Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070810
Gene name
Locationscaffold_4:1365160..1367626
Strand-
Gene length (bp)2466
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 2.0E-18 284 383
PF00153 Mito_carr Mitochondrial carrier protein 1.9E-17 393 481
PF00153 Mito_carr Mitochondrial carrier protein 7.0E-21 489 578
PF13405 EF-hand_6 EF-hand domain 3.2E-06 119 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 85 580 1.0E-88
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 104 580 6.0E-69
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 113 580 3.0E-67
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 286 580 9.0E-67
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 122 580 1.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 85 580 1.0E-88
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 104 580 6.0E-69
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 113 580 3.0E-67
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 286 580 9.0E-67
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 122 580 1.0E-66
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 104 580 7.0E-66
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 116 579 3.0E-65
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 92 580 5.0E-65
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 122 580 6.0E-65
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 116 579 1.0E-64
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 122 580 2.0E-64
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 117 580 2.0E-64
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 104 580 4.0E-63
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 104 580 4.0E-63
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 104 580 4.0E-62
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 104 580 2.0E-61
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 104 580 5.0E-61
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 273 580 5.0E-61
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 273 580 2.0E-60
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 273 580 3.0E-60
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 273 580 9.0E-60
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 273 580 9.0E-60
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 287 580 7.0E-59
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 285 580 7.0E-48
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 123 580 7.0E-47
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 283 580 1.0E-46
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 261 580 6.0E-46
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 263 572 1.0E-39
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 287 580 1.0E-37
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 285 525 2.0E-37
sp|D6W196|CMC1_YEAST Truncated non-functional calcium-binding mitochondrial carrier SAL1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAL1 PE=1 SV=2 85 488 2.0E-37
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 269 575 1.0E-34
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 283 578 2.0E-34
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 269 578 4.0E-34
sp|O13805|YE08_SCHPO Uncharacterized mitochondrial carrier C17H9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.08 PE=3 SV=1 268 580 5.0E-34
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 277 575 3.0E-33
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 269 575 8.0E-33
sp|Q9LV81|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 285 580 4.0E-29
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 298 579 7.0E-29
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 284 576 2.0E-28
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 287 572 2.0E-28
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 284 576 7.0E-28
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 284 576 1.0E-27
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 287 578 1.0E-27
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 269 572 2.0E-27
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 287 573 7.0E-27
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 269 572 2.0E-26
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 269 572 2.0E-26
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 281 577 5.0E-26
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 288 580 1.0E-25
sp|Q9LJX5|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 285 578 2.0E-25
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 282 578 5.0E-25
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 287 572 5.0E-25
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 282 578 1.0E-24
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 287 578 7.0E-24
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 269 572 7.0E-24
sp|Q5U3V7|S2543_DANRE Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 280 576 9.0E-24
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 282 578 1.0E-23
sp|P31692|ADT_PARKE ADP,ATP carrier protein OS=Parachlorella kessleri PE=3 SV=1 287 576 2.0E-23
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 287 580 2.0E-23
sp|Q8R0Y8|S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus GN=Slc25a42 PE=1 SV=1 287 572 2.0E-23
sp|P0C546|S2542_RAT Mitochondrial coenzyme A transporter SLC25A42 OS=Rattus norvegicus GN=Slc25a42 PE=2 SV=1 287 572 3.0E-23
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 284 568 5.0E-23
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 282 578 8.0E-23
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 285 578 8.0E-23
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 280 576 1.0E-22
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 285 578 2.0E-22
sp|Q9FM86|ADT5_ARATH Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana GN=At5g56450 PE=2 SV=1 266 578 3.0E-22
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 289 578 3.0E-22
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 298 579 3.0E-22
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 284 579 4.0E-22
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 287 575 5.0E-22
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 249 578 1.0E-21
sp|Q8WUT9|S2543_HUMAN Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 287 576 6.0E-21
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 279 573 2.0E-20
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 287 572 4.0E-20
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 282 578 6.0E-20
sp|Q9C9R4|BRTL2_ARATH Probable mitochondrial adenine nucleotide transporter BTL2 OS=Arabidopsis thaliana GN=At1g78180 PE=2 SV=1 285 580 7.0E-20
sp|Q5R5A1|ADT2_PONAB ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 287 576 9.0E-20
sp|Q8SQH5|ADT2_BOVIN ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 287 576 2.0E-19
sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 287 576 2.0E-19
sp|Q09073|ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 287 576 2.0E-19
sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 287 576 2.0E-19
sp|O97470|ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum GN=ancA PE=1 SV=1 268 579 4.0E-19
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 287 580 9.0E-19
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 287 574 1.0E-18
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 279 572 2.0E-18
sp|Q3TZX3|S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 279 579 2.0E-18
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 287 559 2.0E-18
sp|O46373|ADT1_RABIT ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 284 576 3.0E-18
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 280 578 3.0E-18
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 287 578 3.0E-18
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 287 559 3.0E-18
sp|Q05962|ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 284 576 4.0E-18
sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 284 576 6.0E-18
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 299 578 6.0E-18
sp|Q9BSK2|S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 279 572 7.0E-18
sp|P32007|ADT3_BOVIN ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 287 576 8.0E-18
sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 284 576 8.0E-18
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 287 580 1.0E-17
sp|Q000K2|ADT2_TACAC ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 287 576 1.0E-17
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 287 578 1.0E-17
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 271 578 1.0E-17
sp|Q0UUH1|TPC1_PHANO Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 285 580 2.0E-17
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 287 578 2.0E-17
sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 284 576 2.0E-17
sp|Q91XD8|S2538_MOUSE Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 243 580 4.0E-17
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 239 578 4.0E-17
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 280 578 4.0E-17
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 280 573 5.0E-17
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 278 572 5.0E-17
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 271 572 6.0E-17
sp|Q27238|ADT1_ANOGA ADP,ATP carrier protein 1 OS=Anopheles gambiae GN=AGAP006782 PE=2 SV=2 287 579 7.0E-17
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 388 576 8.0E-17
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 389 576 1.0E-16
sp|Q6QRN9|ADT3_PIG ADP/ATP translocase 3 OS=Sus scrofa GN=SLC25A6 PE=2 SV=3 287 576 1.0E-16
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 271 572 2.0E-16
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 394 578 2.0E-16
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 400 576 3.0E-16
sp|O94370|YG04_SCHPO Uncharacterized mitochondrial carrier C1604.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.04 PE=3 SV=2 286 578 3.0E-16
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 284 576 4.0E-16
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 278 572 5.0E-16
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 266 574 7.0E-16
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 84 576 7.0E-16
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 282 576 1.0E-15
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 282 576 1.0E-15
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 385 576 2.0E-15
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 283 578 2.0E-15
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 287 574 2.0E-15
sp|P04710|ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 279 566 3.0E-15
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 283 568 3.0E-15
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 283 568 3.0E-15
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 283 568 3.0E-15
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 84 576 3.0E-15
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 283 568 4.0E-15
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 386 580 5.0E-15
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 287 573 6.0E-15
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 279 566 6.0E-15
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 247 580 6.0E-15
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 287 578 7.0E-15
sp|Q6FTE5|TPC1_CANGA Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPC1 PE=3 SV=1 271 579 8.0E-15
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 266 578 9.0E-15
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 392 571 1.0E-14
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 215 578 1.0E-14
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 389 576 1.0E-14
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 339 575 1.0E-14
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 287 572 1.0E-14
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 392 571 2.0E-14
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 279 578 2.0E-14
sp|P02723|ADT_NEUCR ADP,ATP carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aac PE=3 SV=1 287 566 2.0E-14
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 339 575 2.0E-14
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 392 571 3.0E-14
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 284 572 3.0E-14
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 281 576 3.0E-14
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 395 576 4.0E-14
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 282 576 4.0E-14
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 291 572 4.0E-14
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 369 578 4.0E-14
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 339 576 5.0E-14
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 331 575 6.0E-14
sp|Q499U1|S2538_RAT Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 243 580 6.0E-14
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 272 574 7.0E-14
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 339 576 7.0E-14
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 278 572 7.0E-14
sp|P18239|ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 287 566 9.0E-14
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 392 571 1.0E-13
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 84 576 1.0E-13
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 288 578 1.0E-13
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 287 574 1.0E-13
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 270 572 1.0E-13
sp|P34519|TXTP_CAEEL Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 339 572 2.0E-13
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 287 578 2.0E-13
sp|Q12289|CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 283 574 2.0E-13
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 95 476 3.0E-13
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 287 571 4.0E-13
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 278 572 4.0E-13
sp|Q26365|ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster GN=sesB PE=2 SV=4 241 578 4.0E-13
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 283 477 5.0E-13
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 389 576 5.0E-13
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 287 578 7.0E-13
sp|Q7PQV7|ADT2_ANOGA ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 289 578 8.0E-13
sp|Q08DK4|GHC1_BOVIN Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 287 571 8.0E-13
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 287 578 9.0E-13
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 284 572 1.0E-12
sp|P27080|ADT_CHLRE ADP,ATP carrier protein OS=Chlamydomonas reinhardtii GN=ABT PE=2 SV=1 287 566 1.0E-12
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 288 579 1.0E-12
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 339 576 1.0E-12
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 400 572 2.0E-12
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 389 576 2.0E-12
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 339 576 2.0E-12
sp|A7TDX5|TPC1_VANPO Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 271 578 2.0E-12
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 278 572 2.0E-12
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 331 575 2.0E-12
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 287 578 3.0E-12
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 389 576 3.0E-12
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 287 579 3.0E-12
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 339 576 4.0E-12
sp|O13660|YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 341 573 4.0E-12
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 339 575 4.0E-12
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 299 576 5.0E-12
sp|P53320|MTM1_YEAST Mitochondrial carrier protein MTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTM1 PE=1 SV=1 339 579 5.0E-12
sp|Q75EP3|TPC1_ASHGO Mitochondrial thiamine pyrophosphate carrier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPC1 PE=3 SV=1 272 578 6.0E-12
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 287 571 8.0E-12
sp|P31691|ADT_ORYSJ ADP,ATP carrier protein, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0718900 PE=2 SV=1 287 566 8.0E-12
sp|Q09188|ADT_SCHPO ADP,ATP carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=anc1 PE=2 SV=1 287 566 9.0E-12
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 339 576 9.0E-12
sp|P27081|ADT2_SOLTU ADP,ATP carrier protein, mitochondrial (Fragment) OS=Solanum tuberosum GN=ANT1 PE=2 SV=1 287 566 9.0E-12
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 386 579 1.0E-11
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 284 578 1.0E-11
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 396 578 1.0E-11
sp|Q41629|ADT1_WHEAT ADP,ATP carrier protein 1, mitochondrial OS=Triticum aestivum GN=ANT-G1 PE=3 SV=1 280 566 1.0E-11
sp|Q9H936|GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 287 571 1.0E-11
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 281 580 1.0E-11
sp|Q8TBP6|S2540_HUMAN Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 269 575 1.0E-11
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 255 580 1.0E-11
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 288 578 1.0E-11
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 287 579 1.0E-11
sp|Q8LB08|ADT4_ARATH ADP,ATP carrier protein ER-ANT1 OS=Arabidopsis thaliana GN=ER-ANT1 PE=2 SV=2 336 566 1.0E-11
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 395 576 2.0E-11
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 395 576 2.0E-11
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 385 576 2.0E-11
sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 394 578 2.0E-11
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 287 578 2.0E-11
sp|Q12289|CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 289 479 2.0E-11
sp|P25083|ADT1_SOLTU ADP,ATP carrier protein, mitochondrial OS=Solanum tuberosum GN=ANT PE=2 SV=1 287 566 2.0E-11
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 339 576 2.0E-11
sp|P12857|ADT2_MAIZE ADP,ATP carrier protein 2, mitochondrial OS=Zea mays GN=ANT2 PE=2 SV=2 261 566 2.0E-11
sp|Q6DJ08|S2538_XENTR Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 269 580 2.0E-11
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 339 575 2.0E-11
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 284 578 3.0E-11
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 287 576 3.0E-11
sp|O49447|ADT3_ARATH ADP,ATP carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=AAC3 PE=2 SV=1 287 566 3.0E-11
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 287 579 3.0E-11
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 287 575 3.0E-11
sp|Q5RD81|GHC1_PONAB Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 287 571 3.0E-11
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 284 578 4.0E-11
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 339 575 4.0E-11
sp|Q9Y619|ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 287 578 4.0E-11
sp|P49382|ADT_KLULA ADP,ATP carrier protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AAC PE=3 SV=1 287 566 4.0E-11
sp|Q8SQH5|ADT2_BOVIN ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 394 578 5.0E-11
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 394 578 5.0E-11
sp|O22342|ADT1_GOSHI ADP,ATP carrier protein 1, mitochondrial OS=Gossypium hirsutum GN=ANT1 PE=2 SV=1 287 566 5.0E-11
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 339 576 5.0E-11
sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 370 578 5.0E-11
sp|P32007|ADT3_BOVIN ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 394 578 6.0E-11
sp|P04709|ADT1_MAIZE ADP,ATP carrier protein 1, mitochondrial OS=Zea mays GN=ANT1 PE=2 SV=3 287 566 7.0E-11
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 339 575 7.0E-11
sp|O46373|ADT1_RABIT ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 394 578 8.0E-11
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 400 580 8.0E-11
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 331 575 8.0E-11
sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 395 578 9.0E-11
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 396 578 9.0E-11
sp|Q06497|ANT1_YEAST Peroxisomal adenine nucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANT1 PE=1 SV=1 288 559 9.0E-11
sp|Q96A46|MFRN2_HUMAN Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 266 575 9.0E-11
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 398 578 1.0E-10
sp|Q09073|ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 394 578 1.0E-10
sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 394 578 1.0E-10
sp|Q000K2|ADT2_TACAC ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 394 578 1.0E-10
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 287 575 1.0E-10
sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 391 578 1.0E-10
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 399 557 1.0E-10
sp|Q9WVD5|ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 287 578 1.0E-10
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 277 475 1.0E-10
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 279 476 2.0E-10
sp|Q05962|ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 394 578 2.0E-10
sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 394 578 2.0E-10
sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 394 578 2.0E-10
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 400 580 2.0E-10
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 396 578 2.0E-10
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 287 571 2.0E-10
sp|Q8R0Z5|MFRN2_MOUSE Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 269 575 2.0E-10
sp|Q41630|ADT2_WHEAT ADP,ATP carrier protein 2, mitochondrial OS=Triticum aestivum GN=ANT-G2 PE=3 SV=1 280 566 2.0E-10
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 278 580 2.0E-10
sp|P31167|ADT1_ARATH ADP,ATP carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=AAC1 PE=1 SV=2 281 566 2.0E-10
sp|Q5R5A1|ADT2_PONAB ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 394 578 3.0E-10
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 400 580 3.0E-10
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 400 578 3.0E-10
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 395 578 3.0E-10
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 389 572 3.0E-10
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 395 578 3.0E-10
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 400 578 4.0E-10
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 231 578 4.0E-10
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 266 578 4.0E-10
sp|Q9CR62|M2OM_MOUSE Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 391 578 4.0E-10
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 392 575 4.0E-10
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 287 575 4.0E-10
sp|P40941|ADT2_ARATH ADP,ATP carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=AAC2 PE=2 SV=2 287 566 4.0E-10
sp|Q9QZD8|DIC_MOUSE Mitochondrial dicarboxylate carrier OS=Mus musculus GN=Slc25a10 PE=1 SV=2 290 580 4.0E-10
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 276 580 4.0E-10
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 287 571 4.0E-10
sp|O94344|YHMB_SCHPO Uncharacterized mitochondrial carrier C1271.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.11 PE=3 SV=1 401 578 4.0E-10
sp|Q1ECW7|S247A_DANRE Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 287 578 5.0E-10
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 277 580 5.0E-10
sp|Q6QRN9|ADT3_PIG ADP/ATP translocase 3 OS=Sus scrofa GN=SLC25A6 PE=2 SV=3 394 578 6.0E-10
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 396 578 6.0E-10
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 400 578 6.0E-10
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 395 578 6.0E-10
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 390 561 7.0E-10
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 288 570 7.0E-10
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 279 580 8.0E-10
sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 290 580 8.0E-10
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 399 578 8.0E-10
sp|Q7T292|MFRN2_DANRE Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 287 578 8.0E-10
sp|Q10442|YDE9_SCHPO Uncharacterized mitochondrial carrier C12B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.09 PE=3 SV=1 387 577 9.0E-10
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 395 578 9.0E-10
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 287 578 1.0E-09
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 386 572 1.0E-09
sp|P22292|M2OM_BOVIN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 391 578 1.0E-09
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 395 578 1.0E-09
sp|Q944H5|MTM1_ARATH Mitochondrial carrier protein MTM1 OS=Arabidopsis thaliana GN=MTM1 PE=2 SV=1 414 578 1.0E-09
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 287 575 1.0E-09
sp|P32331|YMC1_YEAST Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 263 579 1.0E-09
sp|Q76PC3|YQ73_SCHPO Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 287 572 1.0E-09
sp|Q9UTD6|YID3_SCHPO Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.03c PE=3 SV=1 430 579 1.0E-09
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 400 576 2.0E-09
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 400 580 2.0E-09
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 400 580 2.0E-09
sp|Q2HFL6|TPC1_CHAGB Mitochondrial thiamine pyrophosphate carrier 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TPC1 PE=3 SV=2 284 574 2.0E-09
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 390 575 2.0E-09
sp|Q5EAC0|S2538_BOVIN Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 255 580 2.0E-09
sp|P97700|M2OM_RAT Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus GN=Slc25a11 PE=1 SV=3 391 578 2.0E-09
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 395 578 2.0E-09
sp|Q09834|YAD8_SCHPO Uncharacterized mitochondrial carrier C4G8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.08 PE=3 SV=1 351 577 2.0E-09
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 385 575 3.0E-09
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 273 475 3.0E-09
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 388 575 3.0E-09
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 399 578 3.0E-09
sp|P18239|ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 400 575 3.0E-09
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 271 476 4.0E-09
sp|Q23125|MFRN_CAEEL Mitoferrin OS=Caenorhabditis elegans GN=W02B12.9 PE=3 SV=1 272 578 4.0E-09
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 281 574 4.0E-09
sp|P38087|YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 261 579 4.0E-09
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 385 578 4.0E-09
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 385 575 5.0E-09
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 399 575 6.0E-09
sp|P02723|ADT_NEUCR ADP,ATP carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aac PE=3 SV=1 397 575 6.0E-09
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 400 578 6.0E-09
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 271 476 7.0E-09
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 400 578 9.0E-09
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 289 476 1.0E-08
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 485 575 1.0E-08
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 396 572 1.0E-08
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 290 572 1.0E-08
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 344 572 1.0E-08
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 281 574 1.0E-08
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 395 578 1.0E-08
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 339 575 1.0E-08
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 395 578 1.0E-08
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 272 476 2.0E-08
sp|Q7PQV7|ADT2_ANOGA ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 388 578 2.0E-08
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 400 578 2.0E-08
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 287 578 2.0E-08
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 396 575 2.0E-08
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 494 579 2.0E-08
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 290 572 2.0E-08
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 398 575 2.0E-08
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 339 575 2.0E-08
sp|Q9BXI2|ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 287 578 2.0E-08
sp|D6W196|CMC1_YEAST Truncated non-functional calcium-binding mitochondrial carrier SAL1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAL1 PE=1 SV=2 400 521 3.0E-08
sp|Q6PIV7|S2534_HUMAN Solute carrier family 25 member 34 OS=Homo sapiens GN=SLC25A34 PE=2 SV=1 416 579 3.0E-08
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 338 578 3.0E-08
sp|Q84UC7|BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 288 580 3.0E-08
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 394 579 4.0E-08
sp|Q5U680|SAMC_MOUSE S-adenosylmethionine mitochondrial carrier protein OS=Mus musculus GN=Slc25a26 PE=1 SV=2 287 560 4.0E-08
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 339 575 4.0E-08
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 385 575 5.0E-08
sp|Q54W11|MCFL_DICDI Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 279 572 5.0E-08
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 396 579 5.0E-08
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 279 580 5.0E-08
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 267 572 6.0E-08
sp|P04710|ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 400 575 7.0E-08
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 280 580 7.0E-08
sp|P31692|ADT_PARKE ADP,ATP carrier protein OS=Parachlorella kessleri PE=3 SV=1 390 575 8.0E-08
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 339 575 9.0E-08
sp|Q9LV81|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 394 575 1.0E-07
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 400 578 1.0E-07
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 397 577 1.0E-07
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 334 488 1.0E-07
sp|Q5U680|SAMC_MOUSE S-adenosylmethionine mitochondrial carrier protein OS=Mus musculus GN=Slc25a26 PE=1 SV=2 398 575 1.0E-07
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 391 578 1.0E-07
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 397 575 1.0E-07
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 395 578 1.0E-07
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 293 576 1.0E-07
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 395 578 1.0E-07
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 386 578 2.0E-07
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 429 578 2.0E-07
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 339 475 2.0E-07
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 287 572 2.0E-07
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 394 572 2.0E-07
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 275 475 2.0E-07
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 283 577 2.0E-07
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 400 571 2.0E-07
sp|Q6C6I3|S2538_YARLI Solute carrier family 25 member 38 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E09284g PE=3 SV=1 287 578 2.0E-07
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 285 574 2.0E-07
sp|Q6DHS9|S2548_DANRE Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 400 571 2.0E-07
sp|Q9VBN7|SAMC_DROME S-adenosylmethionine mitochondrial carrier protein homolog OS=Drosophila melanogaster GN=CG4743 PE=2 SV=2 275 579 2.0E-07
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 285 574 2.0E-07
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 278 574 2.0E-07
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 391 578 2.0E-07
sp|Q8R0Y8|S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus GN=Slc25a42 PE=1 SV=1 388 575 3.0E-07
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 284 475 3.0E-07
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 387 580 3.0E-07
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 278 578 3.0E-07
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 279 580 4.0E-07
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 287 578 4.0E-07
sp|P56501|UCP3_MOUSE Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 395 578 4.0E-07
sp|Q6IS41|S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 287 576 5.0E-07
sp|Q9C5M0|DTC_ARATH Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 395 561 6.0E-07
sp|P0C546|S2542_RAT Mitochondrial coenzyme A transporter SLC25A42 OS=Rattus norvegicus GN=Slc25a42 PE=2 SV=1 397 575 7.0E-07
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 429 578 7.0E-07
sp|P49382|ADT_KLULA ADP,ATP carrier protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AAC PE=3 SV=1 400 575 7.0E-07
sp|Q6GLA2|SAMC_XENTR S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis GN=slc25a26 PE=2 SV=1 397 575 7.0E-07
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 279 575 9.0E-07
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 429 578 1.0E-06
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 287 560 1.0E-06
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 477 572 1.0E-06
sp|Q9MA90|PNC1_ARATH Peroxisomal adenine nucleotide carrier 1 OS=Arabidopsis thaliana GN=PNC1 PE=1 SV=1 289 573 1.0E-06
sp|Q3SZK0|S2534_BOVIN Solute carrier family 25 member 34 OS=Bos taurus GN=SLC25A34 PE=2 SV=1 416 579 1.0E-06
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 392 578 1.0E-06
sp|Q5XIF9|S2534_RAT Solute carrier family 25 member 34 OS=Rattus norvegicus GN=Slc25a34 PE=2 SV=2 416 576 1.0E-06
sp|O95847|UCP4_HUMAN Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 285 580 1.0E-06
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 365 571 1.0E-06
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 287 483 2.0E-06
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 414 579 2.0E-06
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 334 473 2.0E-06
sp|Q8VZS0|PNC2_ARATH Peroxisomal adenine nucleotide carrier 2 OS=Arabidopsis thaliana GN=PNC2 PE=1 SV=1 289 573 2.0E-06
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 287 486 3.0E-06
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 278 487 3.0E-06
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 334 473 3.0E-06
sp|Q9MA90|PNC1_ARATH Peroxisomal adenine nucleotide carrier 1 OS=Arabidopsis thaliana GN=PNC1 PE=1 SV=1 393 578 3.0E-06
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 241 489 4.0E-06
sp|P27080|ADT_CHLRE ADP,ATP carrier protein OS=Chlamydomonas reinhardtii GN=ABT PE=2 SV=1 400 575 4.0E-06
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 486 578 4.0E-06
sp|Q09834|YAD8_SCHPO Uncharacterized mitochondrial carrier C4G8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.08 PE=3 SV=1 397 578 4.0E-06
sp|O77792|UCP3_BOVIN Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 273 481 4.0E-06
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 386 572 5.0E-06
sp|Q5RD81|GHC1_PONAB Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 492 578 5.0E-06
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 494 579 5.0E-06
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 287 578 5.0E-06
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 284 573 5.0E-06
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 278 486 6.0E-06
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 396 572 6.0E-06
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 492 578 6.0E-06
sp|Q9H936|GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 492 578 6.0E-06
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 328 475 7.0E-06
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 435 579 7.0E-06
sp|Q08DK4|GHC1_BOVIN Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 492 578 7.0E-06
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 486 578 7.0E-06
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 406 578 7.0E-06
sp|P38127|RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 340 578 8.0E-06
sp|Q6J329|S2547_RAT Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 479 576 8.0E-06
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 104 216 9.0E-06
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 104 216 1.0E-05
sp|Q96A46|MFRN2_HUMAN Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 336 487 1.0E-05
sp|Q6DHS9|S2548_DANRE Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 280 482 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1596 0.1123 0.0382 0.091 0.9213 0.0714 0.2234 0.1824 0.1458 0.4171

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup4276
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|070810
Agaricus bisporus var bisporus H97 AgabiH97|070810 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|31_17

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070810
MSPDTRPFRKPLATSDTPPSAPSRSLEDFRRAEGRESRKRHLLALWDRFPPPQPRPGHPDTGQRRPLGPDGLTYE
GAETLQAMYDDELLVLCKGSKDRVRAQGVSWEEFKKYAEAKEVELWHIFHELDLDRNGRLDADELRSALNKSGIQ
VSPETLTEFMSSLAISPQQRHITFSEFRDFLLLLPRRASPDEIYRYYEVTRFMGDDGRGPARVTMEGDVSLSAED
KPPDSMLHKPTSTPTNLSASISNQSSSSPQSNRDRPTEYLDDEDPEEDHHSFLERHTSLRFLLAGGIAGAVSRTC
TAPFDRLKVFLITRSPDMGGVPALSGVNGTGGVRIISSAVARIYSEGGVLAFWTGNGLSVAKIFPESAIKFFTYE
SAKRTFARYWDHVDDPRDISSVSRFLSGGIGGLTSQLSIYPLETLKTQMMSSTGAKRSFLQAMRHVYSMGGIHAY
YRGLTIGLIGVFPYSAIDMSTFEALKLAYVKSTGKEEPGVLALLAFGSVSGSVGATSVYPLNLVRTRLQASGSSG
HPQRYSGVREVMIKTWERDGWRGFYRGLFPTLAKVVPAVSISYVVYEHSKRRLGV*
Coding >AgabiH97|070810
ATGTCTCCGGATACCCGTCCCTTTCGAAAACCTCTGGCCACCTCAGACACACCACCTTCCGCCCCATCCCGCTCG
CTCGAAGATTTTAGGAGAGCAGAAGGCCGGGAGAGCAGGAAACGCCATCTCTTGGCTCTCTGGGACCGTTTTCCT
CCACCACAACCTAGACCTGGTCATCCTGATACCGGGCAACGCAGACCCCTTGGACCGGATGGCCTGACCTATGAA
GGGGCAGAGACCCTGCAAGCCATGTACGATGACGAATTGTTGGTGCTTTGTAAAGGTTCAAAAGACAGGGTGAGA
GCCCAGGGAGTCAGTTGGGAAGAATTCAAAAAATACGCAGAGGCCAAGGAAGTTGAACTATGGCACATTTTCCAC
GAACTAGATCTTGACAGGAACGGGAGGCTGGATGCCGACGAGCTTCGCTCAGCACTCAACAAATCTGGAATACAA
GTATCCCCGGAAACCCTTACTGAGTTCATGTCCTCCCTGGCAATATCTCCCCAACAACGTCATATTACATTTTCT
GAATTTCGAGATTTCTTGCTTCTTCTGCCACGTAGGGCCTCCCCGGACGAAATTTACAGATATTATGAAGTTACC
CGGTTCATGGGAGACGACGGGCGGGGTCCAGCACGGGTAACGATGGAGGGCGATGTTAGCCTTAGCGCCGAAGAC
AAACCTCCAGATTCTATGCTACATAAACCTACATCCACCCCCACTAACTTATCAGCCTCTATATCCAATCAGTCT
TCTTCATCACCGCAATCAAATAGAGATAGGCCAACGGAGTATCTGGATGACGAGGATCCAGAAGAGGACCATCAT
AGTTTTCTTGAACGTCACACGTCTCTACGATTTCTTCTTGCAGGGGGGATTGCGGGTGCAGTTTCGCGAACATGT
ACGGCACCATTCGATCGTTTGAAGGTATTCTTGATCACGCGTTCTCCTGATATGGGTGGGGTACCAGCTTTAAGT
GGCGTAAATGGGACGGGTGGCGTGAGGATTATATCTAGTGCTGTTGCTCGCATTTACTCTGAGGGAGGAGTTTTG
GCCTTCTGGACAGGCAACGGGCTATCTGTGGCGAAGATATTCCCAGAATCTGCGATCAAGTTCTTCACATATGAA
TCAGCGAAACGTACGTTTGCACGGTATTGGGATCATGTTGATGACCCAAGGGATATAAGCAGCGTGAGCCGGTTT
CTATCTGGTGGCATTGGAGGGCTCACCAGTCAATTAAGCATCTATCCATTGGAGACACTCAAGACGCAAATGATG
AGTAGTACCGGTGCAAAAAGATCGTTCCTTCAGGCAATGCGACATGTATACTCAATGGGGGGTATTCATGCATAC
TATCGTGGTCTGACGATTGGTCTAATTGGGGTTTTTCCATACTCCGCAATCGACATGAGCACATTCGAAGCACTC
AAATTGGCATATGTAAAGTCCACGGGCAAAGAAGAACCAGGAGTCCTCGCTCTCCTAGCTTTTGGTAGCGTATCA
GGCAGTGTCGGTGCAACTAGCGTATATCCTCTTAATCTCGTGCGCACGAGATTACAAGCATCAGGTTCGTCAGGT
CATCCGCAGAGATATTCAGGAGTTCGGGAAGTGATGATAAAGACGTGGGAGAGGGATGGGTGGCGAGGATTCTAC
CGCGGGTTGTTCCCCACTTTGGCCAAGGTAGTCCCAGCGGTGTCAATATCTTATGTTGTATATGAGCATAGCAAA
CGGAGATTAGGAGTTTAG
Transcript >AgabiH97|070810
ATGTCTCCGGATACCCGTCCCTTTCGAAAACCTCTGGCCACCTCAGACACACCACCTTCCGCCCCATCCCGCTCG
CTCGAAGATTTTAGGAGAGCAGAAGGCCGGGAGAGCAGGAAACGCCATCTCTTGGCTCTCTGGGACCGTTTTCCT
CCACCACAACCTAGACCTGGTCATCCTGATACCGGGCAACGCAGACCCCTTGGACCGGATGGCCTGACCTATGAA
GGGGCAGAGACCCTGCAAGCCATGTACGATGACGAATTGTTGGTGCTTTGTAAAGGTTCAAAAGACAGGGTGAGA
GCCCAGGGAGTCAGTTGGGAAGAATTCAAAAAATACGCAGAGGCCAAGGAAGTTGAACTATGGCACATTTTCCAC
GAACTAGATCTTGACAGGAACGGGAGGCTGGATGCCGACGAGCTTCGCTCAGCACTCAACAAATCTGGAATACAA
GTATCCCCGGAAACCCTTACTGAGTTCATGTCCTCCCTGGCAATATCTCCCCAACAACGTCATATTACATTTTCT
GAATTTCGAGATTTCTTGCTTCTTCTGCCACGTAGGGCCTCCCCGGACGAAATTTACAGATATTATGAAGTTACC
CGGTTCATGGGAGACGACGGGCGGGGTCCAGCACGGGTAACGATGGAGGGCGATGTTAGCCTTAGCGCCGAAGAC
AAACCTCCAGATTCTATGCTACATAAACCTACATCCACCCCCACTAACTTATCAGCCTCTATATCCAATCAGTCT
TCTTCATCACCGCAATCAAATAGAGATAGGCCAACGGAGTATCTGGATGACGAGGATCCAGAAGAGGACCATCAT
AGTTTTCTTGAACGTCACACGTCTCTACGATTTCTTCTTGCAGGGGGGATTGCGGGTGCAGTTTCGCGAACATGT
ACGGCACCATTCGATCGTTTGAAGGTATTCTTGATCACGCGTTCTCCTGATATGGGTGGGGTACCAGCTTTAAGT
GGCGTAAATGGGACGGGTGGCGTGAGGATTATATCTAGTGCTGTTGCTCGCATTTACTCTGAGGGAGGAGTTTTG
GCCTTCTGGACAGGCAACGGGCTATCTGTGGCGAAGATATTCCCAGAATCTGCGATCAAGTTCTTCACATATGAA
TCAGCGAAACGTACGTTTGCACGGTATTGGGATCATGTTGATGACCCAAGGGATATAAGCAGCGTGAGCCGGTTT
CTATCTGGTGGCATTGGAGGGCTCACCAGTCAATTAAGCATCTATCCATTGGAGACACTCAAGACGCAAATGATG
AGTAGTACCGGTGCAAAAAGATCGTTCCTTCAGGCAATGCGACATGTATACTCAATGGGGGGTATTCATGCATAC
TATCGTGGTCTGACGATTGGTCTAATTGGGGTTTTTCCATACTCCGCAATCGACATGAGCACATTCGAAGCACTC
AAATTGGCATATGTAAAGTCCACGGGCAAAGAAGAACCAGGAGTCCTCGCTCTCCTAGCTTTTGGTAGCGTATCA
GGCAGTGTCGGTGCAACTAGCGTATATCCTCTTAATCTCGTGCGCACGAGATTACAAGCATCAGGTTCGTCAGGT
CATCCGCAGAGATATTCAGGAGTTCGGGAAGTGATGATAAAGACGTGGGAGAGGGATGGGTGGCGAGGATTCTAC
CGCGGGTTGTTCCCCACTTTGGCCAAGGTAGTCCCAGCGGTGTCAATATCTTATGTTGTATATGAGCATAGCAAA
CGGAGATTAGGAGTTTAG
Gene >AgabiH97|070810
ATGTCTCCGGATACCCGTCCCTTTCGAAAACCTCTGGCCACCTCAGACACACCACCTTCCGCCCCATCCCGCTCG
CTCGAAGATTTTAGGAGAGCAGAAGGCCGGGAGAGCAGGAAACGCCATCTCTTGGCTCTCTGGGACCGTTTTCCT
CCACCACAACCTAGACCTGGTCATCCTGATACCGGGCAACGCAGACCCCTTGGACCGGATGGCCTGACCTATGAA
GGGGCAGAGACCCTGCAAGCCATGTACGATGACGAATTGTTGGTGCTTTGTAAAGGTTCAAAAGACAGGGTGAGA
GCCCAGGGAGTCAGTTGGGAAGAATTCAAAAAATACGCAGAGGCCAAGGAAGTTGGTAGGTTATTCTGTATTACT
CTGGGAAGCTTCTAATCAACATTATTTTTGTCCTTGGAAGAACTATGGCACATTTTCCACGAACTAGATCTTGAC
AGGAACGGGAGGCTGGATGCCGACGAGCTTCGCTCAGCACTCAACAAATCTGGTACATGCTCCAATGCCTATTCT
GACCCGACCCTGCCTAAACTCACCTCTCTATCAGGAATACAAGTATCCCCGGAAACCCTTACTGAGTTCATGTCC
TCCCTGGCAATATCTCCCCAACAACGTCATATTACATTTTCTGAATTTCGAGATTTCTTGCTTCTTCTGCCACGT
AGGGCCTCCCCGGACGAAATTTACAGATATTATGAAGTTACCCGGTTCATGGGAGACGACGGGCGGGGTCCAGCA
CGGGTAACGATGGAGGGTTAGTACTTTAGCGAGCATATTTGGTCAGCTCATTCCTCATGCTCATGGACTTCAAAT
CAGGCGATGTTAGCCTTAGCGCCGAAGACAAACCTCCAGATTCTATGCTACATAAACCTACATCCACCCCCACTA
ACTTATCAGCCTCTATATCCAATCAGTCTTCTTCATCACCGCAATCAAATAGAGATAGGCCAACGGAGTATCTGG
ATGACGAGGATCCAGAAGAGGACCATCATAGTTTTCTTGAACGTCACACGTCTCTACGATTTCTTCTTGCAGGGG
GGATTGCGGGTGCAGGTCCGTTTCTGGTCGATATTTCCCGTCGCTCTAGGACTCAAACCCTTTTGCCCAGTTTCG
CGAACATGTACGGCACCATTCGATCGTTTGAAGGTATTCTTGATCACGCGTTCTCCTGATATGGGTGGGGTACCA
GCTTTAAGTGGCGTAAATGGGACGGGTGGCGTGAGGATTATATCTAGTGCTGTTGCTCGCATTTACTCTGAGGGA
GGAGTTTTGGCCTTCTGGACAGGCAACGGGCTATCTGTGGCGAAGATATTCCCAGAATCTGCGATCAAGTTCTTC
ACATATGAATCAGCGGCAAGTGCAATGCATTTGGCCTTTTAGGCTATTGCTGCGAGTACTTATTCTTGCGTTTCA
GAAACGTACGTTTGCACGGTATTGGGATCATGTTGATGACCCAAGGGATATAAGCAGCGTGAGCCGGTTTCTATC
TGGTGGCATTGGAGGGCTCACCAGTCAATTAAGTGAGCTACTCTCTTTTGGATGATGATGGCCGGTCTTGACCCT
CATATTAAAGGCATCTATCCATTGGAGACACTCAAGGTTCTTTCCGTTATCTCGGCAAAAATGTTTATGAGCTGA
TCGAGCTATAGACGCAAATGATGAGTAGTACCGGTGCAAAAAGATCGTTCCTTCAGGCAATGCGACATGTATACT
CAATGGGGGGTATTCATGCATACTATCGTGGTCTGACGGTAAGCTCGGACAATGACATTGTTCTCTTCACATATC
AACGTCATATGAATGAATCCATACTATTTTAGATTGGTCTAATTGGGGTTTTTCCGTATGCAATGTTCATCTCTG
CCTCACCACGTCAACCATTGAATTGCTGCGCTCTTTTTATTCATTTAATAGATACTCCGCAATCGACATGAGCAC
ATTCGAAGCACTCAAATTGGCATATGTAAAGTCCACGGGCAAAGAAGAACCAGGAGTCCTCGCTCTCCTAGCTTT
TGGTAGCGTATCAGGCAGTGTCGGTGCAACTAGCGTATATCCTCTTAATCTCGTGCGCACGAGATTACAAGCATC
AGGTTCGTCAGGTCATCCGCAGAGATATTCAGGAGTTCGGGAAGTGATGATAAAGACGTGGGAGAGGGATGGGTG
GCGAGGATTCTACCGCGGGTTGTTCCCCACTTTGGCCAAGGTAGGCCCCCTGTTCTGTTTGCGTCTGAACCTTAT
TGTGGTCTTGCTTGATTGGCCGGATAATGGTTGCAACCGACTTTCGCTTATTTCATTAATGATCATTTCCGCTTG
CTAACATTGCTGTCGATCAGGTAGTCCCAGCGGTGTCAATATCTTATGTTGTATATGAGCATAGCAAACGGAGGT
GAGTATTTGTAGTTTCCCCTGCACTGGCATTCATCTTTGTATTTTTTTTTCAGATTAGGAGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail