Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070930
Gene name
Locationscaffold_4:1387428..1388841
Strand-
Gene length (bp)1413
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 2.8E-15 109 254
PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain 6.7E-11 24 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UV5|GLNA_HEBCY Glutamine synthetase OS=Hebeloma cylindrosporum GN=GLN1 PE=2 SV=1 1 353 0.0E+00
sp|O00088|GLNA_AGABI Glutamine synthetase OS=Agaricus bisporus GN=glnA PE=3 SV=1 1 348 0.0E+00
sp|Q75BT9|GLNA_ASHGO Glutamine synthetase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLN1 PE=3 SV=1 10 348 0.0E+00
sp|Q6C3E0|GLNA_YARLI Glutamine synthetase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLN1 PE=3 SV=1 9 348 0.0E+00
sp|Q6FMT6|GLNA_CANGA Glutamine synthetase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLN1 PE=3 SV=1 9 348 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UV5|GLNA_HEBCY Glutamine synthetase OS=Hebeloma cylindrosporum GN=GLN1 PE=2 SV=1 1 353 0.0E+00
sp|O00088|GLNA_AGABI Glutamine synthetase OS=Agaricus bisporus GN=glnA PE=3 SV=1 1 348 0.0E+00
sp|Q75BT9|GLNA_ASHGO Glutamine synthetase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLN1 PE=3 SV=1 10 348 0.0E+00
sp|Q6C3E0|GLNA_YARLI Glutamine synthetase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLN1 PE=3 SV=1 9 348 0.0E+00
sp|Q6FMT6|GLNA_CANGA Glutamine synthetase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLN1 PE=3 SV=1 9 348 0.0E+00
sp|Q6B4U7|GLNA_DEBHA Glutamine synthetase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLN1 PE=3 SV=1 4 348 0.0E+00
sp|P32288|GLNA_YEAST Glutamine synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN1 PE=1 SV=4 2 348 0.0E+00
sp|P0CN85|GLNA_CRYNB Glutamine synthetase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GLN1 PE=3 SV=1 1 353 0.0E+00
sp|Q874T6|GLNA_KLULA Glutamine synthetase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLN1 PE=3 SV=1 9 348 0.0E+00
sp|Q8X169|GLNA_AMAMU Glutamine synthetase OS=Amanita muscaria GN=GLN1 PE=2 SV=2 1 348 0.0E+00
sp|P0CN84|GLNA_CRYNJ Glutamine synthetase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GLN1 PE=2 SV=1 1 353 0.0E+00
sp|Q8J1R3|GLNA_SUIBO Glutamine synthetase OS=Suillus bovinus GN=GLNA PE=3 SV=1 1 348 0.0E+00
sp|Q86ZU6|GLNA_TUBBO Glutamine synthetase OS=Tuber borchii GN=GLN1 PE=2 SV=1 10 348 5.0E-177
sp|Q09179|GLNA_SCHPO Glutamine synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gln1 PE=1 SV=2 9 348 1.0E-171
sp|Q86ZF9|GLNA_NEUCR Glutamine synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gln-1 PE=3 SV=1 10 348 3.0E-171
sp|Q12613|GLNA_COLGL Glutamine synthetase OS=Colletotrichum gloeosporioides GN=GLN1 PE=3 SV=1 8 348 2.0E-169
sp|Q9UUN6|GLNA_FUSSH Glutamine synthetase OS=Fusarium solani subsp. phaseoli GN=GLN1 PE=2 SV=1 4 349 3.0E-169
sp|Q9C2U9|GLNA_GIBFU Glutamine synthetase OS=Gibberella fujikuroi GN=GLN1 PE=3 SV=1 4 349 9.0E-168
sp|Q96V52|GLNA_EMENI Glutamine synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=glnA PE=3 SV=3 2 348 1.0E-166
sp|P15104|GLNA_HUMAN Glutamine synthetase OS=Homo sapiens GN=GLUL PE=1 SV=4 13 352 9.0E-153
sp|P15103|GLNA_BOVIN Glutamine synthetase OS=Bos taurus GN=GLUL PE=2 SV=4 13 352 1.0E-152
sp|P51121|GLNA_XENLA Glutamine synthetase OS=Xenopus laevis GN=glul PE=2 SV=1 13 347 1.0E-152
sp|Q8HZM5|GLNA_CANLF Glutamine synthetase OS=Canis lupus familiaris GN=GLUL PE=1 SV=3 13 352 2.0E-152
sp|Q9QY94|GLNA_ACOCA Glutamine synthetase OS=Acomys cahirinus GN=GLUL PE=2 SV=3 13 352 1.0E-151
sp|P46410|GLNA_PIG Glutamine synthetase OS=Sus scrofa GN=GLUL PE=2 SV=3 13 352 2.0E-151
sp|P15105|GLNA_MOUSE Glutamine synthetase OS=Mus musculus GN=Glul PE=1 SV=6 13 352 3.0E-151
sp|Q4R7U3|GLNA_MACFA Glutamine synthetase OS=Macaca fascicularis GN=GLUL PE=2 SV=3 13 352 7.0E-151
sp|P09606|GLNA_RAT Glutamine synthetase OS=Rattus norvegicus GN=Glul PE=1 SV=3 13 352 2.0E-148
sp|P20478|GLNA2_DROME Glutamine synthetase 2 cytoplasmic OS=Drosophila melanogaster GN=Gs2 PE=2 SV=3 9 347 3.0E-148
sp|P16580|GLNA_CHICK Glutamine synthetase OS=Gallus gallus GN=GLUL PE=1 SV=1 13 352 5.0E-148
sp|P14656|GLN11_ORYSJ Glutamine synthetase cytosolic isozyme 1-1 OS=Oryza sativa subsp. japonica GN=GLN1-1 PE=1 SV=1 7 348 2.0E-147
sp|P52782|GLNA_LUPLU Glutamine synthetase nodule isozyme OS=Lupinus luteus PE=3 SV=1 7 348 2.0E-147
sp|P32289|GLNA_VIGAC Glutamine synthetase nodule isozyme OS=Vigna aconitifolia PE=2 SV=1 7 348 6.0E-147
sp|P38561|GLNA3_MAIZE Glutamine synthetase root isozyme 3 OS=Zea mays GN=GLN4 PE=1 SV=1 7 348 4.0E-146
sp|P14654|GLN12_ORYSJ Glutamine synthetase cytosolic isozyme 1-2 OS=Oryza sativa subsp. japonica GN=GLN1-2 PE=1 SV=1 1 348 5.0E-146
sp|P04078|GLNA1_MEDSA Glutamine synthetase cytosolic isozyme OS=Medicago sativa PE=2 SV=1 9 346 5.0E-145
sp|P14655|GLNA2_ORYSJ Glutamine synthetase, chloroplastic OS=Oryza sativa subsp. japonica GN=GLN2 PE=1 SV=1 20 348 1.0E-144
sp|P51119|GLNA2_VITVI Glutamine synthetase cytosolic isozyme 2 OS=Vitis vinifera GN=GS1-2 PE=2 SV=1 7 348 1.0E-144
sp|Q43785|GLNA3_MEDSA Glutamine synthetase nodule isozyme OS=Medicago sativa GN=GS1 PE=2 SV=1 7 348 1.0E-144
sp|P38563|GLNA5_MAIZE Glutamine synthetase root isozyme 5 OS=Zea mays GN=GS1-5 PE=2 SV=2 7 348 2.0E-144
sp|P12424|GLNA_NICPL Glutamine synthetase OS=Nicotiana plumbaginifolia PE=2 SV=1 7 346 2.0E-144
sp|P25462|GLNAC_MAIZE Glutamine synthetase, chloroplastic OS=Zea mays GN=GLN2 PE=2 SV=1 20 348 3.0E-144
sp|P08282|GLNA1_PEA Glutamine synthetase nodule isozyme OS=Pisum sativum GN=GS1 PE=2 SV=2 20 348 4.0E-144
sp|O82560|GLNA2_SOYBN Glutamine synthetase cytosolic isozyme 2 OS=Glycine max PE=1 SV=1 7 348 4.0E-144
sp|P38559|GLNA1_MAIZE Glutamine synthetase root isozyme 1 OS=Zea mays GN=GLN6 PE=2 SV=1 7 348 5.0E-144
sp|P41320|GLNA_SQUAC Glutamine synthetase, mitochondrial OS=Squalus acanthias PE=2 SV=1 13 352 5.0E-144
sp|Q04831|GLNA_PANAR Glutamine synthetase OS=Panulirus argus PE=2 SV=1 9 345 2.0E-143
sp|P00965|GLNA3_PHAVU Glutamine synthetase N-1 OS=Phaseolus vulgaris GN=Gln-gamma PE=2 SV=2 7 348 2.0E-143
sp|P04770|GLNA1_PHAVU Glutamine synthetase PR-1 OS=Phaseolus vulgaris PE=2 SV=1 7 346 2.0E-143
sp|P23712|GLNA_LACSA Glutamine synthetase OS=Lactuca sativa PE=2 SV=2 9 348 4.0E-143
sp|Q42899|GLNA1_LOTJA Glutamine synthetase cytosolic isozyme OS=Lotus japonicus GN=GLN1 PE=2 SV=2 7 346 5.0E-143
sp|O22506|GLNA2_DAUCA Glutamine synthetase, chloroplastic OS=Daucus carota GN=GLN2 PE=2 SV=1 20 348 6.0E-143
sp|Q43127|GLNA2_ARATH Glutamine synthetase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GLN2 PE=1 SV=1 14 348 8.0E-143
sp|P13564|GLNA2_HORVU Glutamine synthetase leaf isozyme, chloroplastic OS=Hordeum vulgare PE=2 SV=2 20 348 1.0E-142
sp|Q42624|GLNAC_BRANA Glutamine synthetase, chloroplastic OS=Brassica napus GN=GLN2 PE=2 SV=1 20 348 1.0E-142
sp|Q56WN1|GLN11_ARATH Glutamine synthetase cytosolic isozyme 1-1 OS=Arabidopsis thaliana GN=GLN1-1 PE=1 SV=2 7 348 2.0E-142
sp|P15102|GLNA4_PHAVU Glutamine synthetase leaf isozyme, chloroplastic OS=Phaseolus vulgaris PE=2 SV=1 20 348 4.0E-142
sp|Q9LVI8|GLN13_ARATH Glutamine synthetase cytosolic isozyme 1-3 OS=Arabidopsis thaliana GN=GLN1-3 PE=1 SV=1 9 348 5.0E-142
sp|P38562|GLNA4_MAIZE Glutamine synthetase root isozyme 4 OS=Zea mays GN=GLN5 PE=2 SV=1 7 348 7.0E-142
sp|P52783|GLNA_PINSY Glutamine synthetase cytosolic isozyme OS=Pinus sylvestris PE=2 SV=1 7 348 3.0E-141
sp|Q9FMD9|GLN14_ARATH Glutamine synthetase cytosolic isozyme 1-4 OS=Arabidopsis thaliana GN=GLN1-4 PE=1 SV=1 8 348 3.0E-141
sp|P07694|GLNA3_PEA Glutamine synthetase root isozyme A OS=Pisum sativum GN=GS3A PE=2 SV=1 7 348 5.0E-141
sp|Q4W8D0|GLN13_ORYSJ Glutamine synthetase cytosolic isozyme 1-3 OS=Oryza sativa subsp. japonica GN=GLN1-3 PE=2 SV=1 1 348 5.0E-141
sp|P51118|GLNA1_VITVI Glutamine synthetase cytosolic isozyme 1 OS=Vitis vinifera GN=GS1-1 PE=2 SV=1 7 348 6.0E-141
sp|P04771|GLNA2_PHAVU Glutamine synthetase PR-2 OS=Phaseolus vulgaris PE=2 SV=1 7 348 7.0E-141
sp|Q8LCE1|GLN12_ARATH Glutamine synthetase cytosolic isozyme 1-2 OS=Arabidopsis thaliana GN=GLN1-2 PE=1 SV=2 9 348 8.0E-141
sp|O22504|GLNA1_DAUCA Glutamine synthetase cytosolic isozyme OS=Daucus carota GN=GLN1 PE=2 SV=1 7 348 9.0E-141
sp|Q9XQ94|GLNA2_MEDSA Glutamine synthetase leaf isozyme, chloroplastic OS=Medicago sativa GN=GS2 PE=2 SV=1 20 348 1.0E-140
sp|Q43066|GLNA4_PEA Glutamine synthetase root isozyme B OS=Pisum sativum GN=GS3B PE=3 SV=1 7 348 2.0E-140
sp|P08281|GLNA2_PEA Glutamine synthetase leaf isozyme, chloroplastic OS=Pisum sativum GN=GS2 PE=2 SV=2 20 348 6.0E-139
sp|O04867|GLNA1_ALNGL Glutamine synthetase OS=Alnus glutinosa GN=GLN1 PE=2 SV=1 7 348 2.0E-138
sp|Q42688|GLNA1_CHLRE Glutamine synthetase cytosolic isozyme OS=Chlamydomonas reinhardtii GN=GLN1 PE=2 SV=1 17 348 3.0E-138
sp|Q8GXW5|GLN15_ARATH Glutamine synthetase cytosolic isozyme 1-5 OS=Arabidopsis thaliana GN=GLN1-5 PE=1 SV=1 21 348 1.0E-137
sp|P04773|GLNA_CRIGR Glutamine synthetase OS=Cricetulus griseus GN=GLUL PE=2 SV=4 13 352 3.0E-137
sp|P24099|GLNA1_SOYBN Glutamine synthetase cytosolic isozyme 1 OS=Glycine max PE=2 SV=1 7 348 3.0E-137
sp|Q06378|GLNA3_HORVU Glutamine synthetase OS=Hordeum vulgare PE=2 SV=1 20 348 4.0E-137
sp|P20477|GLNA1_DROME Glutamine synthetase 1, mitochondrial OS=Drosophila melanogaster GN=Gs1 PE=2 SV=3 9 352 9.0E-137
sp|P38560|GLNA2_MAIZE Glutamine synthetase root isozyme 2 OS=Zea mays GN=GLN2 PE=2 SV=1 9 348 3.0E-133
sp|P34497|GLNA_CAEEL Probable glutamine synthetase OS=Caenorhabditis elegans GN=gln-2 PE=3 SV=1 21 348 2.0E-132
sp|P14636|GLNA3_LUPAN Glutamine synthetase nodule isozyme (Fragment) OS=Lupinus angustifolius PE=2 SV=1 7 314 1.0E-130
sp|Q5UR44|GLNA_MIMIV Putative glutamine synthetase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R565 PE=3 SV=1 25 348 7.0E-117
sp|Q42689|GLNA2_CHLRE Glutamine synthetase, chloroplastic OS=Chlamydomonas reinhardtii GN=GLN2 PE=2 SV=1 18 348 2.0E-116
sp|P19432|GLNA2_STRVR Glutamine synthetase 2 OS=Streptomyces viridochromogenes GN=glnII PE=3 SV=1 22 348 4.0E-114
sp|P20805|GLNA2_FRAAL Glutamine synthetase 2 OS=Frankia alni GN=glnII PE=2 SV=1 23 348 2.0E-103
sp|P22878|GLNA2_STRHY Glutamine synthetase 2 OS=Streptomyces hygroscopicus GN=glnB PE=3 SV=1 21 348 8.0E-102
sp|P04772|GLNA2_BRADU Glutamine synthetase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glnII PE=3 SV=2 21 348 3.0E-93
sp|P11600|GLNA_DUNSA Glutamine synthetase (Fragment) OS=Dunaliella salina PE=2 SV=1 120 348 5.0E-93
sp|Q02154|GLNA2_RHILP Glutamine synthetase 2 OS=Rhizobium leguminosarum bv. phaseoli GN=glnII PE=1 SV=3 21 343 5.0E-84
sp|P45626|GLNA2_RHIML Glutamine synthetase 2 OS=Rhizobium meliloti GN=glnII PE=3 SV=1 21 343 7.0E-83
sp|P94845|GLNA_HELPY Glutamine synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glnA PE=3 SV=2 70 347 5.0E-10
sp|Q9ZLW5|GLNA_HELPJ Glutamine synthetase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glnA PE=3 SV=1 57 347 1.0E-09
sp|P12425|GLNA_BACSU Glutamine synthetase OS=Bacillus subtilis (strain 168) GN=glnA PE=1 SV=3 57 347 7.0E-09
sp|P10656|GLNA_CLOSA Glutamine synthetase OS=Clostridium saccharobutylicum GN=glnA PE=3 SV=1 57 348 1.0E-08
sp|P19064|GLNA_BACCE Glutamine synthetase OS=Bacillus cereus GN=glnA PE=1 SV=3 57 252 2.0E-08
sp|A0R083|GLNA2_MYCS2 Probable glutamine synthetase 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glnA PE=1 SV=1 57 347 7.0E-08
sp|Q60182|GLNA_METJA Glutamine synthetase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glnA PE=3 SV=1 44 253 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0006542 glutamine biosynthetic process Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0009064 glutamine family amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0006541 glutamine metabolic process No
GO:0009058 biosynthetic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003674 molecular_function No
GO:0043436 oxoacid metabolic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0016874 ligase activity No
GO:0044238 primary metabolic process No
GO:0016880 acid-ammonia (or amide) ligase activity No
GO:0006082 organic acid metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0016211 ammonia ligase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070930
MANTYHNDLLAPYLSLDQGDKIQAEYVWIDGDGGLRCKTTTVSKKVTDIGQLRIWDFDGSSTNQAPGHDSDVYLR
PAAIFKDPFRGGDNILVLAETYNNDGTPNRTNHRHHAKKVFDEAKEHEPWFGLEQEYTLFDADDQPYGWPKGGFP
GPQGPYYCGAGTGKVFARDLIEAHYRACLYAGINISGINAEVMPSQWEFQVGPCEGISMGDHLWMARYLLVRIAE
QWGVKVSFHPKPLKGEWNGAGCHTNFSTKAMREAGGMKFIEDAIEKLAKRHDEHIAVYGEDNDLRLTGRHETGHI
SNFSSGVANRGASIRVPRHVASQGYGYLEDRRPASNIDPYRTISLIIEYRNCN*
Coding >AgabiH97|070930
ATGGCCAACACCTACCACAACGACCTTCTTGCCCCCTACCTCAGCCTCGATCAAGGCGACAAGATCCAAGCAGAG
TACGTCTGGATCGACGGTGACGGTGGCCTCCGCTGCAAGACCACTACCGTTAGCAAGAAGGTTACCGACATCGGC
CAACTCCGCATTTGGGACTTCGATGGTTCTTCCACAAATCAAGCCCCCGGTCATGATTCCGATGTCTACCTCCGT
CCCGCCGCCATCTTCAAAGACCCTTTCCGTGGCGGCGACAACATCCTTGTTCTCGCAGAGACCTACAACAACGAC
GGCACTCCAAACCGCACCAACCATCGCCATCATGCCAAGAAGGTCTTTGATGAAGCCAAGGAACACGAGCCATGG
TTTGGTCTCGAACAGGAATATACCCTTTTCGATGCCGACGATCAACCATACGGTTGGCCAAAAGGCGGTTTCCCC
GGCCCTCAAGGTCCCTACTACTGCGGTGCTGGCACCGGCAAAGTCTTTGCGCGTGACCTCATTGAGGCACACTAT
CGTGCCTGCCTCTATGCTGGTATCAACATCAGCGGTATCAATGCTGAAGTGATGCCTTCTCAATGGGAGTTCCAA
GTGGGACCGTGTGAAGGCATTTCTATGGGCGACCACCTTTGGATGGCCCGGTACCTTCTTGTTCGCATCGCTGAG
CAGTGGGGCGTCAAGGTTTCCTTCCACCCCAAGCCTCTCAAGGGCGAATGGAACGGTGCTGGCTGCCACACCAAC
TTCTCTACCAAGGCCATGCGGGAAGCTGGAGGTATGAAGTTCATCGAAGACGCTATCGAAAAACTCGCCAAACGA
CATGATGAACATATTGCTGTTTACGGGGAGGACAATGACCTCCGACTCACTGGTCGCCACGAGACCGGTCACATC
AGCAATTTCAGCTCCGGTGTAGCTAACCGCGGTGCTTCAATTCGTGTTCCACGACATGTTGCCTCTCAGGGCTAT
GGTTATCTCGAGGATCGTCGCCCCGCGTCCAATATTGATCCCTATCGCACCATCTCTTTAATCATCGAATATCGA
AATTGTAATTAG
Transcript >AgabiH97|070930
ATGGCCAACACCTACCACAACGACCTTCTTGCCCCCTACCTCAGCCTCGATCAAGGCGACAAGATCCAAGCAGAG
TACGTCTGGATCGACGGTGACGGTGGCCTCCGCTGCAAGACCACTACCGTTAGCAAGAAGGTTACCGACATCGGC
CAACTCCGCATTTGGGACTTCGATGGTTCTTCCACAAATCAAGCCCCCGGTCATGATTCCGATGTCTACCTCCGT
CCCGCCGCCATCTTCAAAGACCCTTTCCGTGGCGGCGACAACATCCTTGTTCTCGCAGAGACCTACAACAACGAC
GGCACTCCAAACCGCACCAACCATCGCCATCATGCCAAGAAGGTCTTTGATGAAGCCAAGGAACACGAGCCATGG
TTTGGTCTCGAACAGGAATATACCCTTTTCGATGCCGACGATCAACCATACGGTTGGCCAAAAGGCGGTTTCCCC
GGCCCTCAAGGTCCCTACTACTGCGGTGCTGGCACCGGCAAAGTCTTTGCGCGTGACCTCATTGAGGCACACTAT
CGTGCCTGCCTCTATGCTGGTATCAACATCAGCGGTATCAATGCTGAAGTGATGCCTTCTCAATGGGAGTTCCAA
GTGGGACCGTGTGAAGGCATTTCTATGGGCGACCACCTTTGGATGGCCCGGTACCTTCTTGTTCGCATCGCTGAG
CAGTGGGGCGTCAAGGTTTCCTTCCACCCCAAGCCTCTCAAGGGCGAATGGAACGGTGCTGGCTGCCACACCAAC
TTCTCTACCAAGGCCATGCGGGAAGCTGGAGGTATGAAGTTCATCGAAGACGCTATCGAAAAACTCGCCAAACGA
CATGATGAACATATTGCTGTTTACGGGGAGGACAATGACCTCCGACTCACTGGTCGCCACGAGACCGGTCACATC
AGCAATTTCAGCTCCGGTGTAGCTAACCGCGGTGCTTCAATTCGTGTTCCACGACATGTTGCCTCTCAGGGCTAT
GGTTATCTCGAGGATCGTCGCCCCGCGTCCAATATTGATCCCTATCGCACCATCTCTTTAATCATCGAATATCGA
AATTGTAATTAG
Gene >AgabiH97|070930
ATGGCCAACACCTACCACAACGACCTTCTTGCCCCCTACCTCAGCCTCGATCAAGGCGACAAGATCCAAGCAGAG
TGTAAGTCTCCTAGTCCCTCTCCTGACCCTCCAAATTCACGATCGCTCAACAGACGTCTGGATCGACGGTGACGG
TGGCCTCCGCTGCAAGACCACTGTGCGTATATGTGCTAACCAGATTTCTCTTCCGCTCACCCTACTTTCCATATC
TGGAAATTAGACCGTTAGCAAGAAGGTTACCGACATCGGCCAACTCCGCATTTGGGACTTCGATGGTTCTTCCAC
AAATCAAGCCCCCGGTCATGATTCCGATGTCTACCTCCGTCCCGCCGCCATCTTCAAAGACCCTTTCCGTGGCGG
CGACAACATCCTTGTTCTCGCAGAGACCTACAACAACGACGGCACTCCAAACCGCACCAACCATCGCCATCATGC
CAAGAAGGTCTTTGATGAAGCCAAGGAACACGAGCCATGGTTTGGTCTCGAACAGGAATATACCCTTTTCGATGC
CGACGATCAACCATACGGTTGGCCAAAAGGCGGTTTCCCCGGCCCTCAAGGTCCCTACTACTGCGGTGCTGGTAA
GCATACTGAGTCTCGACTTGCTTTGGTCTATCTAACCCGTCGTGCAATAGGCACCGGCAAAGTCTTTGCGCGTGA
CCTCATTGAGGCACACTATCGTGCCTGCCTCTATGCTGGTATCAACATCAGCGGTATCAATGCTGAAGTGATGCC
TTCTCAATGGGAGTTCCAAGTGGGACCGTGTGAAGGCATTTCTATGGGCGACCACCTTTGGATGGCCCGGTACCT
TCTTGTTCGCATCGCTGAGCAGTGGGGCGTCAAGGTTTCCTTCCACCCCAAGCCTCTCAAGGGCGAATGGAACGG
TGCTGGCTGCCACACCAACTTCTCTACCAAGGCCATGCGGGAAGCTGGAGGTATGAAGTTCATCGAAGACGCTAT
CGAAAAACTCGCCAAACGACATGATGAACATATTGCTGTTTACGGGGAGGACAATGACCTCCGACTCACTGGTCG
CCACGAGACCGGTCACATCAGCAATTTCAGCTCCGGTGTAGCTAACCGCGGTGCTTCAATTCGTGTTCCACGACA
TGTTGCCTCTCAGGGCTATGGTTATCTCGAGGATCGTCGCCCCGCGTCCAATATTGGTATGTTTGTTGAATCACG
AGGGATCTTTGACATTTGATTTATTTGTTTCCTGCAGATCCCTATCGCGTCACGAGCATCATCGCCGAAACCACC
ATCCTCGATAAATAATCTGATTCCTTCTGTATCGTTATAGACCATCTCTTTAATCATCGGTAAGTTGGCAGGAAT
CATGGAATGTATCACCCATGCTCTCGGATCTCGCCCACTCTAGAATATCGAAATTGTAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail