Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|071040
Gene name
Locationscaffold_4:1412576..1413879
Strand-
Gene length (bp)1303
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 5.3E-09 11 84
PF05368 NmrA NmrA-like family 4.4E-08 9 79

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7K4|YGI2_SCHPO Uncharacterized protein C2A9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.02 PE=3 SV=1 5 323 3.0E-13

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6793 0.3351 0.2087 0.0439 0.2537 0.0067 0.0215 0.1156 0.0821 0.0736

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 0.85 0.12 1.58
Initials Initials knots 1.16 0.28 2.03
Pileal_Stipeal_center Stage I stipe center 0.62 0.07 1.17
Pileal_Stipeal_shell Stage I stipe shell 0.36 0.00 0.76
DIF_stipe_center Stage II stipe center 0.57 0.04 1.10
DIF_stipe_shell Stage II stipe shell 0.69 0.09 1.29
DIF_stipe_skin Stage II stipe skin 1.07 0.24 1.89
DIF_cap_skin Stage II cap skin 0.32 0.00 0.67
DIF_cap_tissue Stage II cap tissue 0.57 0.05 1.09
DIF_gill_tissue Stage II gill tissue 0.56 0.04 1.09
YFB_stipe_center Young fruiting body stipe center 0.69 0.10 1.29
YFB_stipe_shell Young fruiting body stipe shell 0.71 0.10 1.32
YFB_stipe_skin Young fruiting body stipe skin 0.72 0.11 1.34
YFB_cap_skin Young fruiting body cap skin 0.59 0.06 1.12
YFB_cap_tissue Young fruiting body cap tissue 0.43 0.00 0.86
YFB_gill_tissue Young fruiting body gill tissue 0.90 0.15 1.64
YFB_veil Young fruiting body veil 0.63 0.07 1.20

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.637240 no
Casing YFB_stipe_center 0.846437 no
Casing YFB_stipe_shell 0.865135 no
Casing YFB_stipe_skin 0.884007 no
Casing YFB_cap_skin 0.692917 no
Casing YFB_cap_tissue 0.391120 no
Casing YFB_gill_tissue 0.960825 no
Casing YFB_veil 0.765110 no
Casing Initials 0.708320 no
Casing Pileal_Stipeal_center 0.742594 no
Casing Pileal_Stipeal_shell 0.289287 no
Casing DIF_stipe_center 0.652111 no
Casing DIF_stipe_shell 0.840476 no
Casing DIF_stipe_skin 0.801561 no
Casing DIF_cap_skin 0.202801 no
Casing DIF_cap_tissue 0.650162 no
DIF_gill_tissue YFB_stipe_center 0.839294 no
DIF_gill_tissue YFB_stipe_shell 0.821596 no
DIF_gill_tissue YFB_stipe_skin 0.800333 no
DIF_gill_tissue YFB_cap_skin 0.970092 no
DIF_gill_tissue YFB_cap_tissue 0.793025 no
DIF_gill_tissue YFB_gill_tissue 0.549599 no
DIF_gill_tissue YFB_veil 0.924354 no
YFB_stipe_center YFB_stipe_shell 0.988848 no
YFB_stipe_center YFB_stipe_skin 0.969994 no
YFB_stipe_center YFB_cap_skin 0.883721 no
YFB_stipe_center YFB_cap_tissue 0.567950 no
YFB_stipe_center YFB_gill_tissue 0.775397 no
YFB_stipe_center YFB_veil 0.938595 no
YFB_stipe_shell YFB_stipe_skin 0.988487 no
YFB_stipe_shell YFB_cap_skin 0.862635 no
YFB_stipe_shell YFB_cap_tissue 0.549967 no
YFB_stipe_shell YFB_gill_tissue 0.800369 no
YFB_stipe_shell YFB_veil 0.921595 no
YFB_stipe_skin YFB_cap_skin 0.844618 no
YFB_stipe_skin YFB_cap_tissue 0.524330 no
YFB_stipe_skin YFB_gill_tissue 0.819501 no
YFB_stipe_skin YFB_veil 0.904184 no
YFB_cap_skin YFB_cap_tissue 0.755160 no
YFB_cap_skin YFB_gill_tissue 0.613898 no
YFB_cap_skin YFB_veil 0.956097 no
YFB_cap_tissue YFB_gill_tissue 0.308718 no
YFB_cap_tissue YFB_veil 0.689158 no
YFB_gill_tissue YFB_veil 0.689330 no
Initials DIF_gill_tissue 0.277198 no
Initials YFB_stipe_center 0.461539 no
Initials YFB_stipe_shell 0.482625 no
Initials YFB_stipe_skin 0.506395 no
Initials YFB_cap_skin 0.313067 no
Initials YFB_cap_tissue 0.138008 no
Initials YFB_gill_tissue 0.763722 no
Initials YFB_veil 0.381882 no
Initials Pileal_Stipeal_center 0.361779 no
Initials Pileal_Stipeal_shell 0.115346 no
Initials DIF_stipe_center 0.271359 no
Initials DIF_stipe_shell 0.449437 no
Initials DIF_stipe_skin 0.936334 no
Initials DIF_cap_skin 0.074840 no
Initials DIF_cap_tissue 0.280761 no
Pileal_Stipeal_center DIF_gill_tissue 0.940504 no
Pileal_Stipeal_center YFB_stipe_center 0.920818 no
Pileal_Stipeal_center YFB_stipe_shell 0.903887 no
Pileal_Stipeal_center YFB_stipe_skin 0.886499 no
Pileal_Stipeal_center YFB_cap_skin 0.969078 no
Pileal_Stipeal_center YFB_cap_tissue 0.708106 no
Pileal_Stipeal_center YFB_gill_tissue 0.662908 no
Pileal_Stipeal_center YFB_veil 0.988700 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.565299 no
Pileal_Stipeal_center DIF_stipe_center 0.943212 no
Pileal_Stipeal_center DIF_stipe_shell 0.924498 no
Pileal_Stipeal_center DIF_stipe_skin 0.443652 no
Pileal_Stipeal_center DIF_cap_skin 0.448408 no
Pileal_Stipeal_center DIF_cap_tissue 0.949175 no
Pileal_Stipeal_shell DIF_gill_tissue 0.655633 no
Pileal_Stipeal_shell YFB_stipe_center 0.433061 no
Pileal_Stipeal_shell YFB_stipe_shell 0.419933 no
Pileal_Stipeal_shell YFB_stipe_skin 0.383882 no
Pileal_Stipeal_shell YFB_cap_skin 0.610621 no
Pileal_Stipeal_shell YFB_cap_tissue 0.901349 no
Pileal_Stipeal_shell YFB_gill_tissue 0.238427 no
Pileal_Stipeal_shell YFB_veil 0.548092 no
Pileal_Stipeal_shell DIF_stipe_center 0.648699 no
Pileal_Stipeal_shell DIF_stipe_shell 0.434709 no
Pileal_Stipeal_shell DIF_stipe_skin 0.148373 no
Pileal_Stipeal_shell DIF_cap_skin 0.942038 no
Pileal_Stipeal_shell DIF_cap_tissue 0.642998 no
DIF_stipe_center DIF_gill_tissue 0.986598 no
DIF_stipe_center YFB_stipe_center 0.841831 no
DIF_stipe_center YFB_stipe_shell 0.817880 no
DIF_stipe_center YFB_stipe_skin 0.799017 no
DIF_stipe_center YFB_cap_skin 0.974498 no
DIF_stipe_center YFB_cap_tissue 0.788337 no
DIF_stipe_center YFB_gill_tissue 0.549300 no
DIF_stipe_center YFB_veil 0.929180 no
DIF_stipe_center DIF_stipe_shell 0.845129 no
DIF_stipe_center DIF_stipe_skin 0.337581 no
DIF_stipe_center DIF_cap_skin 0.519406 no
DIF_stipe_center DIF_cap_tissue 0.986433 no
DIF_stipe_shell DIF_gill_tissue 0.849518 no
DIF_stipe_shell YFB_stipe_center 0.988465 no
DIF_stipe_shell YFB_stipe_shell 0.985551 no
DIF_stipe_shell YFB_stipe_skin 0.968041 no
DIF_stipe_shell YFB_cap_skin 0.888421 no
DIF_stipe_shell YFB_cap_tissue 0.572924 no
DIF_stipe_shell YFB_gill_tissue 0.773222 no
DIF_stipe_shell YFB_veil 0.941956 no
DIF_stipe_shell DIF_stipe_skin 0.546018 no
DIF_stipe_shell DIF_cap_skin 0.324781 no
DIF_stipe_shell DIF_cap_tissue 0.857572 no
DIF_stipe_skin DIF_gill_tissue 0.350412 no
DIF_stipe_skin YFB_stipe_center 0.556534 no
DIF_stipe_skin YFB_stipe_shell 0.575445 no
DIF_stipe_skin YFB_stipe_skin 0.602832 no
DIF_stipe_skin YFB_cap_skin 0.396350 no
DIF_stipe_skin YFB_cap_tissue 0.174105 no
DIF_stipe_skin YFB_gill_tissue 0.849797 no
DIF_stipe_skin YFB_veil 0.475630 no
DIF_stipe_skin DIF_cap_skin 0.095962 no
DIF_stipe_skin DIF_cap_tissue 0.358057 no
DIF_cap_skin DIF_gill_tissue 0.533406 no
DIF_cap_skin YFB_stipe_center 0.327839 no
DIF_cap_skin YFB_stipe_shell 0.307771 no
DIF_cap_skin YFB_stipe_skin 0.288491 no
DIF_cap_skin YFB_cap_skin 0.492647 no
DIF_cap_skin YFB_cap_tissue 0.817817 no
DIF_cap_skin YFB_gill_tissue 0.159459 no
DIF_cap_skin YFB_veil 0.432777 no
DIF_cap_skin DIF_cap_tissue 0.523975 no
DIF_cap_tissue DIF_gill_tissue 0.987140 no
DIF_cap_tissue YFB_stipe_center 0.850766 no
DIF_cap_tissue YFB_stipe_shell 0.828665 no
DIF_cap_tissue YFB_stipe_skin 0.809920 no
DIF_cap_tissue YFB_cap_skin 0.980444 no
DIF_cap_tissue YFB_cap_tissue 0.781981 no
DIF_cap_tissue YFB_gill_tissue 0.563298 no
DIF_cap_tissue YFB_veil 0.931899 no

Orthologs

Orthofinder run ID1
Orthogroup152
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|071030
Agaricus bisporus var bisporus H39 AgabiH39|071040
Agaricus bisporus var bisporus H39 AgabiH39|083920
Agaricus bisporus var bisporus H97 AgabiH97|071030
Agaricus bisporus var bisporus H97 AgabiH97|071040 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|083920
Rhodonia placenta FPRL280 RhoplFPRL280|233_5
Rhodonia placenta FPRL280 RhoplFPRL280|287_8
Rhodonia placenta FPRL280 RhoplFPRL280|335_4
Rhodonia placenta FPRL280 RhoplFPRL280|335_6
Rhodonia placenta FPRL280 RhoplFPRL280|335_7
Rhodonia placenta FPRL280 RhoplFPRL280|509_3
Rhodonia placenta FPRL280 RhoplFPRL280|594_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|071040
MSSTLKFFFIGATGYVGSSVLERFLDHPEANNFEFTALVRDPRKAEKLKQFGVNAVVGSFDDAKLVEDLTAAADI
VVDMGGSDNLGLAKSTLRGFQRKFQETGKPSIFIHTSGTIIIADDATGLHSSDVVWNDADPDQIEQLPPTAPHID
VELEIIRADKEGYVRAYFVTPGTIYGIASGKFVDAGLANKHSIQVPALIKTSLDRGQAGMIGKGLNIWPNVHIDE
AADFYIDLYNAIKANPDSVGHGRDGFYFLLNGEHSLYDVGKEIGRALVALGKVTTEVPSTYTQEEVNKYFGGSNF
LGTNSRGLANHSKSIGWKPKKTTQDLMASIKPEVEEILKHL*
Coding >AgabiH97|071040
ATGTCTTCTACCCTCAAATTCTTTTTCATCGGTGCTACTGGCTACGTCGGCAGCTCTGTTCTAGAGCGCTTCCTT
GATCATCCGGAGGCCAATAATTTCGAATTTACTGCCCTTGTTAGAGACCCTCGGAAAGCGGAAAAATTGAAGCAA
TTCGGCGTAAACGCCGTTGTCGGTTCTTTTGATGATGCTAAGCTCGTCGAGGACTTGACTGCCGCTGCGGACATC
GTGGTTGACATGGGAGGCTCAGATAATCTCGGACTTGCCAAAAGTACACTTCGCGGCTTCCAAAGAAAGTTCCAA
GAAACAGGAAAACCTTCAATTTTTATTCACACCTCCGGAACCATCATCATAGCCGATGATGCAACGGGTCTTCAT
TCTTCTGATGTCGTCTGGAACGATGCCGATCCTGACCAGATAGAGCAACTGCCACCAACTGCACCCCATATCGAC
GTAGAATTGGAGATCATCCGGGCCGATAAGGAGGGTTACGTTCGCGCTTACTTCGTGACTCCCGGCACAATATAT
GGAATTGCCTCTGGAAAGTTCGTAGATGCCGGTCTCGCTAATAAGCATTCTATTCAGGTACCTGCCCTCATCAAG
ACCTCGCTTGACAGAGGACAGGCTGGGATGATCGGTAAGGGATTGAACATCTGGCCAAACGTTCATATTGATGAA
GCCGCCGATTTCTATATCGACCTTTATAACGCAATCAAAGCCAACCCTGACTCCGTTGGTCATGGCCGTGATGGG
TTCTATTTTCTGTTGAATGGAGAACACAGTCTCTACGATGTTGGCAAAGAGATCGGCCGCGCACTAGTTGCGCTC
GGCAAGGTAACCACCGAAGTGCCTTCCACATACACCCAAGAAGAAGTGAATAAGTATTTTGGAGGATCTAATTTC
TTGGGCACAAACTCGAGGGGTTTGGCCAATCACTCGAAATCCATCGGGTGGAAACCGAAGAAAACAACCCAAGAT
CTTATGGCGAGCATTAAGCCTGAAGTAGAGGAGATTCTCAAGCATTTGTAA
Transcript >AgabiH97|071040
ATGTCTTCTACCCTCAAATTCTTTTTCATCGGTGCTACTGGCTACGTCGGCAGCTCTGTTCTAGAGCGCTTCCTT
GATCATCCGGAGGCCAATAATTTCGAATTTACTGCCCTTGTTAGAGACCCTCGGAAAGCGGAAAAATTGAAGCAA
TTCGGCGTAAACGCCGTTGTCGGTTCTTTTGATGATGCTAAGCTCGTCGAGGACTTGACTGCCGCTGCGGACATC
GTGGTTGACATGGGAGGCTCAGATAATCTCGGACTTGCCAAAAGTACACTTCGCGGCTTCCAAAGAAAGTTCCAA
GAAACAGGAAAACCTTCAATTTTTATTCACACCTCCGGAACCATCATCATAGCCGATGATGCAACGGGTCTTCAT
TCTTCTGATGTCGTCTGGAACGATGCCGATCCTGACCAGATAGAGCAACTGCCACCAACTGCACCCCATATCGAC
GTAGAATTGGAGATCATCCGGGCCGATAAGGAGGGTTACGTTCGCGCTTACTTCGTGACTCCCGGCACAATATAT
GGAATTGCCTCTGGAAAGTTCGTAGATGCCGGTCTCGCTAATAAGCATTCTATTCAGGTACCTGCCCTCATCAAG
ACCTCGCTTGACAGAGGACAGGCTGGGATGATCGGTAAGGGATTGAACATCTGGCCAAACGTTCATATTGATGAA
GCCGCCGATTTCTATATCGACCTTTATAACGCAATCAAAGCCAACCCTGACTCCGTTGGTCATGGCCGTGATGGG
TTCTATTTTCTGTTGAATGGAGAACACAGTCTCTACGATGTTGGCAAAGAGATCGGCCGCGCACTAGTTGCGCTC
GGCAAGGTAACCACCGAAGTGCCTTCCACATACACCCAAGAAGAAGTGAATAAGTATTTTGGAGGATCTAATTTC
TTGGGCACAAACTCGAGGGGTTTGGCCAATCACTCGAAATCCATCGGGTGGAAACCGAAGAAAACAACCCAAGAT
CTTATGGCGAGCATTAAGCCTGAAGTAGAGGAGATTCTCAAGCATTTGTAA
Gene >AgabiH97|071040
ATGTCTTCTACCCTCAAATTCTTTTTCATCGGTGCTACTGGTCAGCTCAAATTCACATTTCTTTGCAATAGTTCG
TCTCAGACTAATCATCCTCAGGCTACGTCGGCAGCTCTGTTCTAGAGCGCTTCCTTGATCATCCGGAGGCCAATA
ATTTCGAATTTACTGCCCTTGTTAGAGACCCTCGGAAAGCGGAAAAATTGAAGCAATTCGGCGTAAACGCCGTTG
TCGGTTCTTTTGATGATGCTAAGCTCGTCGAGGACTTGACTGCCGCTGCGGACATCGTGGTTGACATGGTTAGTT
AGAATAATATTCATTCGTTTATAAGGTAGTCTTAAAAACCCATGCTTCAGGGAGGCTCAGATAATCTCGGACTTG
CCAAAAGTACACTTCGCGGCTTCCAAAGAAAGTTCCAAGAAACAGGAAAACCTTCAATTTTTATTCACACCGTAA
GTCTTCGTGGATATCTATTTGGGGCTAGCCGTTCCTACTCAACTCTCCAGTCCGGAACCATCATCATAGCCGATG
ATGCAACGGGTCTTCATTCTTCTGATGTCGTCTGGAACGATGCCGATCCTGACCAGATAGAGCAACTGCCACCAA
CTGCACCCCATATCGACGTAGAATTGGAGATCATCCGGGCCGATAAGGAGGGTTACGTTCGCGCTTACTTCGTGA
CTCCCGGCACAATATATGGAATTGCCTCTGGAAAGTTCGTAGATGCCGGTCTCGCTAATAAGCATTCTATTCAGG
TACCTGCCCTCATCAAGACCTCGCTTGACAGAGGACAGGCTGGGATGATCGGTAAGGGATTGAACATCTGGCCAA
ACGTTCATATTGATGAAGGTCAGCTCACTAACTCCCTTGGTCCGAGTCCGTTCATTTATTTGGAAATTAGCCGCC
GATTTCTATATCGACCTTTATAACGCAATCAAAGCCAACCCTGACTCCGTTGGTCATGGCCGTGATGGGTTCTAT
TTTCTGTTGAATGGAGAACACAGTCTCTACGATGTTGGCAAAGAGATCGGCCGCGCACTAGTTGCGCTCGGCAAG
GTAACCACCGAAGTGCCTTCCACATACACCCAAGAAGAAGTGAATAAGTATTTTGGAGTGAGTTTTTATCATTCT
TGGGCTCGTTGAGGACAGGTTGAACTTGACGTTTTCATAGGGATCTAATTTCTTGGGCACAAACTCGAGGGGTTT
GGCCAATCACTCGAAATCCATCGGGTGGAAACCGAAGAAAACAACCCAAGATCTTATGGCGAGCATTAAGCCTGA
AGTAGAGGAGATTCTCAAGCATTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail