Protein ID | AgabiH97|070890 |
Gene name | |
Location | scaffold_4:1380786..1382389 |
Strand | + |
Gene length (bp) | 1603 |
Transcript length (bp) | 1134 |
Coding sequence length (bp) | 1134 |
Protein length (aa) | 378 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00180 | Iso_dh | Isocitrate/isopropylmalate dehydrogenase | 1.6E-77 | 47 | 373 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O13302|IDH1_AJECA | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Ajellomyces capsulatus GN=IDH1 PE=2 SV=1 | 40 | 377 | 9.0E-173 |
sp|O13696|IDH1_SCHPO | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh1 PE=1 SV=1 | 41 | 377 | 1.0E-162 |
sp|O94229|IDH1_KLULA | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH1 PE=3 SV=1 | 12 | 377 | 1.0E-159 |
sp|P28834|IDH1_YEAST | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH1 PE=1 SV=2 | 41 | 377 | 4.0E-142 |
sp|Q93353|IDH3B_CAEEL | Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=idhb-1 PE=3 SV=1 | 37 | 377 | 3.0E-119 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O13302|IDH1_AJECA | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Ajellomyces capsulatus GN=IDH1 PE=2 SV=1 | 40 | 377 | 9.0E-173 |
sp|O13696|IDH1_SCHPO | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh1 PE=1 SV=1 | 41 | 377 | 1.0E-162 |
sp|O94229|IDH1_KLULA | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH1 PE=3 SV=1 | 12 | 377 | 1.0E-159 |
sp|P28834|IDH1_YEAST | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH1 PE=1 SV=2 | 41 | 377 | 4.0E-142 |
sp|Q93353|IDH3B_CAEEL | Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=idhb-1 PE=3 SV=1 | 37 | 377 | 3.0E-119 |
sp|Q8LFC0|IDH1_ARATH | Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana GN=IDH1 PE=2 SV=2 | 34 | 377 | 9.0E-118 |
sp|O77784|IDH3B_BOVIN | Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Bos taurus GN=IDH3B PE=2 SV=2 | 35 | 377 | 3.0E-117 |
sp|Q58CP0|IDH3G_BOVIN | Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Bos taurus GN=IDH3G PE=2 SV=1 | 9 | 377 | 6.0E-117 |
sp|P41564|IDH3G_MACFA | Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (Fragment) OS=Macaca fascicularis GN=IDH3G PE=2 SV=1 | 38 | 377 | 7.0E-117 |
sp|P51553|IDH3G_HUMAN | Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens GN=IDH3G PE=1 SV=1 | 31 | 377 | 1.0E-116 |
sp|Q54B68|IDHB_DICDI | Isocitrate dehydrogenase [NAD] regulatory subunit B, mitochondrial OS=Dictyostelium discoideum GN=idhB PE=3 SV=1 | 47 | 374 | 2.0E-116 |
sp|O81796|IDH3_ARATH | Isocitrate dehydrogenase [NAD] regulatory subunit 3, mitochondrial OS=Arabidopsis thaliana GN=IDH3 PE=1 SV=1 | 6 | 377 | 3.0E-116 |
sp|Q28479|IDH3B_MACFA | Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Macaca fascicularis GN=IDH3B PE=2 SV=2 | 44 | 377 | 4.0E-116 |
sp|P70404|IDHG1_MOUSE | Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus GN=Idh3g PE=1 SV=1 | 38 | 377 | 5.0E-116 |
sp|P41565|IDHG1_RAT | Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus GN=Idh3g PE=1 SV=2 | 38 | 377 | 5.0E-116 |
sp|Q68FX0|IDH3B_RAT | Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Rattus norvegicus GN=Idh3B PE=2 SV=1 | 44 | 377 | 9.0E-116 |
sp|O43837|IDH3B_HUMAN | Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens GN=IDH3B PE=1 SV=2 | 44 | 377 | 4.0E-115 |
sp|Q5RBT4|IDH3B_PONAB | Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Pongo abelii GN=IDH3B PE=2 SV=1 | 44 | 377 | 5.0E-113 |
sp|P93032|IDH2_ARATH | Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial OS=Arabidopsis thaliana GN=IDH2 PE=2 SV=2 | 34 | 377 | 8.0E-112 |
sp|Q945K7|IDH5_ARATH | Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial OS=Arabidopsis thaliana GN=IDH5 PE=2 SV=1 | 47 | 377 | 7.0E-111 |
sp|Q55BI2|IDHA_DICDI | Isocitrate dehydrogenase [NAD] regulatory subunit A, mitochondrial OS=Dictyostelium discoideum GN=idhA PE=3 SV=1 | 45 | 377 | 3.0E-110 |
sp|P50213|IDH3A_HUMAN | Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens GN=IDH3A PE=1 SV=1 | 32 | 377 | 8.0E-106 |
sp|Q5R678|IDH3A_PONAB | Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Pongo abelii GN=IDH3A PE=2 SV=1 | 32 | 377 | 9.0E-106 |
sp|Q9D6R2|IDH3A_MOUSE | Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus GN=Idh3a PE=1 SV=1 | 43 | 377 | 1.0E-105 |
sp|Q28480|IDH3A_MACFA | Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (Fragment) OS=Macaca fascicularis GN=IDH3A PE=2 SV=2 | 43 | 377 | 1.0E-105 |
sp|P41563|IDH3A_BOVIN | Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Bos taurus GN=IDH3A PE=1 SV=1 | 43 | 377 | 5.0E-105 |
sp|Q4QQT5|IDHG2_RAT | Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Rattus norvegicus PE=2 SV=1 | 33 | 377 | 7.0E-105 |
sp|Q8BPC6|IDHG2_MOUSE | Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Mus musculus PE=2 SV=1 | 1 | 377 | 3.0E-104 |
sp|Q99NA5|IDH3A_RAT | Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Rattus norvegicus GN=Idh3a PE=1 SV=1 | 43 | 377 | 9.0E-104 |
sp|Q8LG77|IDH6_ARATH | Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana GN=IDH6 PE=2 SV=2 | 49 | 377 | 1.0E-103 |
sp|Q93714|IDH3A_CAEEL | Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=idha-1 PE=3 SV=3 | 43 | 377 | 2.0E-103 |
sp|Q9VWH4|IDH3A_DROME | Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Drosophila melanogaster GN=l(1)G0156 PE=2 SV=1 | 44 | 377 | 5.0E-103 |
sp|Q9USP8|IDH2_SCHPO | Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh2 PE=1 SV=2 | 1 | 377 | 6.0E-98 |
sp|P29696|LEU3_SOLTU | 3-isopropylmalate dehydrogenase, chloroplastic OS=Solanum tuberosum PE=2 SV=1 | 49 | 355 | 8.0E-96 |
sp|P28241|IDH2_YEAST | Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH2 PE=1 SV=1 | 44 | 377 | 2.0E-90 |
sp|O94230|IDH2_KLULA | Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH2 PE=3 SV=1 | 12 | 377 | 5.0E-90 |
sp|P33197|IDH_THET8 | Isocitrate dehydrogenase [NADP] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=icd PE=1 SV=2 | 44 | 377 | 1.0E-70 |
sp|O29627|LEU3_ARCFU | 3-isopropylmalate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuB PE=3 SV=1 | 48 | 369 | 3.0E-70 |
sp|P50455|LEU3_SULTO | 3-isopropylmalate dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuB PE=1 SV=3 | 46 | 377 | 2.0E-66 |
sp|O27441|LEU3_METTH | 3-isopropylmalate dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuB PE=3 SV=1 | 48 | 377 | 6.0E-66 |
sp|Q58130|LEU3_METJA | 3-isopropylmalate/3-methylmalate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuB PE=1 SV=2 | 45 | 377 | 1.0E-60 |
sp|Q5SIJ1|HICDH_THET8 | Homoisocitrate dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hicd PE=1 SV=1 | 46 | 377 | 2.0E-60 |
sp|Q72IW9|HICDH_THET2 | Homoisocitrate dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hicd PE=1 SV=1 | 46 | 377 | 2.0E-60 |
sp|Q1RJU4|IDH_RICBR | Isocitrate dehydrogenase [NADP] OS=Rickettsia bellii (strain RML369-C) GN=icd PE=3 SV=1 | 48 | 377 | 2.0E-58 |
sp|Q9UXB2|LEU3_SULSO | 3-isopropylmalate dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-57 |
sp|Q4UKR1|IDH_RICFE | Isocitrate dehydrogenase [NADP] OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=icd PE=3 SV=2 | 48 | 377 | 1.0E-56 |
sp|Q68XA5|IDH_RICTY | Isocitrate dehydrogenase [NADP] OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=icd PE=3 SV=1 | 48 | 377 | 2.0E-56 |
sp|Q92IR7|IDH_RICCN | Isocitrate dehydrogenase [NADP] OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=icd PE=3 SV=1 | 48 | 377 | 3.0E-56 |
sp|Q9ZDR0|IDH_RICPR | Isocitrate dehydrogenase [NADP] OS=Rickettsia prowazekii (strain Madrid E) GN=icd PE=3 SV=1 | 48 | 377 | 2.0E-55 |
sp|Q58991|AKSF_METJA | Homoisocitrate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aksF PE=1 SV=3 | 48 | 374 | 1.0E-53 |
sp|P40495|LYS12_YEAST | Homoisocitrate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS12 PE=1 SV=1 | 47 | 377 | 1.0E-51 |
sp|O14104|LYS12_SCHPO | Homoisocitrate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys12 PE=1 SV=1 | 50 | 374 | 6.0E-46 |
sp|Q9LQK9|IDH4_ARATH | Putative isocitrate dehydrogenase [NAD] subunit-like 4 OS=Arabidopsis thaliana GN=IDH4 PE=5 SV=1 | 52 | 367 | 2.0E-45 |
sp|Q59985|IDH_STRSL | Isocitrate dehydrogenase [NADP] OS=Streptococcus salivarius GN=icd PE=3 SV=1 | 27 | 374 | 7.0E-45 |
sp|D4GYE8|LEU3_HALVD | 3-isopropylmalate dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=leuB PE=3 SV=1 | 48 | 377 | 2.0E-43 |
sp|O29610|IDH_ARCFU | Isocitrate dehydrogenase [NADP] OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=icd PE=1 SV=1 | 53 | 377 | 3.0E-43 |
sp|Q48806|DLPA_LEGPH | Protein DlpA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dlpA PE=3 SV=1 | 48 | 375 | 5.0E-43 |
sp|O67480|IDH_AQUAE | Isocitrate dehydrogenase [NADP] OS=Aquifex aeolicus (strain VF5) GN=icd PE=3 SV=1 | 48 | 345 | 4.0E-41 |
sp|O59394|HICD_PYRHO | Isocitrate--homoisocitrate dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1722 PE=1 SV=2 | 45 | 377 | 5.0E-41 |
sp|P94631|LEU3_CORGL | 3-isopropylmalate dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=leuB PE=3 SV=1 | 48 | 345 | 2.0E-40 |
sp|A4QDP9|LEU3_CORGB | 3-isopropylmalate dehydrogenase OS=Corynebacterium glutamicum (strain R) GN=leuB PE=3 SV=1 | 48 | 345 | 2.0E-40 |
sp|Q8CNX4|IDH_STAES | Isocitrate dehydrogenase [NADP] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=icd PE=3 SV=1 | 48 | 377 | 2.0E-40 |
sp|Q5HNL1|IDH_STAEQ | Isocitrate dehydrogenase [NADP] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=icd PE=3 SV=1 | 48 | 377 | 2.0E-40 |
sp|O86504|LEU3_STRCO | 3-isopropylmalate dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=leuB PE=3 SV=1 | 48 | 345 | 4.0E-40 |
sp|Q6GG12|IDH_STAAR | Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain MRSA252) GN=icd PE=3 SV=1 | 48 | 377 | 4.0E-40 |
sp|P99167|IDH_STAAN | Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain N315) GN=icd PE=1 SV=1 | 48 | 377 | 5.0E-40 |
sp|P65099|IDH_STAAM | Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=icd PE=3 SV=1 | 48 | 377 | 5.0E-40 |
sp|Q5HF79|IDH_STAAC | Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain COL) GN=icd PE=3 SV=1 | 48 | 377 | 5.0E-40 |
sp|Q8NW61|IDH_STAAW | Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain MW2) GN=icd PE=3 SV=1 | 48 | 377 | 6.0E-40 |
sp|Q6G8N2|IDH_STAAS | Isocitrate dehydrogenase [NADP] OS=Staphylococcus aureus (strain MSSA476) GN=icd PE=3 SV=1 | 48 | 377 | 6.0E-40 |
sp|Q9ZN36|IDH_HELPJ | Isocitrate dehydrogenase [NADP] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=icd PE=3 SV=1 | 32 | 377 | 8.0E-40 |
sp|P08200|IDH_ECOLI | Isocitrate dehydrogenase [NADP] OS=Escherichia coli (strain K12) GN=icd PE=1 SV=1 | 26 | 377 | 1.0E-39 |
sp|Q59940|IDH_STRMU | Isocitrate dehydrogenase [NADP] OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=icd PE=3 SV=2 | 25 | 377 | 2.0E-39 |
sp|Q8G500|LEU3_BIFLO | 3-isopropylmalate dehydrogenase OS=Bifidobacterium longum (strain NCC 2705) GN=leuB PE=3 SV=1 | 46 | 363 | 2.0E-39 |
sp|B3DTF8|LEU3_BIFLD | 3-isopropylmalate dehydrogenase OS=Bifidobacterium longum (strain DJO10A) GN=leuB PE=3 SV=1 | 46 | 363 | 2.0E-39 |
sp|D4GU92|IDH_HALVD | Isocitrate dehydrogenase [NADP] OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=icd PE=1 SV=1 | 48 | 377 | 4.0E-39 |
sp|P56063|IDH_HELPY | Isocitrate dehydrogenase [NADP] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=icd PE=3 SV=1 | 32 | 377 | 6.0E-39 |
sp|P42958|TTUC_BACSU | Probable tartrate dehydrogenase/decarboxylase OS=Bacillus subtilis (strain 168) GN=ycsA PE=3 SV=4 | 46 | 377 | 1.0E-38 |
sp|Q3B595|LEU3_CHLL7 | 3-isopropylmalate dehydrogenase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=leuB PE=3 SV=1 | 45 | 377 | 1.0E-38 |
sp|B1VZ57|LEU3_STRGG | 3-isopropylmalate dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=leuB PE=3 SV=1 | 48 | 364 | 1.0E-38 |
sp|Q8FPV5|LEU3_COREF | 3-isopropylmalate dehydrogenase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=leuB PE=3 SV=2 | 48 | 345 | 2.0E-38 |
sp|B7GUI8|LEU3_BIFLS | 3-isopropylmalate dehydrogenase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=leuB PE=3 SV=1 | 46 | 363 | 3.0E-38 |
sp|C4LJH3|LEU3_CORK4 | 3-isopropylmalate dehydrogenase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=leuB PE=3 SV=1 | 48 | 361 | 3.0E-38 |
sp|P76251|DMLA_ECOLI | D-malate dehydrogenase [decarboxylating] OS=Escherichia coli (strain K12) GN=dmlA PE=1 SV=1 | 48 | 375 | 4.0E-38 |
sp|P41560|IDH1_COLMA | Isocitrate dehydrogenase [NADP] 1 OS=Colwellia maris GN=icdI PE=1 SV=2 | 48 | 334 | 6.0E-38 |
sp|Q65GI9|LEU3_BACLD | 3-isopropylmalate dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuB PE=3 SV=2 | 48 | 360 | 7.0E-38 |
sp|A5CPZ4|LEU3_CLAM3 | 3-isopropylmalate dehydrogenase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=leuB PE=3 SV=1 | 47 | 345 | 8.0E-38 |
sp|P24098|LEU3_THEAQ | 3-isopropylmalate dehydrogenase OS=Thermus aquaticus GN=leuB PE=3 SV=1 | 48 | 377 | 8.0E-38 |
sp|Q6NHM7|LEU3_CORDI | 3-isopropylmalate dehydrogenase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=leuB PE=3 SV=1 | 48 | 361 | 8.0E-38 |
sp|P61494|LEU3_THET2 | 3-isopropylmalate dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=leuB PE=3 SV=1 | 48 | 377 | 1.0E-37 |
sp|Q9ZH99|IDH_COXBU | Isocitrate dehydrogenase [NADP] OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=icd PE=1 SV=1 | 48 | 377 | 2.0E-37 |
sp|P96318|IDH_CALNO | Isocitrate dehydrogenase [NADP] OS=Caldococcus noboribetus GN=icd PE=1 SV=2 | 48 | 330 | 2.0E-37 |
sp|P39126|IDH_BACSU | Isocitrate dehydrogenase [NADP] OS=Bacillus subtilis (strain 168) GN=icd PE=1 SV=1 | 48 | 377 | 2.0E-37 |
sp|Q5KWJ4|LEU3_GEOKA | 3-isopropylmalate dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=leuB PE=3 SV=1 | 44 | 363 | 2.0E-37 |
sp|P61495|LEU3_THETH | 3-isopropylmalate dehydrogenase OS=Thermus thermophilus GN=leuB PE=1 SV=2 | 48 | 377 | 2.0E-37 |
sp|P70787|TTUC2_AGRVI | Probable tartrate dehydrogenase/decarboxylase TtuC OS=Agrobacterium vitis GN=ttuC PE=2 SV=1 | 46 | 377 | 3.0E-37 |
sp|P70792|TTUC4_AGRVI | Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 | 46 | 377 | 3.0E-37 |
sp|Q5SIY4|LEU3_THET8 | 3-isopropylmalate dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=leuB PE=1 SV=1 | 48 | 377 | 3.0E-37 |
sp|P41019|LEU3_BACMD | 3-isopropylmalate dehydrogenase OS=Bacillus megaterium (strain DSM 319) GN=leuB PE=3 SV=2 | 48 | 361 | 4.0E-37 |
sp|Q02143|LEU3_LACLA | 3-isopropylmalate dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=leuB PE=3 SV=3 | 48 | 375 | 7.0E-37 |
sp|P12010|LEU3_BACCO | 3-isopropylmalate dehydrogenase OS=Bacillus coagulans GN=leuB PE=1 SV=1 | 48 | 377 | 7.0E-37 |
sp|Q5YRX2|LEU3_NOCFA | 3-isopropylmalate dehydrogenase OS=Nocardia farcinica (strain IFM 10152) GN=leuB PE=3 SV=1 | 48 | 334 | 9.0E-37 |
sp|P59028|LEU3_CHLTE | 3-isopropylmalate dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=leuB PE=3 SV=1 | 45 | 377 | 1.0E-36 |
sp|O34296|TTUC3_AGRVI | Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 | 46 | 373 | 2.0E-36 |
sp|Q1IZK2|LEU3_DEIGD | 3-isopropylmalate dehydrogenase OS=Deinococcus geothermalis (strain DSM 11300) GN=leuB PE=3 SV=1 | 48 | 374 | 2.0E-36 |
sp|Q73B99|LEU3_BACC1 | 3-isopropylmalate dehydrogenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuB PE=3 SV=1 | 48 | 377 | 3.0E-36 |
sp|Q51945|TTUC_PSEPU | Tartrate dehydrogenase/decarboxylase OS=Pseudomonas putida PE=1 SV=3 | 46 | 373 | 4.0E-36 |
sp|Q82JN6|LEU3_STRAW | 3-isopropylmalate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=leuB PE=3 SV=1 | 48 | 334 | 4.0E-36 |
sp|C3PFX5|LEU3_CORA7 | 3-isopropylmalate dehydrogenase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=leuB PE=3 SV=1 | 48 | 361 | 6.0E-36 |
sp|Q81G11|LEU3_BACCR | 3-isopropylmalate dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=leuB PE=3 SV=1 | 48 | 377 | 8.0E-36 |
sp|O34295|TTUC5_AGRVI | Probable tartrate dehydrogenase/decarboxylase TtuC' OS=Agrobacterium vitis GN=ttuC' PE=2 SV=1 | 46 | 373 | 8.0E-36 |
sp|Q3APC4|LEU3_CHLCH | 3-isopropylmalate dehydrogenase OS=Chlorobium chlorochromatii (strain CaD3) GN=leuB PE=3 SV=1 | 46 | 377 | 1.0E-35 |
sp|B0RIP4|LEU3_CLAMS | 3-isopropylmalate dehydrogenase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=leuB PE=3 SV=1 | 47 | 335 | 1.0E-35 |
sp|Q44471|TTUC1_AGRVI | Probable tartrate dehydrogenase/decarboxylase TtuC OS=Agrobacterium vitis GN=ttuC PE=2 SV=1 | 46 | 373 | 1.0E-35 |
sp|Q67JY2|LEU3_SYMTH | 3-isopropylmalate dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuB PE=3 SV=1 | 46 | 375 | 1.0E-35 |
sp|O66607|LEU3_AQUAE | 3-isopropylmalate dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-35 |
sp|Q02NB5|IDH_PSEAB | Isocitrate dehydrogenase [NADP] OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=icd PE=1 SV=1 | 48 | 377 | 2.0E-35 |
sp|Q7M886|LEU3_WOLSU | 3-isopropylmalate dehydrogenase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuB PE=3 SV=1 | 46 | 360 | 2.0E-35 |
sp|Q4JUQ0|LEU3_CORJK | 3-isopropylmalate dehydrogenase OS=Corynebacterium jeikeium (strain K411) GN=leuB PE=3 SV=1 | 48 | 361 | 4.0E-35 |
sp|Q63DX7|LEU3_BACCZ | 3-isopropylmalate dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=leuB PE=3 SV=1 | 48 | 377 | 4.0E-35 |
sp|Q81T67|LEU3_BACAN | 3-isopropylmalate dehydrogenase OS=Bacillus anthracis GN=leuB PE=3 SV=1 | 48 | 377 | 5.0E-35 |
sp|B1VG35|LEU3_CORU7 | 3-isopropylmalate dehydrogenase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=leuB PE=3 SV=1 | 48 | 348 | 6.0E-35 |
sp|Q9RTH9|LEU3_DEIRA | 3-isopropylmalate dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuB PE=3 SV=1 | 48 | 377 | 8.0E-35 |
sp|Q6HLF2|LEU3_BACHK | 3-isopropylmalate dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuB PE=3 SV=1 | 48 | 377 | 1.0E-34 |
sp|Q2RGA0|LEU3_MOOTA | 3-isopropylmalate dehydrogenase OS=Moorella thermoacetica (strain ATCC 39073) GN=leuB PE=3 SV=1 | 45 | 360 | 1.0E-34 |
sp|A0PPY6|LEU3_MYCUA | 3-isopropylmalate dehydrogenase OS=Mycobacterium ulcerans (strain Agy99) GN=leuB PE=3 SV=1 | 48 | 345 | 2.0E-34 |
sp|Q5WEN4|LEU3_BACSK | 3-isopropylmalate dehydrogenase OS=Bacillus clausii (strain KSM-K16) GN=leuB PE=3 SV=1 | 48 | 373 | 2.0E-34 |
sp|Q4L7U1|LEU3_STAHJ | 3-isopropylmalate dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuB PE=3 SV=1 | 46 | 368 | 3.0E-34 |
sp|Q8RDK0|LEU3_CALS4 | 3-isopropylmalate dehydrogenase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuB PE=3 SV=1 | 45 | 361 | 4.0E-34 |
sp|P05645|LEU3_BACSU | 3-isopropylmalate dehydrogenase OS=Bacillus subtilis (strain 168) GN=leuB PE=3 SV=3 | 48 | 374 | 6.0E-34 |
sp|Q65V05|LEU3_MANSM | 3-isopropylmalate dehydrogenase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuB PE=3 SV=1 | 46 | 365 | 7.0E-34 |
sp|C5C2I9|LEU3_BEUC1 | 3-isopropylmalate dehydrogenase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=leuB PE=3 SV=1 | 48 | 361 | 2.0E-33 |
sp|B2HIH1|LEU3_MYCMM | 3-isopropylmalate dehydrogenase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=leuB PE=3 SV=1 | 48 | 345 | 2.0E-33 |
sp|Q5NPQ9|LEU3_ZYMMO | 3-isopropylmalate dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=leuB PE=3 SV=1 | 48 | 377 | 2.0E-33 |
sp|Q2G4X5|LEU3_NOVAD | 3-isopropylmalate dehydrogenase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuB PE=3 SV=2 | 48 | 377 | 3.0E-33 |
sp|Q47SB4|LEU3_THEFY | 3-isopropylmalate dehydrogenase OS=Thermobifida fusca (strain YX) GN=leuB PE=3 SV=1 | 48 | 334 | 5.0E-33 |
sp|Q5HMF8|LEU3_STAEQ | 3-isopropylmalate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuB PE=3 SV=1 | 46 | 368 | 7.0E-33 |
sp|Q8CNL2|LEU3_STAES | 3-isopropylmalate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuB PE=3 SV=1 | 46 | 367 | 1.0E-32 |
sp|Q5MZ40|LEU3_SYNP6 | 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuB PE=3 SV=2 | 46 | 360 | 1.0E-32 |
sp|Q31N34|LEU3_SYNE7 | 3-isopropylmalate dehydrogenase OS=Synechococcus elongatus (strain PCC 7942) GN=leuB PE=3 SV=1 | 46 | 360 | 1.0E-32 |
sp|Q9WZ26|LEU3_THEMA | 3-isopropylmalate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuB PE=1 SV=1 | 48 | 377 | 2.0E-32 |
sp|Q5LWZ5|LEU3_RUEPO | 3-isopropylmalate dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=leuB PE=3 SV=1 | 47 | 377 | 2.0E-32 |
sp|Q3AEQ2|LEU3_CARHZ | 3-isopropylmalate dehydrogenase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=leuB PE=3 SV=1 | 44 | 366 | 3.0E-32 |
sp|Q49Z13|LEU3_STAS1 | 3-isopropylmalate dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuB PE=3 SV=1 | 46 | 377 | 3.0E-32 |
sp|Q6AEP6|LEU3_LEIXX | 3-isopropylmalate dehydrogenase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuB PE=3 SV=1 | 48 | 366 | 4.0E-32 |
sp|Q46LE2|LEU3_PROMT | 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain NATL2A) GN=leuB PE=3 SV=1 | 46 | 366 | 4.0E-32 |
sp|P05644|LEU3_BACCA | 3-isopropylmalate dehydrogenase OS=Bacillus caldotenax GN=leuB PE=3 SV=1 | 44 | 331 | 5.0E-32 |
sp|Q5M405|LEU3_STRT2 | 3-isopropylmalate dehydrogenase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=leuB PE=3 SV=2 | 48 | 377 | 5.0E-32 |
sp|Q5LZF3|LEU3_STRT1 | 3-isopropylmalate dehydrogenase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=leuB PE=3 SV=2 | 48 | 377 | 5.0E-32 |
sp|Q2NVW4|LEU3_SODGM | 3-isopropylmalate dehydrogenase OS=Sodalis glossinidius (strain morsitans) GN=leuB PE=3 SV=1 | 46 | 376 | 6.0E-32 |
sp|Q8EN68|LEU3_OCEIH | 3-isopropylmalate dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuB PE=3 SV=1 | 48 | 377 | 9.0E-32 |
sp|C1B2M3|LEU3_RHOOB | 3-isopropylmalate dehydrogenase OS=Rhodococcus opacus (strain B4) GN=leuB PE=3 SV=1 | 48 | 361 | 1.0E-31 |
sp|Q31HI0|LEU3_THICR | 3-isopropylmalate dehydrogenase OS=Thiomicrospira crunogena (strain XCL-2) GN=leuB PE=3 SV=1 | 48 | 366 | 1.0E-31 |
sp|Q3M8T9|LEU3_ANAVT | 3-isopropylmalate dehydrogenase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuB PE=3 SV=1 | 46 | 360 | 1.0E-31 |
sp|Q7U840|LEU3_SYNPX | 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain WH8102) GN=leuB PE=3 SV=1 | 46 | 367 | 2.0E-31 |
sp|Q24XT2|LEU3_DESHY | 3-isopropylmalate dehydrogenase OS=Desulfitobacterium hafniense (strain Y51) GN=leuB PE=3 SV=1 | 48 | 360 | 2.0E-31 |
sp|Q6G7Q0|LEU3_STAAS | 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-31 |
sp|P65101|LEU3_STAAN | 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-31 |
sp|P65100|LEU3_STAAM | 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-31 |
sp|Q1QUR0|LEU3_CHRSD | 3-isopropylmalate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=leuB PE=3 SV=2 | 48 | 373 | 2.0E-31 |
sp|Q8NVJ0|LEU3_STAAW | 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-31 |
sp|Q2YUF1|LEU3_STAAB | 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-31 |
sp|Q0S2H1|LEU3_RHOJR | 3-isopropylmalate dehydrogenase OS=Rhodococcus jostii (strain RHA1) GN=leuB PE=3 SV=1 | 48 | 361 | 3.0E-31 |
sp|Q8Z9I1|LEU3_SALTI | 3-isopropylmalate dehydrogenase OS=Salmonella typhi GN=leuB PE=3 SV=1 | 46 | 376 | 4.0E-31 |
sp|Q9EVH5|LEU3_BUCUE | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon erigeronensis GN=leuB PE=3 SV=1 | 46 | 364 | 5.0E-31 |
sp|C1AGB0|LEU3_MYCBT | 3-isopropylmalate dehydrogenase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=leuB PE=3 SV=1 | 48 | 334 | 6.0E-31 |
sp|A1KMY9|LEU3_MYCBP | 3-isopropylmalate dehydrogenase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=leuB PE=3 SV=1 | 48 | 334 | 6.0E-31 |
sp|P94929|LEU3_MYCBO | 3-isopropylmalate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuB PE=3 SV=1 | 48 | 334 | 6.0E-31 |
sp|Q8FL76|LEU3_ECOL6 | 3-isopropylmalate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuB PE=3 SV=3 | 46 | 376 | 6.0E-31 |
sp|Q8X9Z9|LEU3_ECO57 | 3-isopropylmalate dehydrogenase OS=Escherichia coli O157:H7 GN=leuB PE=3 SV=3 | 46 | 376 | 6.0E-31 |
sp|Q8YXA2|LEU3_NOSS1 | 3-isopropylmalate dehydrogenase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuB PE=3 SV=1 | 46 | 360 | 7.0E-31 |
sp|Q6GF15|LEU3_STAAR | 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=leuB PE=3 SV=1 | 46 | 377 | 8.0E-31 |
sp|Q21CS1|LEU3_RHOPB | 3-isopropylmalate dehydrogenase OS=Rhodopseudomonas palustris (strain BisB18) GN=leuB PE=3 SV=2 | 46 | 377 | 8.0E-31 |
sp|Q6FEV6|LEU3_ACIAD | 3-isopropylmalate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuB PE=3 SV=1 | 48 | 360 | 9.0E-31 |
sp|Q8DTG3|LEU3_STRMU | 3-isopropylmalate dehydrogenase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=leuB PE=3 SV=1 | 48 | 377 | 9.0E-31 |
sp|Q1BAR4|LEU3_MYCSS | 3-isopropylmalate dehydrogenase OS=Mycobacterium sp. (strain MCS) GN=leuB PE=3 SV=1 | 48 | 334 | 1.0E-30 |
sp|A1UE98|LEU3_MYCSK | 3-isopropylmalate dehydrogenase OS=Mycobacterium sp. (strain KMS) GN=leuB PE=3 SV=1 | 48 | 334 | 1.0E-30 |
sp|A3PXQ2|LEU3_MYCSJ | 3-isopropylmalate dehydrogenase OS=Mycobacterium sp. (strain JLS) GN=leuB PE=3 SV=1 | 48 | 334 | 1.0E-30 |
sp|Q1RGC4|LEU3_ECOUT | 3-isopropylmalate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=leuB PE=3 SV=1 | 46 | 376 | 1.0E-30 |
sp|Q7W929|LEU3_BORPA | 3-isopropylmalate dehydrogenase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=leuB PE=3 SV=2 | 46 | 377 | 1.0E-30 |
sp|Q7WKH4|LEU32_BORBR | 3-isopropylmalate dehydrogenase 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuB2 PE=3 SV=1 | 46 | 377 | 1.0E-30 |
sp|Q92A27|LEU3_LISIN | 3-isopropylmalate dehydrogenase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuB PE=3 SV=1 | 46 | 377 | 1.0E-30 |
sp|Q8FVF3|LEU3_BRUSU | 3-isopropylmalate dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=leuB PE=3 SV=1 | 48 | 366 | 1.0E-30 |
sp|Q5HEE3|LEU3_STAAC | 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-30 |
sp|Q2FF66|LEU3_STAA3 | 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-30 |
sp|Q9K8E9|LEU3_BACHD | 3-isopropylmalate dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuB PE=3 SV=1 | 48 | 373 | 2.0E-30 |
sp|Q7VY73|LEU3_BORPE | 3-isopropylmalate dehydrogenase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-30 |
sp|Q83SP1|LEU3_SHIFL | 3-isopropylmalate dehydrogenase OS=Shigella flexneri GN=leuB PE=3 SV=3 | 46 | 376 | 2.0E-30 |
sp|Q326G2|LEU3_SHIBS | 3-isopropylmalate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=leuB PE=3 SV=2 | 46 | 376 | 2.0E-30 |
sp|P9WKK9|LEU3_MYCTU | 3-isopropylmalate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=leuB PE=1 SV=1 | 48 | 334 | 2.0E-30 |
sp|P9WKK8|LEU3_MYCTO | 3-isopropylmalate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=leuB PE=3 SV=1 | 48 | 334 | 2.0E-30 |
sp|A5U706|LEU3_MYCTA | 3-isopropylmalate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=leuB PE=3 SV=1 | 48 | 334 | 2.0E-30 |
sp|Q2KYL5|LEU3_BORA1 | 3-isopropylmalate dehydrogenase OS=Bordetella avium (strain 197N) GN=leuB PE=3 SV=1 | 48 | 377 | 2.0E-30 |
sp|P30125|LEU3_ECOLI | 3-isopropylmalate dehydrogenase OS=Escherichia coli (strain K12) GN=leuB PE=1 SV=3 | 46 | 376 | 2.0E-30 |
sp|Q21XI1|LEU3_RHOFT | 3-isopropylmalate dehydrogenase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=leuB PE=3 SV=1 | 48 | 377 | 3.0E-30 |
sp|Q87SS8|LEU3_VIBPA | 3-isopropylmalate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuB PE=3 SV=1 | 46 | 360 | 3.0E-30 |
sp|Q2FWK2|LEU3_STAA8 | 3-isopropylmalate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=leuB PE=3 SV=1 | 46 | 377 | 3.0E-30 |
sp|Q8YCX4|LEU3_BRUME | 3-isopropylmalate dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuB PE=3 SV=1 | 48 | 366 | 3.0E-30 |
sp|Q6LV25|LEU3_PHOPR | 3-isopropylmalate dehydrogenase OS=Photobacterium profundum GN=leuB PE=3 SV=1 | 44 | 362 | 3.0E-30 |
sp|Q32K21|LEU3_SHIDS | 3-isopropylmalate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuB PE=3 SV=2 | 46 | 376 | 3.0E-30 |
sp|O31292|LEU3_BUCTS | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Thelaxes suberi GN=leuB PE=3 SV=1 | 45 | 350 | 3.0E-30 |
sp|Q4KF05|LEU3_PSEF5 | 3-isopropylmalate dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=leuB PE=3 SV=1 | 48 | 366 | 3.0E-30 |
sp|Q579B1|LEU3_BRUAB | 3-isopropylmalate dehydrogenase OS=Brucella abortus biovar 1 (strain 9-941) GN=leuB PE=3 SV=1 | 48 | 366 | 3.0E-30 |
sp|Q2YL58|LEU3_BRUA2 | 3-isopropylmalate dehydrogenase OS=Brucella abortus (strain 2308) GN=leuB PE=3 SV=1 | 48 | 366 | 3.0E-30 |
sp|Q3AIH4|LEU3_SYNSC | 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain CC9605) GN=leuB PE=3 SV=1 | 46 | 331 | 4.0E-30 |
sp|Q97EE2|LEU3_CLOAB | 3-isopropylmalate dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuB PE=3 SV=1 | 46 | 360 | 4.0E-30 |
sp|Q8PH05|LEU3_XANAC | 3-isopropylmalate dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=leuB PE=3 SV=1 | 48 | 373 | 4.0E-30 |
sp|Q7MP78|LEU3_VIBVY | 3-isopropylmalate dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=leuB PE=3 SV=1 | 46 | 363 | 4.0E-30 |
sp|Q3SNU3|LEU3_NITWN | 3-isopropylmalate dehydrogenase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=leuB PE=3 SV=1 | 46 | 377 | 4.0E-30 |
sp|Q3Z5T7|LEU3_SHISS | 3-isopropylmalate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=leuB PE=3 SV=2 | 46 | 376 | 4.0E-30 |
sp|Q88LE5|LEU3_PSEPK | 3-isopropylmalate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=leuB PE=3 SV=1 | 48 | 360 | 5.0E-30 |
sp|P59029|LEU3_THEEB | 3-isopropylmalate dehydrogenase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuB PE=3 SV=1 | 46 | 332 | 5.0E-30 |
sp|Q8DEE0|LEU3_VIBVU | 3-isopropylmalate dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=leuB PE=3 SV=1 | 46 | 363 | 6.0E-30 |
sp|Q21IY5|LEU3_SACD2 | 3-isopropylmalate dehydrogenase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=leuB PE=3 SV=1 | 48 | 332 | 6.0E-30 |
sp|Q48K97|LEU3_PSE14 | 3-isopropylmalate dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=leuB PE=3 SV=1 | 48 | 377 | 6.0E-30 |
sp|A4TE12|LEU3_MYCGI | 3-isopropylmalate dehydrogenase OS=Mycobacterium gilvum (strain PYR-GCK) GN=leuB PE=3 SV=1 | 48 | 333 | 7.0E-30 |
sp|Q8DPJ4|LEU3_STRR6 | 3-isopropylmalate dehydrogenase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=leuB PE=3 SV=1 | 53 | 377 | 7.0E-30 |
sp|Q2JTN8|LEU3_SYNJA | 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuB PE=3 SV=1 | 46 | 360 | 8.0E-30 |
sp|Q4ZUZ4|LEU3_PSEU2 | 3-isopropylmalate dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=leuB PE=3 SV=1 | 48 | 377 | 8.0E-30 |
sp|A4FMQ2|LEU3_SACEN | 3-isopropylmalate dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=leuB PE=3 SV=1 | 48 | 334 | 8.0E-30 |
sp|Q3A3B2|LEU3_PELCD | 3-isopropylmalate dehydrogenase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=leuB PE=3 SV=1 | 46 | 360 | 8.0E-30 |
sp|Q5PDG2|LEU3_SALPA | 3-isopropylmalate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=leuB PE=3 SV=1 | 46 | 376 | 1.0E-29 |
sp|A8L554|LEU3_FRASN | 3-isopropylmalate dehydrogenase OS=Frankia sp. (strain EAN1pec) GN=leuB PE=3 SV=1 | 48 | 334 | 1.0E-29 |
sp|Q30RK2|LEU3_SULDN | 3-isopropylmalate dehydrogenase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=leuB PE=3 SV=1 | 46 | 360 | 1.0E-29 |
sp|Q7NFH4|LEU3_GLOVI | 3-isopropylmalate dehydrogenase OS=Gloeobacter violaceus (strain PCC 7421) GN=leuB PE=3 SV=1 | 43 | 360 | 1.0E-29 |
sp|P73960|LEU3_SYNY3 | 3-isopropylmalate dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuB PE=3 SV=1 | 46 | 360 | 1.0E-29 |
sp|P37412|LEU3_SALTY | 3-isopropylmalate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuB PE=1 SV=2 | 46 | 376 | 1.0E-29 |
sp|Q57TE7|LEU3_SALCH | 3-isopropylmalate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=leuB PE=3 SV=1 | 46 | 376 | 1.0E-29 |
sp|Q3KF21|LEU3_PSEPF | 3-isopropylmalate dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=leuB PE=3 SV=1 | 48 | 366 | 1.0E-29 |
sp|Q9KP82|LEU3_VIBCH | 3-isopropylmalate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuB PE=3 SV=1 | 46 | 363 | 1.0E-29 |
sp|Q7V842|LEU3_PROMM | 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain MIT 9313) GN=leuB PE=3 SV=1 | 46 | 366 | 1.0E-29 |
sp|Q884C0|LEU3_PSESM | 3-isopropylmalate dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=leuB PE=3 SV=1 | 48 | 377 | 1.0E-29 |
sp|Q9FMT1|LEU33_ARATH | 3-isopropylmalate dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana GN=IMDH3 PE=1 SV=1 | 46 | 360 | 2.0E-29 |
sp|Q7N128|LEU3_PHOLL | 3-isopropylmalate dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuB PE=3 SV=1 | 46 | 376 | 2.0E-29 |
sp|Q8Y5R8|LEU3_LISMO | 3-isopropylmalate dehydrogenase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-29 |
sp|Q47WG3|LEU3_COLP3 | 3-isopropylmalate dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuB PE=3 SV=1 | 48 | 360 | 2.0E-29 |
sp|Q2SJD6|LEU3_HAHCH | 3-isopropylmalate dehydrogenase OS=Hahella chejuensis (strain KCTC 2396) GN=leuB PE=3 SV=1 | 48 | 373 | 2.0E-29 |
sp|Q5E857|LEU3_VIBF1 | 3-isopropylmalate dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuB PE=3 SV=1 | 46 | 363 | 2.0E-29 |
sp|A1T6Z4|LEU3_MYCVP | 3-isopropylmalate dehydrogenase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=leuB PE=3 SV=1 | 48 | 333 | 3.0E-29 |
sp|Q3BPJ8|LEU3_XANC5 | 3-isopropylmalate dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=leuB PE=3 SV=1 | 48 | 373 | 4.0E-29 |
sp|P59515|LEU3_BUCBP | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=leuB PE=3 SV=1 | 46 | 374 | 5.0E-29 |
sp|Q3IJS3|LEU3_PSEHT | 3-isopropylmalate dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuB PE=3 SV=1 | 46 | 377 | 5.0E-29 |
sp|Q7NUC2|LEU3_CHRVO | 3-isopropylmalate dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuB PE=3 SV=1 | 48 | 360 | 7.0E-29 |
sp|C0ZXM4|LEU3_RHOE4 | 3-isopropylmalate dehydrogenase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=leuB PE=3 SV=1 | 48 | 367 | 9.0E-29 |
sp|Q6ND82|LEU3_RHOPA | 3-isopropylmalate dehydrogenase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuB PE=3 SV=1 | 46 | 366 | 9.0E-29 |
sp|Q51375|LEU3_PSEAE | 3-isopropylmalate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=leuB PE=3 SV=2 | 48 | 377 | 1.0E-28 |
sp|Q7VH33|LEU3_HELHP | 3-isopropylmalate dehydrogenase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuB PE=3 SV=2 | 48 | 360 | 1.0E-28 |
sp|Q31B91|LEU3_PROM9 | 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain MIT 9312) GN=leuB PE=3 SV=1 | 46 | 365 | 1.0E-28 |
sp|Q8ZIG9|LEU3_YERPE | 3-isopropylmalate dehydrogenase OS=Yersinia pestis GN=leuB PE=3 SV=2 | 46 | 363 | 1.0E-28 |
sp|Q9SA14|LEU31_ARATH | 3-isopropylmalate dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=IMDH1 PE=2 SV=2 | 46 | 360 | 2.0E-28 |
sp|Q9EVE1|LEU3_BUCUD | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon rudbeckiae GN=leuB PE=3 SV=1 | 46 | 360 | 2.0E-28 |
sp|Q71Y34|LEU3_LISMF | 3-isopropylmalate dehydrogenase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-28 |
sp|Q4FRV0|LEU3_PSYA2 | 3-isopropylmalate dehydrogenase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=leuB PE=3 SV=1 | 47 | 360 | 2.0E-28 |
sp|P93832|LEU32_ARATH | 3-isopropylmalate dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=IMDH2 PE=1 SV=1 | 46 | 365 | 2.0E-28 |
sp|Q2IJK7|LEU3_ANADE | 3-isopropylmalate dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=leuB PE=3 SV=1 | 48 | 377 | 2.0E-28 |
sp|Q5H4C7|LEU3_XANOR | 3-isopropylmalate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=leuB PE=3 SV=1 | 48 | 373 | 3.0E-28 |
sp|Q2P762|LEU3_XANOM | 3-isopropylmalate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=leuB PE=3 SV=1 | 48 | 373 | 3.0E-28 |
sp|P29102|LEU3_BRANA | 3-isopropylmalate dehydrogenase, chloroplastic OS=Brassica napus PE=2 SV=1 | 1 | 365 | 3.0E-28 |
sp|Q4FP17|LEU3_PELUB | 3-isopropylmalate dehydrogenase OS=Pelagibacter ubique (strain HTCC1062) GN=leuB PE=3 SV=1 | 48 | 377 | 3.0E-28 |
sp|Q3AYS1|LEU3_SYNS9 | 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain CC9902) GN=leuB PE=3 SV=1 | 46 | 360 | 4.0E-28 |
sp|Q9EVI1|LEU3_BUCUO | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon obscurum GN=leuB PE=3 SV=1 | 46 | 360 | 4.0E-28 |
sp|Q56268|LEU3_ACIFR | 3-isopropylmalate dehydrogenase OS=Acidithiobacillus ferrooxidans GN=leuB PE=1 SV=1 | 48 | 365 | 4.0E-28 |
sp|Q3JCC4|LEU3_NITOC | 3-isopropylmalate dehydrogenase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=leuB PE=3 SV=1 | 48 | 373 | 5.0E-28 |
sp|Q2JL30|LEU3_SYNJB | 3-isopropylmalate dehydrogenase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuB PE=3 SV=1 | 46 | 360 | 5.0E-28 |
sp|Q9HDQ5|LEU3_CANRU | 3-isopropylmalate dehydrogenase OS=Candida rugosa GN=LEU2 PE=3 SV=1 | 47 | 377 | 5.0E-28 |
sp|Q2J3B4|LEU3_RHOP2 | 3-isopropylmalate dehydrogenase OS=Rhodopseudomonas palustris (strain HaA2) GN=leuB PE=3 SV=1 | 46 | 366 | 6.0E-28 |
sp|Q9EVG9|LEU3_BUCUM | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuB PE=3 SV=1 | 46 | 360 | 6.0E-28 |
sp|Q7VQJ7|LEU3_BLOFL | 3-isopropylmalate dehydrogenase OS=Blochmannia floridanus GN=leuB PE=3 SV=1 | 46 | 377 | 6.0E-28 |
sp|Q66EM2|LEU3_YERPS | 3-isopropylmalate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuB PE=3 SV=2 | 46 | 363 | 7.0E-28 |
sp|Q30WD0|LEU3_DESAG | 3-isopropylmalate dehydrogenase OS=Desulfovibrio alaskensis (strain G20) GN=leuB PE=3 SV=1 | 48 | 360 | 7.0E-28 |
sp|P59027|LEU3_BUCPS | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=leuB PE=3 SV=1 | 45 | 376 | 9.0E-28 |
sp|Q3SHL3|LEU3_THIDA | 3-isopropylmalate dehydrogenase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuB PE=3 SV=1 | 48 | 365 | 1.0E-27 |
sp|Q89XA0|LEU31_BRADU | 3-isopropylmalate dehydrogenase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuB1 PE=3 SV=2 | 47 | 331 | 1.0E-27 |
sp|P43860|LEU3_HAEIN | 3-isopropylmalate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuB PE=3 SV=1 | 46 | 365 | 1.0E-27 |
sp|Q5FUG5|LEU3_GLUOX | 3-isopropylmalate dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=leuB PE=3 SV=1 | 46 | 360 | 1.0E-27 |
sp|Q9EVG6|LEU3_BUCUA | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon aeneum GN=leuB PE=3 SV=1 | 46 | 363 | 1.0E-27 |
sp|Q89X19|LEU32_BRADU | 3-isopropylmalate dehydrogenase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuB2 PE=3 SV=1 | 46 | 377 | 2.0E-27 |
sp|Q47HR1|LEU31_DECAR | 3-isopropylmalate dehydrogenase 1 OS=Dechloromonas aromatica (strain RCB) GN=leuB1 PE=3 SV=1 | 48 | 360 | 2.0E-27 |
sp|Q8E9N3|LEU3_SHEON | 3-isopropylmalate dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=leuB PE=1 SV=1 | 46 | 375 | 3.0E-27 |
sp|Q748X2|LEU3_GEOSL | 3-isopropylmalate dehydrogenase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuB PE=3 SV=1 | 45 | 360 | 3.0E-27 |
sp|Q39Y29|LEU3_GEOMG | 3-isopropylmalate dehydrogenase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuB PE=3 SV=1 | 45 | 360 | 3.0E-27 |
sp|O85071|LEU3_BUCDN | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuB PE=3 SV=1 | 46 | 376 | 3.0E-27 |
sp|Q7VC80|LEU3_PROMA | 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuB PE=3 SV=1 | 46 | 360 | 3.0E-27 |
sp|A0QJC2|LEU3_MYCA1 | 3-isopropylmalate dehydrogenase OS=Mycobacterium avium (strain 104) GN=leuB PE=3 SV=1 | 48 | 345 | 4.0E-27 |
sp|Q73VI1|LEU3_MYCPA | 3-isopropylmalate dehydrogenase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=leuB PE=3 SV=1 | 48 | 345 | 4.0E-27 |
sp|Q4QLS3|LEU3_HAEI8 | 3-isopropylmalate dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=leuB PE=3 SV=1 | 46 | 365 | 4.0E-27 |
sp|Q63JL2|LEU3_BURPS | 3-isopropylmalate dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=leuB PE=3 SV=1 | 48 | 373 | 5.0E-27 |
sp|Q3JKG9|LEU3_BURP1 | 3-isopropylmalate dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=leuB PE=3 SV=1 | 48 | 373 | 5.0E-27 |
sp|Q62AI9|LEU3_BURMA | 3-isopropylmalate dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=leuB PE=3 SV=1 | 48 | 373 | 5.0E-27 |
sp|Q393X4|LEU3_BURL3 | 3-isopropylmalate dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuB PE=3 SV=1 | 48 | 360 | 5.0E-27 |
sp|Q9ABN3|LEU3_CAUCR | 3-isopropylmalate dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=leuB PE=3 SV=1 | 47 | 377 | 6.0E-27 |
sp|Q2S0M8|LEU3_SALRD | 3-isopropylmalate dehydrogenase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=leuB PE=3 SV=2 | 46 | 376 | 6.0E-27 |
sp|P24404|LEU3_AGRFC | 3-isopropylmalate dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuB PE=3 SV=2 | 45 | 374 | 6.0E-27 |
sp|Q8P5L1|LEU3_XANCP | 3-isopropylmalate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=leuB PE=3 SV=1 | 48 | 373 | 7.0E-27 |
sp|Q4UYG2|LEU3_XANC8 | 3-isopropylmalate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=leuB PE=3 SV=1 | 48 | 373 | 7.0E-27 |
sp|Q3ZXI7|LEU3_DEHMC | 3-isopropylmalate dehydrogenase OS=Dehalococcoides mccartyi (strain CBDB1) GN=leuB PE=3 SV=1 | 46 | 365 | 8.0E-27 |
sp|Q87BQ1|LEU3_XYLFT | 3-isopropylmalate dehydrogenase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=leuB PE=3 SV=1 | 48 | 373 | 8.0E-27 |
sp|Q9CJN6|LEU3_PASMU | 3-isopropylmalate dehydrogenase OS=Pasteurella multocida (strain Pm70) GN=leuB PE=3 SV=1 | 46 | 360 | 9.0E-27 |
sp|Q2J6V8|LEU3_FRASC | 3-isopropylmalate dehydrogenase OS=Frankia sp. (strain CcI3) GN=leuB PE=3 SV=1 | 48 | 334 | 1.0E-26 |
sp|Q7UIE1|LEU3_RHOBA | 3-isopropylmalate dehydrogenase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=leuB PE=3 SV=2 | 47 | 377 | 1.0E-26 |
sp|Q9PAX3|LEU3_XYLFA | 3-isopropylmalate dehydrogenase OS=Xylella fastidiosa (strain 9a5c) GN=leuB PE=3 SV=1 | 48 | 373 | 1.0E-26 |
sp|P48572|LEU3_BUCRP | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=leuB PE=3 SV=1 | 46 | 360 | 1.0E-26 |
sp|Q1QAF5|LEU3_PSYCK | 3-isopropylmalate dehydrogenase OS=Psychrobacter cryohalolentis (strain K5) GN=leuB PE=3 SV=1 | 47 | 360 | 1.0E-26 |
sp|Q00412|LEU3_ARTPT | 3-isopropylmalate dehydrogenase OS=Arthrospira platensis GN=leuB PE=3 SV=1 | 46 | 353 | 1.0E-26 |
sp|P56933|LEU3_BUCAI | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuB PE=3 SV=2 | 46 | 360 | 1.0E-26 |
sp|Q493R1|LEU3_BLOPB | 3-isopropylmalate dehydrogenase OS=Blochmannia pennsylvanicus (strain BPEN) GN=leuB PE=3 SV=1 | 46 | 375 | 2.0E-26 |
sp|Q92KY8|LEU3_RHIME | 3-isopropylmalate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=leuB PE=3 SV=1 | 45 | 360 | 2.0E-26 |
sp|Q5P1J6|LEU3_AROAE | 3-isopropylmalate dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=leuB PE=3 SV=1 | 48 | 367 | 2.0E-26 |
sp|P31958|LEU3_CLOPA | 3-isopropylmalate dehydrogenase OS=Clostridium pasteurianum GN=leuB PE=3 SV=1 | 46 | 377 | 2.0E-26 |
sp|Q726X1|LEU3_DESVH | 3-isopropylmalate dehydrogenase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuB PE=3 SV=1 | 48 | 360 | 3.0E-26 |
sp|Q606F4|LEU3_METCA | 3-isopropylmalate dehydrogenase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=leuB PE=3 SV=1 | 48 | 373 | 3.0E-26 |
sp|O33117|LEU3_MYCLE | 3-isopropylmalate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=leuB PE=3 SV=1 | 48 | 361 | 5.0E-26 |
sp|B8ZS15|LEU3_MYCLB | 3-isopropylmalate dehydrogenase OS=Mycobacterium leprae (strain Br4923) GN=leuB PE=3 SV=1 | 48 | 361 | 5.0E-26 |
sp|Q8A6M0|LEU3_BACTN | 3-isopropylmalate dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=leuB PE=3 SV=1 | 46 | 360 | 5.0E-26 |
sp|Q6D0G7|LEU3_PECAS | 3-isopropylmalate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuB PE=3 SV=1 | 46 | 364 | 5.0E-26 |
sp|Q1MA50|LEU3_RHIL3 | 3-isopropylmalate dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuB PE=3 SV=1 | 50 | 360 | 5.0E-26 |
sp|Q9EVH8|LEU3_BUCUH | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon helianthicola GN=leuB PE=3 SV=1 | 46 | 360 | 7.0E-26 |
sp|O60027|LEU3_ASHGO | 3-isopropylmalate dehydrogenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEU2 PE=3 SV=1 | 45 | 373 | 7.0E-26 |
sp|Q9EVG3|LEU3_BUCML | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Macrosiphoniella ludovicianae GN=leuB PE=3 SV=1 | 46 | 360 | 7.0E-26 |
sp|Q9EVI7|LEU3_BUCUN | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuB PE=3 SV=1 | 46 | 361 | 1.0E-25 |
sp|Q7V1R9|LEU3_PROMP | 3-isopropylmalate dehydrogenase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuB PE=3 SV=1 | 46 | 360 | 1.0E-25 |
sp|Q845W3|LEU3_BURM1 | 3-isopropylmalate dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=leuB PE=3 SV=1 | 48 | 373 | 1.0E-25 |
sp|Q2T7H6|LEU3_BURTA | 3-isopropylmalate dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuB PE=1 SV=1 | 48 | 373 | 1.0E-25 |
sp|Q28W67|LEU3_JANSC | 3-isopropylmalate dehydrogenase OS=Jannaschia sp. (strain CCS1) GN=leuB PE=3 SV=1 | 47 | 377 | 1.0E-25 |
sp|Q2VZV2|LEU3_MAGSA | 3-isopropylmalate dehydrogenase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuB PE=3 SV=1 | 48 | 360 | 1.0E-25 |
sp|Q1LKH7|LEU3_CUPMC | 3-isopropylmalate dehydrogenase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=leuB PE=3 SV=1 | 48 | 360 | 2.0E-25 |
sp|Q3IZJ3|LEU3_RHOS4 | 3-isopropylmalate dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=leuB PE=3 SV=2 | 47 | 377 | 2.0E-25 |
sp|Q2K2V0|LEU3_RHIEC | 3-isopropylmalate dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuB PE=3 SV=1 | 50 | 360 | 2.0E-25 |
sp|Q2Y7Q8|LEU3_NITMU | 3-isopropylmalate dehydrogenase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=leuB PE=3 SV=1 | 48 | 360 | 2.0E-25 |
sp|Q8XXX5|LEU3_RALSO | 3-isopropylmalate dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=leuB PE=3 SV=2 | 48 | 360 | 5.0E-25 |
sp|P24015|LEU3_LEPIN | 3-isopropylmalate dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuB PE=3 SV=1 | 48 | 366 | 5.0E-25 |
sp|Q72RH7|LEU3_LEPIC | 3-isopropylmalate dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuB PE=3 SV=1 | 48 | 366 | 5.0E-25 |
sp|Q12545|LEU3_ACRCH | 3-isopropylmalate dehydrogenase OS=Acremonium chrysogenum GN=LEU2 PE=3 SV=1 | 46 | 377 | 7.0E-25 |
sp|O85064|LEU3_BUCAP | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=leuB PE=3 SV=1 | 46 | 360 | 8.0E-25 |
sp|P23390|LEU3_KLULA | 3-isopropylmalate dehydrogenase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LEU2 PE=3 SV=2 | 48 | 375 | 9.0E-25 |
sp|Q479H7|LEU32_DECAR | 3-isopropylmalate dehydrogenase 2 OS=Dechloromonas aromatica (strain RCB) GN=leuB2 PE=3 SV=1 | 48 | 360 | 1.0E-24 |
sp|Q2RV53|LEU3_RHORT | 3-isopropylmalate dehydrogenase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuB PE=3 SV=1 | 48 | 360 | 1.0E-24 |
sp|Q46YW0|LEU3_CUPPJ | 3-isopropylmalate dehydrogenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuB PE=3 SV=1 | 48 | 360 | 1.0E-24 |
sp|Q5WPZ9|LEU3_BUCCC | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=leuB PE=3 SV=1 | 46 | 368 | 1.0E-24 |
sp|Q9EVI4|LEU3_BUCUS | 3-isopropylmalate dehydrogenase OS=Buchnera aphidicola subsp. Uroleucon solidaginis GN=leuB PE=3 SV=1 | 46 | 364 | 1.0E-24 |
sp|Q9JU79|LEU3_NEIMA | 3-isopropylmalate dehydrogenase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuB PE=3 SV=1 | 125 | 360 | 2.0E-24 |
sp|Q6PY58|LEU3_CANHU | 3-isopropylmalate dehydrogenase OS=Candida humilis GN=LEU2 PE=3 SV=1 | 47 | 373 | 2.0E-24 |
sp|P96197|LEU3_AZOVI | 3-isopropylmalate dehydrogenase OS=Azotobacter vinelandii GN=leuB PE=3 SV=1 | 48 | 377 | 2.0E-24 |
sp|Q6ANR1|LEU3_DESPS | 3-isopropylmalate dehydrogenase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=leuB PE=3 SV=1 | 48 | 360 | 3.0E-24 |
sp|P04173|LEU3_YEAST | 3-isopropylmalate dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU2 PE=1 SV=4 | 48 | 373 | 4.0E-24 |
sp|Q96WI0|LEU3_ZYGRC | 3-isopropylmalate dehydrogenase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=LEU2 PE=3 SV=1 | 48 | 375 | 4.0E-24 |
sp|Q9JZI9|LEU3_NEIMB | 3-isopropylmalate dehydrogenase OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuB PE=3 SV=1 | 125 | 360 | 5.0E-24 |
sp|P54354|LEU3_BACFR | 3-isopropylmalate dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=leuB PE=3 SV=1 | 46 | 360 | 5.0E-24 |
sp|Q5LAB4|LEU3_BACFN | 3-isopropylmalate dehydrogenase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=leuB PE=3 SV=1 | 46 | 360 | 5.0E-24 |
sp|P07139|LEU3_CANMA | 3-isopropylmalate dehydrogenase OS=Candida maltosa GN=LEU2 PE=3 SV=1 | 47 | 375 | 6.0E-24 |
sp|P41926|LEU3_KODOH | 3-isopropylmalate dehydrogenase OS=Kodamaea ohmeri GN=LEU2 PE=3 SV=1 | 47 | 373 | 9.0E-24 |
sp|Q5F8T6|LEU3_NEIG1 | 3-isopropylmalate dehydrogenase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=leuB PE=3 SV=1 | 125 | 360 | 1.0E-23 |
sp|P34733|LEU3_PICAN | 3-isopropylmalate dehydrogenase OS=Pichia angusta GN=LEU2 PE=3 SV=1 | 48 | 377 | 2.0E-23 |
sp|Q82WI6|LEU3_NITEU | 3-isopropylmalate dehydrogenase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuB PE=3 SV=1 | 48 | 360 | 3.0E-23 |
sp|Q6B458|LEU3_DEBHA | 3-isopropylmalate dehydrogenase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LEU2 PE=3 SV=1 | 47 | 373 | 3.0E-23 |
sp|Q9PLW0|LEU3_CAMJE | 3-isopropylmalate dehydrogenase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuB PE=1 SV=1 | 46 | 377 | 4.0E-23 |
sp|P87186|LEU3_CANAX | 3-isopropylmalate dehydrogenase OS=Candida albicans GN=LEU2 PE=3 SV=1 | 47 | 373 | 6.0E-23 |
sp|Q98E57|LEU3_RHILO | 3-isopropylmalate dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=leuB PE=3 SV=1 | 50 | 360 | 6.0E-23 |
sp|Q9HDQ1|LEU3_WICAO | 3-isopropylmalate dehydrogenase OS=Wickerhamomyces anomalus GN=LEU2 PE=3 SV=1 | 47 | 368 | 1.0E-22 |
sp|Q9P3Y0|LEU3_ZYGBA | 3-isopropylmalate dehydrogenase OS=Zygosaccharomyces bailii GN=LEU2 PE=3 SV=1 | 48 | 375 | 1.0E-22 |
sp|Q01987|LEU3_CANBO | 3-isopropylmalate dehydrogenase OS=Candida boidinii GN=LEU2 PE=3 SV=1 | 48 | 377 | 2.0E-22 |
sp|P08791|LEU3_CYBJA | 3-isopropylmalate dehydrogenase OS=Cyberlindnera jadinii GN=LEU2 PE=3 SV=1 | 47 | 373 | 4.0E-22 |
sp|P18869|LEU3_SCHPO | 3-isopropylmalate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu1 PE=1 SV=1 | 48 | 377 | 4.0E-22 |
sp|P50180|LEU3_NEILA | 3-isopropylmalate dehydrogenase (Fragment) OS=Neisseria lactamica GN=leuB PE=3 SV=1 | 125 | 332 | 5.0E-22 |
sp|O94114|LEU3_PICST | 3-isopropylmalate dehydrogenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LEU2 PE=3 SV=3 | 47 | 374 | 9.0E-22 |
sp|Q5HS77|LEU3_CAMJR | 3-isopropylmalate dehydrogenase OS=Campylobacter jejuni (strain RM1221) GN=leuB PE=3 SV=1 | 46 | 377 | 1.0E-21 |
sp|Q96WT9|LEU3_SACEX | 3-isopropylmalate dehydrogenase OS=Saccharomyces exiguus GN=LEU2 PE=3 SV=1 | 39 | 375 | 1.0E-21 |
sp|P50214|IDH_NOSS1 | Isocitrate dehydrogenase [NADP] OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=icd PE=3 SV=1 | 17 | 377 | 2.0E-21 |
sp|O14429|LEU3_CANGA | 3-isopropylmalate dehydrogenase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LEU2 PE=3 SV=2 | 47 | 375 | 2.0E-21 |
sp|Q7WNM3|LEU31_BORBR | 3-isopropylmalate dehydrogenase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuB1 PE=3 SV=1 | 48 | 331 | 2.0E-21 |
sp|P18120|LEU3_YARLI | 3-isopropylmalate dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LEU2 PE=3 SV=2 | 125 | 368 | 3.0E-21 |
sp|P41766|LEU3_KLUMA | 3-isopropylmalate dehydrogenase OS=Kluyveromyces marxianus GN=LEU2 PE=3 SV=1 | 48 | 375 | 5.0E-21 |
sp|Q6TWC4|LEU3_SORMA | 3-isopropylmalate dehydrogenase OS=Sordaria macrospora GN=LEU1 PE=3 SV=1 | 134 | 377 | 1.0E-20 |
sp|P87257|LEU3B_ASPNG | 3-isopropylmalate dehydrogenase B OS=Aspergillus niger GN=leu2B PE=2 SV=1 | 46 | 377 | 1.0E-19 |
sp|P87256|LEU3A_ASPNG | 3-isopropylmalate dehydrogenase A OS=Aspergillus niger GN=leu2A PE=2 SV=1 | 134 | 377 | 2.0E-19 |
sp|Q9Y897|LEU3_ZYMTR | 3-isopropylmalate dehydrogenase OS=Zymoseptoria tritici GN=LEUC PE=3 SV=1 | 46 | 377 | 3.0E-19 |
sp|P34738|LEU3_NEUCR | 3-isopropylmalate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-1 PE=3 SV=2 | 134 | 377 | 4.0E-19 |
sp|Q3Z896|LEU3_DEHM1 | 3-isopropylmalate dehydrogenase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=leuB PE=3 SV=1 | 46 | 361 | 5.0E-19 |
sp|Q8NKB8|LEU3_BLAAD | 3-isopropylmalate dehydrogenase OS=Blastobotrys adeninivorans GN=LEU2 PE=3 SV=1 | 48 | 373 | 5.0E-19 |
sp|O59930|LEU3_PHACH | 3-isopropylmalate dehydrogenase OS=Phanerochaete chrysosporium GN=LEU2 PE=2 SV=1 | 46 | 369 | 2.0E-18 |
sp|P80046|IDH_SYNY3 | Isocitrate dehydrogenase [NADP] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=icd PE=1 SV=2 | 23 | 342 | 2.0E-17 |
sp|Q9AQC8|LEU3_BUCUL | 3-isopropylmalate dehydrogenase (Fragment) OS=Buchnera aphidicola subsp. Uroleucon rurale GN=leuB PE=3 SV=1 | 260 | 360 | 2.0E-10 |
sp|P86225|IDH3A_MESAU | Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (Fragments) OS=Mesocricetus auratus GN=IDH3A PE=1 SV=1 | 67 | 175 | 4.0E-09 |
sp|P56471|IDH3A_PIG | Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (Fragments) OS=Sus scrofa GN=IDH3A PE=1 SV=1 | 43 | 76 | 3.0E-06 |
sp|P56472|IDH3B_PIG | Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial (Fragments) OS=Sus scrofa GN=IDH3B PE=1 SV=1 | 259 | 377 | 4.0E-06 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 19 | 0.45 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 95.20 | 54.35 | 136.06 |
Initials | Initials knots | 65.50 | 38.58 | 92.41 |
Pileal_Stipeal_center | Stage I stipe center | 177.62 | 103.06 | 252.19 |
Pileal_Stipeal_shell | Stage I stipe shell | 276.22 | 150.82 | 401.62 |
DIF_stipe_center | Stage II stipe center | 213.26 | 125.45 | 301.07 |
DIF_stipe_shell | Stage II stipe shell | 165.44 | 98.55 | 232.32 |
DIF_stipe_skin | Stage II stipe skin | 177.94 | 105.67 | 250.21 |
DIF_cap_skin | Stage II cap skin | 330.62 | 185.10 | 476.13 |
DIF_cap_tissue | Stage II cap tissue | 295.37 | 169.36 | 421.38 |
DIF_gill_tissue | Stage II gill tissue | 294.04 | 167.36 | 420.72 |
YFB_stipe_center | Young fruiting body stipe center | 153.57 | 90.41 | 216.74 |
YFB_stipe_shell | Young fruiting body stipe shell | 141.79 | 84.62 | 198.97 |
YFB_stipe_skin | Young fruiting body stipe skin | 156.81 | 93.50 | 220.12 |
YFB_cap_skin | Young fruiting body cap skin | 258.67 | 150.01 | 367.33 |
YFB_cap_tissue | Young fruiting body cap tissue | 226.05 | 132.28 | 319.82 |
YFB_gill_tissue | Young fruiting body gill tissue | 236.08 | 137.00 | 335.15 |
YFB_veil | Young fruiting body veil | 288.95 | 163.10 | 414.80 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.000613 | yes |
Casing | YFB_stipe_center | 0.101059 | no |
Casing | YFB_stipe_shell | 0.190974 | no |
Casing | YFB_stipe_skin | 0.078590 | no |
Casing | YFB_cap_skin | 0.000613 | yes |
Casing | YFB_cap_tissue | 0.001140 | yes |
Casing | YFB_gill_tissue | 0.001140 | yes |
Casing | YFB_veil | 0.000613 | yes |
Casing | Initials | 0.230656 | no |
Casing | Pileal_Stipeal_center | 0.025458 | yes |
Casing | Pileal_Stipeal_shell | 0.000613 | yes |
Casing | DIF_stipe_center | 0.002084 | yes |
Casing | DIF_stipe_shell | 0.046117 | yes |
Casing | DIF_stipe_skin | 0.019169 | yes |
Casing | DIF_cap_skin | 0.000613 | yes |
Casing | DIF_cap_tissue | 0.000613 | yes |
DIF_gill_tissue | YFB_stipe_center | 0.018344 | yes |
DIF_gill_tissue | YFB_stipe_shell | 0.006387 | yes |
DIF_gill_tissue | YFB_stipe_skin | 0.023415 | yes |
DIF_gill_tissue | YFB_cap_skin | 0.787031 | no |
DIF_gill_tissue | YFB_cap_tissue | 0.466797 | no |
DIF_gill_tissue | YFB_gill_tissue | 0.575097 | no |
DIF_gill_tissue | YFB_veil | 0.977215 | no |
YFB_stipe_center | YFB_stipe_shell | 0.873571 | no |
YFB_stipe_center | YFB_stipe_skin | 0.969427 | no |
YFB_stipe_center | YFB_cap_skin | 0.062610 | no |
YFB_stipe_center | YFB_cap_tissue | 0.205535 | no |
YFB_stipe_center | YFB_gill_tissue | 0.146853 | no |
YFB_stipe_center | YFB_veil | 0.021583 | yes |
YFB_stipe_shell | YFB_stipe_skin | 0.829818 | no |
YFB_stipe_shell | YFB_cap_skin | 0.026710 | yes |
YFB_stipe_shell | YFB_cap_tissue | 0.098108 | no |
YFB_stipe_shell | YFB_gill_tissue | 0.070317 | no |
YFB_stipe_shell | YFB_veil | 0.006032 | yes |
YFB_stipe_skin | YFB_cap_skin | 0.075016 | no |
YFB_stipe_skin | YFB_cap_tissue | 0.230883 | no |
YFB_stipe_skin | YFB_gill_tissue | 0.169322 | no |
YFB_stipe_skin | YFB_veil | 0.022892 | yes |
YFB_cap_skin | YFB_cap_tissue | 0.761216 | no |
YFB_cap_skin | YFB_gill_tissue | 0.857461 | no |
YFB_cap_skin | YFB_veil | 0.817661 | no |
YFB_cap_tissue | YFB_gill_tissue | 0.938190 | no |
YFB_cap_tissue | YFB_veil | 0.497939 | no |
YFB_gill_tissue | YFB_veil | 0.609135 | no |
Initials | DIF_gill_tissue | 0.000613 | yes |
Initials | YFB_stipe_center | 0.001140 | yes |
Initials | YFB_stipe_shell | 0.002525 | yes |
Initials | YFB_stipe_skin | 0.000613 | yes |
Initials | YFB_cap_skin | 0.000613 | yes |
Initials | YFB_cap_tissue | 0.000613 | yes |
Initials | YFB_gill_tissue | 0.000613 | yes |
Initials | YFB_veil | 0.000613 | yes |
Initials | Pileal_Stipeal_center | 0.000613 | yes |
Initials | Pileal_Stipeal_shell | 0.000613 | yes |
Initials | DIF_stipe_center | 0.000613 | yes |
Initials | DIF_stipe_shell | 0.000613 | yes |
Initials | DIF_stipe_skin | 0.000613 | yes |
Initials | DIF_cap_skin | 0.000613 | yes |
Initials | DIF_cap_tissue | 0.000613 | yes |
Pileal_Stipeal_center | DIF_gill_tissue | 0.091161 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.741698 | no |
Pileal_Stipeal_center | YFB_stipe_shell | 0.542506 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 0.781394 | no |
Pileal_Stipeal_center | YFB_cap_skin | 0.228362 | no |
Pileal_Stipeal_center | YFB_cap_tissue | 0.507364 | no |
Pileal_Stipeal_center | YFB_gill_tissue | 0.414707 | no |
Pileal_Stipeal_center | YFB_veil | 0.101059 | no |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.162901 | no |
Pileal_Stipeal_center | DIF_stipe_center | 0.658352 | no |
Pileal_Stipeal_center | DIF_stipe_shell | 0.888562 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 0.997161 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.032504 | yes |
Pileal_Stipeal_center | DIF_cap_tissue | 0.080883 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.912650 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.040058 | yes |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.016949 | yes |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.048007 | yes |
Pileal_Stipeal_shell | YFB_cap_skin | 0.908153 | no |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.622766 | no |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.729556 | no |
Pileal_Stipeal_shell | YFB_veil | 0.940086 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.488685 | no |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.078590 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.147674 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.686330 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.902778 | no |
DIF_stipe_center | DIF_gill_tissue | 0.334887 | no |
DIF_stipe_center | YFB_stipe_center | 0.305510 | no |
DIF_stipe_center | YFB_stipe_shell | 0.163166 | no |
DIF_stipe_center | YFB_stipe_skin | 0.340971 | no |
DIF_stipe_center | YFB_cap_skin | 0.625211 | no |
DIF_stipe_center | YFB_cap_tissue | 0.910605 | no |
DIF_stipe_center | YFB_gill_tissue | 0.832444 | no |
DIF_stipe_center | YFB_veil | 0.371656 | no |
DIF_stipe_center | DIF_stipe_shell | 0.466295 | no |
DIF_stipe_center | DIF_stipe_skin | 0.645785 | no |
DIF_stipe_center | DIF_cap_skin | 0.154255 | no |
DIF_stipe_center | DIF_cap_tissue | 0.316051 | no |
DIF_stipe_shell | DIF_gill_tissue | 0.037818 | yes |
DIF_stipe_shell | YFB_stipe_center | 0.882038 | no |
DIF_stipe_shell | YFB_stipe_shell | 0.705949 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.918037 | no |
DIF_stipe_shell | YFB_cap_skin | 0.117172 | no |
DIF_stipe_shell | YFB_cap_tissue | 0.327925 | no |
DIF_stipe_shell | YFB_gill_tissue | 0.249412 | no |
DIF_stipe_shell | YFB_veil | 0.038047 | yes |
DIF_stipe_shell | DIF_stipe_skin | 0.881561 | no |
DIF_stipe_shell | DIF_cap_skin | 0.010093 | yes |
DIF_stipe_shell | DIF_cap_tissue | 0.027451 | yes |
DIF_stipe_skin | DIF_gill_tissue | 0.080179 | no |
DIF_stipe_skin | YFB_stipe_center | 0.732211 | no |
DIF_stipe_skin | YFB_stipe_shell | 0.530481 | no |
DIF_stipe_skin | YFB_stipe_skin | 0.773049 | no |
DIF_stipe_skin | YFB_cap_skin | 0.221592 | no |
DIF_stipe_skin | YFB_cap_tissue | 0.502877 | no |
DIF_stipe_skin | YFB_gill_tissue | 0.408596 | no |
DIF_stipe_skin | YFB_veil | 0.092330 | no |
DIF_stipe_skin | DIF_cap_skin | 0.027943 | yes |
DIF_stipe_skin | DIF_cap_tissue | 0.071598 | no |
DIF_cap_skin | DIF_gill_tissue | 0.807579 | no |
DIF_cap_skin | YFB_stipe_center | 0.003765 | yes |
DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
DIF_cap_skin | YFB_stipe_skin | 0.004928 | yes |
DIF_cap_skin | YFB_cap_skin | 0.511895 | no |
DIF_cap_skin | YFB_cap_tissue | 0.235278 | no |
DIF_cap_skin | YFB_gill_tissue | 0.314520 | no |
DIF_cap_skin | YFB_veil | 0.769731 | no |
DIF_cap_skin | DIF_cap_tissue | 0.813553 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.993056 | no |
DIF_cap_tissue | YFB_stipe_center | 0.009773 | yes |
DIF_cap_tissue | YFB_stipe_shell | 0.004160 | yes |
DIF_cap_tissue | YFB_stipe_skin | 0.014956 | yes |
DIF_cap_tissue | YFB_cap_skin | 0.770030 | no |
DIF_cap_tissue | YFB_cap_tissue | 0.440020 | no |
DIF_cap_tissue | YFB_gill_tissue | 0.549853 | no |
DIF_cap_tissue | YFB_veil | 0.969315 | no |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|070890 MASVLRHNLAAFLRPAISQPTRSATTLSAGFPKVTQRPTTKYGGVYTVTLIPGDGIGAEITDSVKEIFEHVNAPI EWEQYNVSGVSSSGEALFNQAMESLKRNRVGLKGILFTPISQSGHISWNVAMRQQLDIYASVVLCKSLPGHPTRH SNVDFAIIRENTEGEYSGLEHQSYPGVVESLKVSTRAKAERISRFAFDFALKNGRKKVTCVHKANIMKLGDGLFL NTFRRVAEEYKSSGIEFNDMIVDNTSMQLVARPGQFDVMVMPNLYGAIVSNIGAALVGGPGIVPGCNVGREYALF EPGCRHVASDIMGTNRANPTAMVLSATMMLRHLGLDSIANSIASATFDVINEGKVRTADMGGSATTSDFTAAILK RL* |
Coding | >AgabiH97|070890 ATGGCCTCCGTCCTACGTCACAATCTCGCTGCCTTCCTCCGTCCTGCTATTTCCCAGCCTACCCGTTCCGCAACC ACCCTATCCGCCGGCTTCCCAAAAGTCACCCAGCGTCCCACGACCAAGTATGGTGGAGTGTACACCGTAACCCTA ATCCCCGGTGATGGCATTGGTGCAGAGATCACAGACTCGGTGAAGGAAATTTTTGAACATGTGAATGCTCCCATT GAGTGGGAGCAGTACAATGTCTCCGGCGTGTCCTCGTCCGGTGAGGCACTCTTTAATCAGGCCATGGAGAGTCTC AAACGCAATCGCGTTGGACTCAAGGGTATTCTCTTCACTCCCATTTCACAGTCGGGACACATCTCGTGGAATGTG GCTATGCGTCAACAACTTGATATTTATGCCTCTGTGGTTCTCTGCAAGTCCCTCCCTGGACACCCCACCCGCCAC TCTAACGTTGACTTCGCCATTATTCGTGAAAATACTGAGGGTGAATACTCCGGACTTGAGCACCAGAGCTACCCT GGTGTTGTTGAGAGCTTGAAAGTTTCTACCAGGGCAAAAGCCGAACGTATCTCCCGCTTTGCCTTTGACTTTGCC TTGAAAAATGGCCGGAAGAAAGTTACTTGCGTTCACAAAGCCAACATCATGAAGCTTGGTGATGGTCTTTTCCTC AATACCTTCCGTCGTGTGGCAGAAGAGTATAAATCCTCCGGCATCGAGTTCAATGATATGATTGTTGACAATACT TCCATGCAGCTTGTTGCCCGTCCCGGTCAATTTGATGTCATGGTCATGCCCAACCTTTATGGGGCTATCGTTTCT AACATCGGTGCCGCGCTCGTTGGTGGACCCGGTATCGTCCCGGGCTGCAACGTCGGAAGGGAATACGCGTTATTT GAGCCTGGTTGCCGACATGTCGCAAGCGATATAATGGGCACTAACCGCGCGAATCCCACCGCAATGGTCTTAAGT GCCACGATGATGCTCCGCCATCTTGGGTTGGATTCAATTGCCAACAGCATCGCCAGCGCTACGTTTGATGTCATT AACGAAGGAAAAGTCAGGACAGCCGATATGGGTGGATCTGCCACGACTTCGGATTTCACAGCTGCCATTCTCAAG CGTTTGTAA |
Transcript | >AgabiH97|070890 ATGGCCTCCGTCCTACGTCACAATCTCGCTGCCTTCCTCCGTCCTGCTATTTCCCAGCCTACCCGTTCCGCAACC ACCCTATCCGCCGGCTTCCCAAAAGTCACCCAGCGTCCCACGACCAAGTATGGTGGAGTGTACACCGTAACCCTA ATCCCCGGTGATGGCATTGGTGCAGAGATCACAGACTCGGTGAAGGAAATTTTTGAACATGTGAATGCTCCCATT GAGTGGGAGCAGTACAATGTCTCCGGCGTGTCCTCGTCCGGTGAGGCACTCTTTAATCAGGCCATGGAGAGTCTC AAACGCAATCGCGTTGGACTCAAGGGTATTCTCTTCACTCCCATTTCACAGTCGGGACACATCTCGTGGAATGTG GCTATGCGTCAACAACTTGATATTTATGCCTCTGTGGTTCTCTGCAAGTCCCTCCCTGGACACCCCACCCGCCAC TCTAACGTTGACTTCGCCATTATTCGTGAAAATACTGAGGGTGAATACTCCGGACTTGAGCACCAGAGCTACCCT GGTGTTGTTGAGAGCTTGAAAGTTTCTACCAGGGCAAAAGCCGAACGTATCTCCCGCTTTGCCTTTGACTTTGCC TTGAAAAATGGCCGGAAGAAAGTTACTTGCGTTCACAAAGCCAACATCATGAAGCTTGGTGATGGTCTTTTCCTC AATACCTTCCGTCGTGTGGCAGAAGAGTATAAATCCTCCGGCATCGAGTTCAATGATATGATTGTTGACAATACT TCCATGCAGCTTGTTGCCCGTCCCGGTCAATTTGATGTCATGGTCATGCCCAACCTTTATGGGGCTATCGTTTCT AACATCGGTGCCGCGCTCGTTGGTGGACCCGGTATCGTCCCGGGCTGCAACGTCGGAAGGGAATACGCGTTATTT GAGCCTGGTTGCCGACATGTCGCAAGCGATATAATGGGCACTAACCGCGCGAATCCCACCGCAATGGTCTTAAGT GCCACGATGATGCTCCGCCATCTTGGGTTGGATTCAATTGCCAACAGCATCGCCAGCGCTACGTTTGATGTCATT AACGAAGGAAAAGTCAGGACAGCCGATATGGGTGGATCTGCCACGACTTCGGATTTCACAGCTGCCATTCTCAAG CGTTTGTAA |
Gene | >AgabiH97|070890 ATGGCCTCCGTCCTACGTCACAATCTCGCTGCCTTCCTCCGTCCTGCTATTTCCCAGCCTACCGTGCGCCCATGT CTTTCTCCGTCTGACTCCCGTTAATTCTATCTTTAGCGTTCCGCAACCACCCTATCCGCCGGCTTCCCAAAAGTC ACCCAGCGTGCATGTCTCCTAGTTTTTGTCTTTTTTTTCTTGCTGCTAAATATCATCTAGCCCACGACCAAGTAT GGTGGAGTGTACACCGTATGTTCTTGCCACATTAGCTACATCTTGAATCGGTCTTGACAATAGGTCAAGGTAACC CTAATCCCCGGTGATGGCATTGGTGCAGAGATCACAGACTCGGTGAAGGAAATTTTTGAACATGTGAATGCTCCC ATTGAGTGGGAGCAGTACAATGTCTCCGGCGTGTCCTCGTCCGGTGAGGCACTCTTTAATCAGGCCATGGAGAGT CTCAAACGCAATCGCGTTGGACTCAAGGGTGAGCGAACTCCGGTAATATATGCTGCGAAAGCTTATCTCCGGCAG GTATTCTCTTCACTCCCATTTCACAGTCGGGACACATCTCGTGGAATGTGGCTATGCGTCAACAACTTGATATTT ATGCCTCTGTGGTTCTCTGCAAGTCCCTCCCTGGACACCCCACCCGCCACTCTAACGTTGACTTCGCCATTATTC GTGAAAATACTGAGGGTGAATACTCCGGACTTGAGCACCAGAGCTACCCTGGTGTTGTTGAGAGCTTGAAAGTTT CTACCAGGGCAAAAGCCGAACGTATCTCCCGCTTTGCCTTTGACTTTGCCTTGAAAAATGGCCGGAAGGTAATTT CAGACTCTGGTCTATCATAGTCATGTTTTATTCATTTGTTACGCTAGAAAGTTACTTGCGTTCACAAAGCCAACA TCATGAAGCTTGGTGATGGTCTTTTCCTCAATACCTTCCGTCGTGTGGCAGAAGAGTATAAATCCTCCGGCATCG AGTTCAATGATATGATTGTTGACAATACGTAGGTCGAGCTCTTTCCTACCACTCATGTTTGTTGACGAAAGAAAA AATAGTTCCATGCAGCTTGTTGCCCGTCCCGGTCAATTTGATGTCATGGTCATGCCCAACCTTTATGGGGCTATC GTTTCTAACATCGGTGCCGCGCTCGTTGGTGGACCCGGTATCGTCCCGGGCTGCAACGTCGGAAGGGTTCGTGAC TCATTTCAGCGCATATGTCATCGTACCCACATCTCGCTTATGAATAGGAATACGCGTTATTTGAGCCTGGTTGCC GACATGTCGCAAGCGATATAATGGGCACTAACCGCGCGAATCCCACCGCAATGGTCTTAAGTGCCACGATGATGC TCCGCCATCTTGGGTAATCGGCAATCTTTCCTTGGCAGTCTCGGTTCAGCTTACTAACGAAGCTTCAAGGTTGGA TTCAATTGCCAACAGCATCGCCAGCGCTACGTTTGATGTCATTAACGAAGGAAAAGTCAGGACAGCCGATATGGG TGGTGAGTTCTCAACACAGTGAATTGGTGGTTTCCCTCATGCACAATTATCAGGATCTGCCACGACTTCGGATTT CACAGCTGCCATTCTCAAGCGTTTGTAA |