464|EFG_ACIF2 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=fusA PE=3 SV=1 2 739 2.0E-86
sp|A9W4P8|EFG_METEP Elongation factor G OS=Methylobacterium extorquens (strain PA1) GN=fusA PE=3 SV=1 2 743 2.0E-86
sp|B7L0Q8|EFG_METC4 Elongation factor G OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=fusA PE=3 SV=1 2 743 2.0E-86
sp|P30767|EFG_MYCLE Elongation factor G OS=Mycobacterium leprae (strain TN) GN=fusA PE=3 SV=2 1 739 2.0E-86
sp|B8ZSC2|EFG_MYCLB Elongation factor G OS=Mycobacterium leprae (strain Br4923) GN=fusA PE=3 SV=1 1 739 2.0E-86
sp|A2SLG0|EFG_METPP Elongation factor G OS=Methylibium petroleiphilum (strain PM1) GN=fusA PE=3 SV=1 2 745 3.0E-86
sp|Q1IX68|EFG_DEIGD Elongation factor G OS=Deinococcus geothermalis (strain DSM 11300) GN=fusA PE=3 SV=1 1 717 3.0E-86
sp|B6J266|EFG_COXB2 Elongation factor G OS=Coxiella burnetii (strain CbuG_Q212) GN=fusA PE=3 SV=1 2 512 3.0E-86
sp|B9DVS2|EFG_STRU0 Elongation factor G OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=fusA PE=3 SV=1 2 750 4.0E-86
sp|A1VEB9|EFG_DESVV Elongation factor G OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=fusA PE=3 SV=1 2 752 5.0E-86
sp|Q72CI3|EFG_DESVH Elongation factor G OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=fusA PE=3 SV=1 2 752 5.0E-86
sp|B9MQH0|EFG_CALBD Elongation factor G OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=fusA PE=3 SV=1 2 739 5.0E-86
sp|Q7VTD5|EFG_BORPE Elongation factor G OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=fusA PE=3 SV=1 2 753 6.0E-86
sp|Q83NA0|EFG_TROW8 Elongation factor G OS=Tropheryma whipplei (strain TW08/27) GN=fusA PE=3 SV=1 1 750 6.0E-86
sp|Q0BYB1|EFG_HYPNA Elongation factor G OS=Hyphomonas neptunium (strain ATCC 15444) GN=fusA PE=3 SV=1 2 751 6.0E-86
sp|A9KD34|EFG_COXBN Elongation factor G OS=Coxiella burnetii (strain Dugway 5J108-111) GN=fusA PE=3 SV=1 2 512 6.0E-86
sp|B5RUN4|RRF2M_DEBHA Ribosome-releasing factor 2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MEF2 PE=3 SV=1 2 752 6.0E-86
sp|Q83FP1|EFG_TROWT Elongation factor G OS=Tropheryma whipplei (strain Twist) GN=fusA PE=3 SV=1 1 750 6.0E-86
sp|B2RLZ4|EFG_PORG3 Elongation factor G OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=fusA PE=3 SV=1 2 750 6.0E-86
sp|Q6KHS5|EFG_MYCMO Elongation factor G OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=fusA PE=3 SV=1 2 750 7.0E-86
sp|Q30Z38|EFG_DESAG Elongation factor G OS=Desulfovibrio alaskensis (strain G20) GN=fusA PE=3 SV=1 2 739 7.0E-86
sp|Q2L2H1|EFG1_BORA1 Elongation factor G 1 OS=Bordetella avium (strain 197N) GN=fusA1 PE=3 SV=1 2 753 7.0E-86
sp|P47335|EFG_MYCGE Elongation factor G OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=fusA PE=3 SV=1 1 738 8.0E-86
sp|Q2T0I7|EFG1_BURTA Elongation factor G 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fusA1 PE=3 SV=1 2 741 8.0E-86
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 2 753 1.0E-85
sp|A9VP74|EFG_BACWK Elongation factor G OS=Bacillus weihenstephanensis (strain KBAB4) GN=fusA PE=3 SV=1 2 750 1.0E-85
sp|A7HWQ8|EFG_PARL1 Elongation factor G OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=fusA PE=3 SV=1 2 739 1.0E-85
sp|Q3ILP5|EFG1_PSEHT Elongation factor G 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fusA1 PE=3 SV=1 2 724 1.0E-85
sp|C1CXH0|EFG_DEIDV Elongation factor G OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=fusA PE=3 SV=1 1 717 1.0E-85
sp|Q9Z9L7|EFG_BACHD Elongation factor G OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=fusA PE=3 SV=2 2 750 1.0E-85
sp|A9BCK1|EFG_PROM4 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9211) GN=fusA PE=3 SV=1 1 512 2.0E-85
sp|B2UYA7|EFG_CLOBA Elongation factor G OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=fusA PE=3 SV=1 1 739 2.0E-85
sp|Q39DL2|EFG2_BURL3 Elongation factor G 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=fusA2 PE=3 SV=1 2 741 2.0E-85
sp|Q5U8S9|EFG_STAIN Elongation factor G OS=Staphylococcus intermedius GN=fusA PE=3 SV=3 2 750 2.0E-85
sp|B9IZJ1|EFG_BACCQ Elongation factor G OS=Bacillus cereus (strain Q1) GN=fusA PE=3 SV=1 2 750 2.0E-85
sp|B7HQU1|EFG_BACC7 Elongation factor G OS=Bacillus cereus (strain AH187) GN=fusA PE=3 SV=1 2 750 2.0E-85
sp|A7MKJ6|EFG_CROS8 Elongation factor G OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fusA PE=3 SV=1 2 729 2.0E-85
sp|Q814C5|EFG_BACCR Elongation factor G OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fusA PE=3 SV=1 2 750 2.0E-85
sp|B7HJ45|EFG_BACC4 Elongation factor G OS=Bacillus cereus (strain B4264) GN=fusA PE=3 SV=1 2 750 2.0E-85
sp|Q88QN8|EFG1_PSEPK Elongation factor G 1 OS=Pseudomonas putida (strain KT2440) GN=fusA PE=3 SV=1 2 494 2.0E-85
sp|Q089Q7|EFG1_SHEFN Elongation factor G 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=fusA1 PE=3 SV=1 2 731 2.0E-85
sp|A1SNN6|EFG_NOCSJ Elongation factor G OS=Nocardioides sp. (strain BAA-499 / JS614) GN=fusA PE=3 SV=1 1 751 2.0E-85
sp|Q2RQV7|EFG_RHORT Elongation factor G OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=fusA PE=3 SV=1 2 747 2.0E-85
sp|Q8FS85|EFG_COREF Elongation factor G OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=fusA PE=3 SV=2 1 739 2.0E-85
sp|B2A4D6|EFG_NATTJ Elongation factor G OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=fusA PE=3 SV=1 2 748 2.0E-85
sp|Q63H93|EFG_BACCZ Elongation factor G OS=Bacillus cereus (strain ZK / E33L) GN=fusA PE=3 SV=1 2 750 2.0E-85
sp|Q13UU8|EFG1_BURXL Elongation factor G 1 OS=Burkholderia xenovorans (strain LB400) GN=fusA1 PE=3 SV=1 2 741 2.0E-85
sp|Q7MTL1|EFG_PORGI Elongation factor G OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=fusA PE=3 SV=1 2 750 2.0E-85
sp|Q73F99|EFG_BACC1 Elongation factor G OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=fusA PE=3 SV=1 2 750 3.0E-85
sp|A6T3K7|EFG_JANMA Elongation factor G OS=Janthinobacterium sp. (strain Marseille) GN=fusA PE=3 SV=1 2 745 3.0E-85
sp|Q6HPR1|EFG_BACHK Elongation factor G OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=fusA PE=3 SV=1 2 750 3.0E-85
sp|C1ET36|EFG_BACC3 Elongation factor G OS=Bacillus cereus (strain 03BB102) GN=fusA PE=3 SV=1 2 750 3.0E-85
sp|Q81VT3|EFG_BACAN Elongation factor G OS=Bacillus anthracis GN=fusA PE=3 SV=1 2 750 3.0E-85
sp|C3P9Q2|EFG_BACAA Elongation factor G OS=Bacillus anthracis (strain A0248) GN=fusA PE=3 SV=1 2 750 3.0E-85
sp|Q03PV4|EFG_LACBA Elongation factor G OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=fusA PE=3 SV=1 2 752 3.0E-85
sp|A6TWI5|EFG_ALKMQ Elongation factor G OS=Alkaliphilus metalliredigens (strain QYMF) GN=fusA PE=3 SV=1 2 739 3.0E-85
sp|A4G9U1|EFG_HERAR Elongation factor G OS=Herminiimonas arsenicoxydans GN=fusA PE=3 SV=1 2 745 3.0E-85
sp|C3LJ79|EFG_BACAC Elongation factor G OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=fusA PE=3 SV=1 2 750 3.0E-85
sp|B7IT16|EFG_BACC2 Elongation factor G OS=Bacillus cereus (strain G9842) GN=fusA PE=3 SV=1 2 750 4.0E-85
sp|Q8EX19|EFG_MYCPE Elongation factor G OS=Mycoplasma penetrans (strain HF-2) GN=fusA PE=3 SV=1 1 729 4.0E-85
sp|Q8EK71|EFG1_SHEON Elongation factor G 1 OS=Shewanella oneidensis (strain MR-1) GN=fusA PE=3 SV=1 2 731 4.0E-85
sp|Q98QD8|EFG_MYCPU Elongation factor G OS=Mycoplasma pulmonis (strain UAB CTIP) GN=fusA PE=3 SV=2 2 731 4.0E-85
sp|O83464|EFG2_TREPA Elongation factor G 2 OS=Treponema pallidum (strain Nichols) GN=fusB PE=3 SV=1 1 654 4.0E-85
sp|A5USJ2|EFG_ROSS1 Elongation factor G OS=Roseiflexus sp. (strain RS-1) GN=fusA PE=3 SV=1 1 653 4.0E-85
sp|A4XI36|EFG_CALS8 Elongation factor G OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=fusA PE=3 SV=1 2 739 5.0E-85
sp|B1HMZ1|EFG_LYSSC Elongation factor G OS=Lysinibacillus sphaericus (strain C3-41) GN=fusA PE=3 SV=1 2 750 5.0E-85
sp|C0QQM0|EFG_PERMH Elongation factor G OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=fusA PE=3 SV=1 1 739 5.0E-85
sp|B7JKB6|EFG_BACC0 Elongation factor G OS=Bacillus cereus (strain AH820) GN=fusA PE=3 SV=1 2 750 6.0E-85
sp|Q64NK6|EFG_BACFR Elongation factor G OS=Bacteroides fragilis (strain YCH46) GN=fusA PE=3 SV=1 2 751 8.0E-85
sp|Q5L8A7|EFG_BACFN Elongation factor G OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=fusA PE=3 SV=1 2 751 8.0E-85
sp|P09952|EFG_MICLU Elongation factor G OS=Micrococcus luteus GN=fusA PE=3 SV=1 1 750 1.0E-84
sp|Q48D33|EFG_PSE14 Elongation factor G OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fusA PE=3 SV=1 2 654 1.0E-84
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6788 0.7108 0.0791 0.0153 0.2402 0.0555 0.0196 0.1929 0.1706 0.1311

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup5974
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|071220
Agaricus bisporus var bisporus H97 AgabiH97|071220 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|31_7

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071220
MRNMALVAHIDSGKTTLTESILYTSSYLTASGTVDTGSTTTDFLPVERERGITVQSASIPVQWKDWTFNLIDTPG
HADFGMEVESASRVVDGAVVLIDSVEGVEAQTKGVWTQLNRYDVASKLVFLNKMDRPGASFNAALSSILSNRLHP
QPLPLIIPIASFDASAYRQAEPGIHGLVDLVKWELWRWDDENKASVEALPRTLEGVVNLFEANHPIPSHLVTART
QFLDNLSMHSEELMETLLGLPSVPDAYLGVKSAQILPHLRQASLSNTILPVLCGSAIRHIGTELVLDYAGELLAS
PLDIPHDSQNSNAPLRVLAWKVVWDSRKGWMTFVRVYSGKLTRQSKLLNTNRNQKEAISKLMLLYASDFQEVDHL
PFGAVGVIIGLKHTRTGDTLISANAPTSGRSVMRDITPPPTVIASSVIPQSHADFGPVQNALESLARTDPSVRLD
MQEGQLLVHGLGALHLEIVEGRLRNEWNVNFEFGKRRVSYRESLGPGEPAPGWDTWNADMGGGKRVSVEVPLLVR
PLESSEKGDPVWDGNRILDPRGRPVPAPESVPTGPLAYIAQGIASALSSSLHSSLAMTHICIQIPKEALSIQATP
AVLTGATAGVLRQLFRAAGPGPINEPYIRLKANVLESHLGKVIRDLTEHGGEILELGTGSTAADDEGGGAYSAEG
IYLPPIWLTPSATDNSLRSSSSKIKRAIYGLAPLSQFLDYSQRLRALSEGHGTFEIMTAGFKEVSDPRRVEILRE
IGKL*
Coding >AgabiH97|071220
ATGCGTAATATGGCACTGGTTGCCCACATAGACTCTGGAAAAACCACTCTCACGGAATCAATATTGTATACTTCA
TCATACTTAACGGCGTCTGGCACGGTTGATACCGGAAGTACGACTACAGACTTTCTTCCAGTAGAACGGGAACGA
GGAATTACTGTTCAGTCGGCGAGTATACCCGTGCAATGGAAAGACTGGACCTTCAATCTTATAGACACGCCGGGA
CACGCTGACTTCGGAATGGAAGTGGAAAGTGCCAGTCGTGTTGTAGATGGTGCGGTGGTTTTAATAGACTCCGTT
GAAGGTGTCGAGGCCCAGACAAAAGGTGTTTGGACACAGCTTAACAGATATGATGTCGCGAGCAAACTTGTCTTC
CTTAATAAGATGGATCGCCCTGGAGCCTCATTCAACGCCGCTCTCTCGTCTATTCTTTCAAATCGACTTCATCCT
CAACCTTTGCCTCTAATTATACCAATCGCGTCTTTTGATGCGTCGGCCTATCGGCAAGCAGAACCTGGCATTCAT
GGTCTCGTTGATCTAGTCAAATGGGAGCTATGGCGATGGGATGACGAGAATAAGGCTTCTGTCGAGGCCCTACCG
CGGACGCTTGAGGGTGTGGTTAACCTTTTCGAAGCCAATCATCCCATCCCATCCCATCTCGTTACTGCCCGAACT
CAGTTCTTGGACAATCTTTCTATGCATTCTGAGGAACTTATGGAGACATTACTTGGCTTACCTTCCGTTCCAGAT
GCATACCTTGGCGTCAAGAGTGCACAAATTCTACCCCACCTTCGACAGGCATCCCTTAGTAATACCATCCTGCCA
GTTCTCTGTGGTTCTGCCATTCGTCACATCGGCACGGAGCTGGTTTTGGATTATGCTGGCGAACTTCTTGCGAGC
CCGCTAGACATTCCTCACGATTCCCAAAACTCTAATGCTCCTTTGCGAGTACTTGCTTGGAAGGTTGTCTGGGAT
TCAAGGAAAGGTTGGATGACATTTGTCCGTGTATATTCCGGAAAATTAACGCGTCAAAGTAAACTTCTAAACACT
AATCGAAATCAGAAGGAAGCTATCTCCAAACTCATGCTTCTTTACGCTTCGGACTTCCAAGAGGTGGATCACCTA
CCATTCGGTGCAGTAGGTGTAATCATTGGCCTCAAACACACCCGGACTGGCGATACTCTGATATCTGCTAATGCA
CCTACATCTGGCCGTTCTGTTATGCGTGATATTACCCCACCGCCTACCGTCATTGCCTCTTCTGTCATTCCTCAA
TCCCATGCCGATTTTGGACCAGTACAAAATGCTTTGGAATCGCTGGCGCGCACCGATCCTTCAGTCCGCTTGGAC
ATGCAGGAGGGACAGCTATTGGTCCATGGACTTGGGGCATTACACCTTGAAATTGTCGAAGGACGACTTCGGAAC
GAATGGAATGTCAATTTTGAATTTGGGAAAAGAAGGGTTAGCTATCGAGAAAGTCTTGGACCTGGTGAGCCCGCT
CCAGGATGGGACACTTGGAATGCTGATATGGGTGGTGGAAAGCGTGTTTCGGTAGAGGTACCCTTGCTCGTGCGT
CCCCTGGAAAGCAGTGAGAAAGGTGATCCCGTATGGGACGGGAACCGAATCCTCGATCCCAGAGGTAGGCCAGTG
CCAGCACCAGAGTCTGTACCGACCGGACCACTTGCATACATCGCGCAGGGCATTGCAAGTGCTCTTTCCAGCTCA
CTGCACTCGTCGCTTGCTATGACGCATATATGCATCCAGATTCCCAAAGAGGCATTATCCATACAAGCGACACCT
GCAGTATTGACCGGAGCGACAGCGGGAGTTCTTCGACAACTCTTCCGTGCCGCCGGGCCTGGACCAATTAACGAA
CCTTATATTCGACTCAAGGCTAACGTACTGGAAAGTCATCTCGGGAAGGTTATTCGCGATCTCACTGAGCATGGA
GGAGAGATACTGGAACTGGGTACAGGATCCACAGCTGCGGACGATGAAGGTGGCGGCGCATATTCTGCCGAGGGT
ATTTATCTACCACCTATATGGTTGACGCCATCTGCGACGGACAACTCGTTGAGATCGTCATCTTCGAAAATTAAA
CGTGCCATTTATGGCTTAGCGCCTCTCAGCCAATTCTTGGACTATTCTCAACGCTTACGTGCTCTTTCTGAAGGA
CATGGTACCTTTGAGATAATGACAGCAGGGTTCAAGGAGGTCTCGGACCCTAGGCGAGTGGAGATCCTCCGAGAA
ATTGGCAAGTTATGA
Transcript >AgabiH97|071220
ATGCGTAATATGGCACTGGTTGCCCACATAGACTCTGGAAAAACCACTCTCACGGAATCAATATTGTATACTTCA
TCATACTTAACGGCGTCTGGCACGGTTGATACCGGAAGTACGACTACAGACTTTCTTCCAGTAGAACGGGAACGA
GGAATTACTGTTCAGTCGGCGAGTATACCCGTGCAATGGAAAGACTGGACCTTCAATCTTATAGACACGCCGGGA
CACGCTGACTTCGGAATGGAAGTGGAAAGTGCCAGTCGTGTTGTAGATGGTGCGGTGGTTTTAATAGACTCCGTT
GAAGGTGTCGAGGCCCAGACAAAAGGTGTTTGGACACAGCTTAACAGATATGATGTCGCGAGCAAACTTGTCTTC
CTTAATAAGATGGATCGCCCTGGAGCCTCATTCAACGCCGCTCTCTCGTCTATTCTTTCAAATCGACTTCATCCT
CAACCTTTGCCTCTAATTATACCAATCGCGTCTTTTGATGCGTCGGCCTATCGGCAAGCAGAACCTGGCATTCAT
GGTCTCGTTGATCTAGTCAAATGGGAGCTATGGCGATGGGATGACGAGAATAAGGCTTCTGTCGAGGCCCTACCG
CGGACGCTTGAGGGTGTGGTTAACCTTTTCGAAGCCAATCATCCCATCCCATCCCATCTCGTTACTGCCCGAACT
CAGTTCTTGGACAATCTTTCTATGCATTCTGAGGAACTTATGGAGACATTACTTGGCTTACCTTCCGTTCCAGAT
GCATACCTTGGCGTCAAGAGTGCACAAATTCTACCCCACCTTCGACAGGCATCCCTTAGTAATACCATCCTGCCA
GTTCTCTGTGGTTCTGCCATTCGTCACATCGGCACGGAGCTGGTTTTGGATTATGCTGGCGAACTTCTTGCGAGC
CCGCTAGACATTCCTCACGATTCCCAAAACTCTAATGCTCCTTTGCGAGTACTTGCTTGGAAGGTTGTCTGGGAT
TCAAGGAAAGGTTGGATGACATTTGTCCGTGTATATTCCGGAAAATTAACGCGTCAAAGTAAACTTCTAAACACT
AATCGAAATCAGAAGGAAGCTATCTCCAAACTCATGCTTCTTTACGCTTCGGACTTCCAAGAGGTGGATCACCTA
CCATTCGGTGCAGTAGGTGTAATCATTGGCCTCAAACACACCCGGACTGGCGATACTCTGATATCTGCTAATGCA
CCTACATCTGGCCGTTCTGTTATGCGTGATATTACCCCACCGCCTACCGTCATTGCCTCTTCTGTCATTCCTCAA
TCCCATGCCGATTTTGGACCAGTACAAAATGCTTTGGAATCGCTGGCGCGCACCGATCCTTCAGTCCGCTTGGAC
ATGCAGGAGGGACAGCTATTGGTCCATGGACTTGGGGCATTACACCTTGAAATTGTCGAAGGACGACTTCGGAAC
GAATGGAATGTCAATTTTGAATTTGGGAAAAGAAGGGTTAGCTATCGAGAAAGTCTTGGACCTGGTGAGCCCGCT
CCAGGATGGGACACTTGGAATGCTGATATGGGTGGTGGAAAGCGTGTTTCGGTAGAGGTACCCTTGCTCGTGCGT
CCCCTGGAAAGCAGTGAGAAAGGTGATCCCGTATGGGACGGGAACCGAATCCTCGATCCCAGAGGTAGGCCAGTG
CCAGCACCAGAGTCTGTACCGACCGGACCACTTGCATACATCGCGCAGGGCATTGCAAGTGCTCTTTCCAGCTCA
CTGCACTCGTCGCTTGCTATGACGCATATATGCATCCAGATTCCCAAAGAGGCATTATCCATACAAGCGACACCT
GCAGTATTGACCGGAGCGACAGCGGGAGTTCTTCGACAACTCTTCCGTGCCGCCGGGCCTGGACCAATTAACGAA
CCTTATATTCGACTCAAGGCTAACGTACTGGAAAGTCATCTCGGGAAGGTTATTCGCGATCTCACTGAGCATGGA
GGAGAGATACTGGAACTGGGTACAGGATCCACAGCTGCGGACGATGAAGGTGGCGGCGCATATTCTGCCGAGGGT
ATTTATCTACCACCTATATGGTTGACGCCATCTGCGACGGACAACTCGTTGAGATCGTCATCTTCGAAAATTAAA
CGTGCCATTTATGGCTTAGCGCCTCTCAGCCAATTCTTGGACTATTCTCAACGCTTACGTGCTCTTTCTGAAGGA
CATGGTACCTTTGAGATAATGACAGCAGGGTTCAAGGAGGTCTCGGACCCTAGGCGAGTGGAGATCCTCCGAGAA
ATTGGCAAGTTATGA
Gene >AgabiH97|071220
ATGCGTAATATGGCACTGGTTGCCCACATAGGTATGATTTTCTTGGCCTGCGGGCAGGCACTTCGGCTCAAGGTC
TCAATCGTGCAGACTCTGGAAAAACCACTCTCACGGAATCAATATTGTATACTTCATCATACTTAACGGCGTCTG
GCACGGTTGATACCGGAAGTACGACTACAGACTTTCTTCCAGTAGAACGGGAACGAGGAATTACTGTTCAGTCGG
CGAGTATACCCGTGCAATGGAAAGACTGGACCTTCAATCTTATAGACACGCCGGGACACGCTGACTTCGGAATGG
AAGTGGAAAGTGCCAGTCGTGTTGTAGATGGTGCGGTGGTTTTAATAGACTCCGTTGAAGGTGTCGAGGCCCAGA
CAAAAGGTGTTTGGACACAGCTTAACAGGTCAGAGCTGCGTGTTCCCCCCTCGCGAAAGGGTGAACTGACACTTC
GTCCAAAGATATGATGTCGCGAGCAAACTTGTCTTCCTTAATAAGATGGATCGCCCTGGAGCCTCATTCAACGCC
GCTCTCTCGTCTATTCTTTCAAATCGACTTCATCCTCAACCTTTGCCTCTAATTATACCAATCGCGTCTTTTGAT
GCGTCGGCCTATCGGCAAGCAGAACCTGGCATTCATGGTCTCGTTGATCTAGTCAAATGGGAGCTATGGCGATGG
GATGACGAGAATAAGGCTTCTGTCGAGGCCCTACCGCGGACGCTTGAGGGTGTGGTTAACCTTTTCGAAGCCAAT
CATCCCATCCCATCCCATCTCGTTACTGCCCGAACTCAGTTCTTGGACAATCTTTCTATGCATTCTGAGGAACTT
ATGGAGACATTACTTGGCTTACCTTCCGTTCCAGATGCATACCTTGGCGTCAAGAGTGCACAAATTCTACCCCAC
CTTCGACAGGCATCCCTTAGTAATACCATCCTGCCAGTTCTCTGTGGTTCTGCCATTCGTCACATCGGCACGGAG
CTGGTTTTGGATTATGCTGGCGAACTTCTTGCGAGCCCGCTAGACATTCCTCACGATTCCCAAAACTCTAATGCT
CCTTTGCGAGTACTTGCTTGGAAGGTTGTCTGGGATTCAAGGAAAGGTTGGATGACATTTGTCCGTGTATATTCC
GGTGCGTACGATTATTGGTGACTTGCAACAGATTTCACCTCATGCAGATACAAAGGAAAATTAACGCGTCAAAGT
AAACTTCTAAACACTAATCGAAATCAGAAGGAAGCTATCTCCAAACTCATGCTTCTTTACGCTTCGGACTTCCAA
GAGGTGGATCACCTACCATTCGGTGCAGTAGGTGTAATCATTGGCCTCAAACACACCCGGACTGGCGATACTCTG
ATATCTGCTAATGCACCTACATCTGGCCGTTCTGTTATGCGTGATATTACCCCACCGCCTACCGTCATTGCCTCT
TCTGTCATTCCTCAATCCCATGCCGATTTTGGACCAGTACAAAATGCTTTGGAATCGCTGGCGCGCACCGATCCT
TCAGTCCGCTTGGACATGCAGGAGGGACAGCTATTGGTCCATGGACTTGGGGCATTACACCTTGAAATTGTCGAA
GGACGACTTCGGAACGAATGGAATGTCAATTTTGAATTTGGGAAAAGAAGGGTTAGCTATCGAGAAAGTCTTGGA
CCTGGTGAGCCCGCTCCAGGATGGGACACTTGGAATGCTGATATGGGTGGTGGAAAGCGTGTTTCGGTAGAGGTA
CCCTTGCTCGTGCGTCCCCTGGAAAGCAGTGAGAAAGGTGATCCCGTATGGGACGGGAACCGAATCCTCGATCCC
AGAGGTAGGCCAGTGCCAGCACCAGAGTCTGTACCGACCGGACCACTTGCATACATCGCGCAGGGCATTGCAAGT
GCTCTTTCCAGCTCACTGCACTCGTCGCTTGCTATGACGCATATATGCATCCAGATTCCCAAAGAGGCATTATCC
ATACAAGCGACACCTGCAGTATTGACCGGAGCGACAGCGGGAGTTCTTCGACAACTCTTCCGTGCCGCCGGGCCT
GGACCAATTAACGAACCTTATATTCGACTCAAGGCTAACGTACTGGAAAGTCATCTCGGGAAGGTTATTCGCGAT
CTCACTGAGCATGGAGGAGAGATACTGGAACTGGGTACAGGATCCACAGCTGCGGACGATGAAGGTGGCGGCGCA
TATTCTGCCGAGGGTATTTATCTACCACCTATATGGTTGACGCCATCTGCGACGGACAACTCGTTGAGATCGTCA
TCTTCGAAAATTAAACGTGCCATTTATGGCTTAGCGCCTCTCAGCCAATTCTTGGACTATTCTCAACGCTTACGT
GCTCTTTCTGAAGGACATGGTACCTTTGAGATAATGACAGCAGGGTTCAAGGAGGTCTCGGACCCTAGGCGAGTG
GAGATCCTCCGAGAAATTGGCAAGTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail