Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070800
Gene name
Locationscaffold_4:1363076..1364532
Strand+
Gene length (bp)1456
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09335 SNARE_assoc SNARE associated Golgi protein 3.0E-17 190 324

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O62126|TM41_CAEEL Transmembrane protein 41 homolog OS=Caenorhabditis elegans GN=tag-175 PE=3 SV=1 142 372 2.0E-12
sp|Q8MXN7|TM41_DICDI Transmembrane protein 41 homolog OS=Dictyostelium discoideum GN=DDB_G0275543 PE=3 SV=2 147 372 4.0E-09
sp|Q502G2|T41AA_DANRE Transmembrane protein 41A-A OS=Danio rerio GN=tmem41aa PE=2 SV=1 144 392 2.0E-08
sp|Q96HV5|TM41A_HUMAN Transmembrane protein 41A OS=Homo sapiens GN=TMEM41A PE=1 SV=1 143 393 1.0E-07
sp|Q9VX39|TM41_DROME Transmembrane protein 41 homolog OS=Drosophila melanogaster GN=stas PE=2 SV=2 144 372 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O62126|TM41_CAEEL Transmembrane protein 41 homolog OS=Caenorhabditis elegans GN=tag-175 PE=3 SV=1 142 372 2.0E-12
sp|Q8MXN7|TM41_DICDI Transmembrane protein 41 homolog OS=Dictyostelium discoideum GN=DDB_G0275543 PE=3 SV=2 147 372 4.0E-09
sp|Q502G2|T41AA_DANRE Transmembrane protein 41A-A OS=Danio rerio GN=tmem41aa PE=2 SV=1 144 392 2.0E-08
sp|Q96HV5|TM41A_HUMAN Transmembrane protein 41A OS=Homo sapiens GN=TMEM41A PE=1 SV=1 143 393 1.0E-07
sp|Q9VX39|TM41_DROME Transmembrane protein 41 homolog OS=Drosophila melanogaster GN=stas PE=2 SV=2 144 372 4.0E-07
sp|Q08D99|TM41A_BOVIN Transmembrane protein 41A OS=Bos taurus GN=TMEM41A PE=2 SV=1 143 331 4.0E-07
sp|A4II98|TM41B_XENTR Transmembrane protein 41B OS=Xenopus tropicalis GN=tmem41b PE=2 SV=1 147 373 5.0E-07
sp|Q9D8U2|TM41A_MOUSE Transmembrane protein 41A OS=Mus musculus GN=Tmem41a PE=2 SV=1 143 345 1.0E-06
sp|Q5U4K5|TM41B_XENLA Transmembrane protein 41B OS=Xenopus laevis GN=tmem41b PE=2 SV=1 147 373 2.0E-06
sp|Q8K1A5|TM41B_MOUSE Transmembrane protein 41B OS=Mus musculus GN=Tmem41b PE=1 SV=1 142 373 5.0E-06
sp|Q5FVN2|TM41B_RAT Transmembrane protein 41B OS=Rattus norvegicus GN=Tmem41b PE=2 SV=1 78 373 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 120 142 22
2 162 184 22
3 191 213 22
4 217 239 22
5 277 299 22
6 345 367 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070800
MLASAPRPVSSSLSPHHSLGRRRSSSSLLDAASDQQPLSTAVSHHQPTQSMIVVVVSRILQWLHLQPQHSLSWPS
PPSPRSSTEKLVLPLSASSQKTSFTDVPSEESRTHHFPSVHAPIVFVICLLPISTALVFYCTSTLPITLAWPRTL
EDVAQLGRELTAYTQSGTWPLLHVMGVMAITAIWKHAWSIPGSVIWNVLAGALFSPIIATLFLTTLTTIGSICAT
LLATPLAPFLTYLFPRALDMTRTALHGESDNPQDDSTTEVHKSKSSAWVRLSVLRLVGVVPWSGINIACGVCGVS
LGDCVMGAFIGCLPWTAVTCQIGDILQTVVSTSSNSTPESISSILMSPRIIIKLALLSFLSLAPILARNRLRKMI
HPSVFQSSPENEQSSRRNWVRDLRTKISKTRSRDRKPSLKLNILVQEKRAIEELPS*
Coding >AgabiH97|070800
ATGCTTGCGTCTGCGCCCCGGCCTGTCTCATCCTCCCTCAGCCCCCACCACTCCCTTGGCCGTCGTCGCTCGTCC
TCGTCCCTCCTCGACGCCGCCAGCGACCAGCAGCCTCTGTCCACAGCGGTCTCTCACCACCAGCCCACTCAGTCA
ATGATCGTCGTCGTGGTCTCCCGCATCCTCCAGTGGCTGCACCTCCAGCCCCAGCACTCCCTCTCCTGGCCCAGC
CCCCCTTCTCCTCGGTCAAGCACGGAGAAGCTCGTCCTTCCACTCTCGGCCTCCTCCCAAAAAACATCCTTCACT
GATGTCCCCTCCGAAGAGTCACGCACGCATCATTTTCCCTCTGTGCATGCCCCTATTGTTTTCGTCATATGTCTC
TTGCCTATATCTACTGCTCTCGTGTTTTACTGCACCTCGACCCTGCCAATTACTCTCGCGTGGCCTAGAACACTA
GAGGACGTCGCTCAGTTAGGACGTGAACTCACGGCTTATACTCAGTCTGGCACTTGGCCCTTGCTTCACGTCATG
GGTGTAATGGCCATTACTGCCATCTGGAAGCACGCCTGGTCTATTCCGGGAAGCGTCATCTGGAACGTGTTGGCC
GGAGCACTGTTCTCTCCTATCATTGCAACCCTTTTCCTCACGACGCTGACTACTATTGGATCCATTTGTGCCACT
CTCCTCGCCACACCTCTTGCTCCATTCCTGACGTATCTTTTCCCTCGAGCCCTCGACATGACACGTACGGCACTC
CACGGCGAATCTGACAATCCGCAGGACGATTCGACCACGGAAGTGCACAAAAGCAAATCGTCTGCATGGGTCCGG
TTGTCAGTCTTGCGGTTGGTTGGGGTTGTACCGTGGTCAGGCATCAATATCGCGTGCGGAGTGTGCGGGGTTTCA
CTCGGTGATTGTGTCATGGGCGCTTTCATCGGATGCCTTCCTTGGACTGCTGTCACGTGCCAGATTGGTGACATC
CTGCAAACGGTTGTGTCCACATCCTCCAACTCGACGCCCGAGTCGATCTCTTCCATTCTCATGTCACCCCGCATC
ATCATCAAACTCGCCCTTTTGTCTTTCCTCTCCCTCGCCCCCATCCTTGCTCGCAACCGCCTGCGGAAAATGATT
CACCCATCTGTCTTCCAGTCGTCACCGGAAAACGAACAATCTTCCCGGAGAAACTGGGTCCGAGATTTGCGTACG
AAGATCTCGAAGACGCGGTCACGCGACCGCAAGCCTTCTTTGAAATTGAATATCCTTGTTCAAGAAAAGCGTGCA
ATCGAGGAATTACCCTCGTAA
Transcript >AgabiH97|070800
ATGCTTGCGTCTGCGCCCCGGCCTGTCTCATCCTCCCTCAGCCCCCACCACTCCCTTGGCCGTCGTCGCTCGTCC
TCGTCCCTCCTCGACGCCGCCAGCGACCAGCAGCCTCTGTCCACAGCGGTCTCTCACCACCAGCCCACTCAGTCA
ATGATCGTCGTCGTGGTCTCCCGCATCCTCCAGTGGCTGCACCTCCAGCCCCAGCACTCCCTCTCCTGGCCCAGC
CCCCCTTCTCCTCGGTCAAGCACGGAGAAGCTCGTCCTTCCACTCTCGGCCTCCTCCCAAAAAACATCCTTCACT
GATGTCCCCTCCGAAGAGTCACGCACGCATCATTTTCCCTCTGTGCATGCCCCTATTGTTTTCGTCATATGTCTC
TTGCCTATATCTACTGCTCTCGTGTTTTACTGCACCTCGACCCTGCCAATTACTCTCGCGTGGCCTAGAACACTA
GAGGACGTCGCTCAGTTAGGACGTGAACTCACGGCTTATACTCAGTCTGGCACTTGGCCCTTGCTTCACGTCATG
GGTGTAATGGCCATTACTGCCATCTGGAAGCACGCCTGGTCTATTCCGGGAAGCGTCATCTGGAACGTGTTGGCC
GGAGCACTGTTCTCTCCTATCATTGCAACCCTTTTCCTCACGACGCTGACTACTATTGGATCCATTTGTGCCACT
CTCCTCGCCACACCTCTTGCTCCATTCCTGACGTATCTTTTCCCTCGAGCCCTCGACATGACACGTACGGCACTC
CACGGCGAATCTGACAATCCGCAGGACGATTCGACCACGGAAGTGCACAAAAGCAAATCGTCTGCATGGGTCCGG
TTGTCAGTCTTGCGGTTGGTTGGGGTTGTACCGTGGTCAGGCATCAATATCGCGTGCGGAGTGTGCGGGGTTTCA
CTCGGTGATTGTGTCATGGGCGCTTTCATCGGATGCCTTCCTTGGACTGCTGTCACGTGCCAGATTGGTGACATC
CTGCAAACGGTTGTGTCCACATCCTCCAACTCGACGCCCGAGTCGATCTCTTCCATTCTCATGTCACCCCGCATC
ATCATCAAACTCGCCCTTTTGTCTTTCCTCTCCCTCGCCCCCATCCTTGCTCGCAACCGCCTGCGGAAAATGATT
CACCCATCTGTCTTCCAGTCGTCACCGGAAAACGAACAATCTTCCCGGAGAAACTGGGTCCGAGATTTGCGTACG
AAGATCTCGAAGACGCGGTCACGCGACCGCAAGCCTTCTTTGAAATTGAATATCCTTGTTCAAGAAAAGCGTGCA
ATCGAGGAATTACCCTCGTAA
Gene >AgabiH97|070800
ATGCTTGCGTCTGCGCCCCGGCCTGTCTCATCCTCCCTCAGCCCCCACCACTCCCTTGGCCGTCGTCGCTCGTCC
TCGTCCCTCCTCGACGCCGCCAGCGACCAGCAGCCTCTGTCCACAGCGGTCTCTCACCACCAGCCCACTCAGTCA
ATGATCGTCGTCGTGGTCTCCCGCATCCTCCAGTGGCTGCACCTCCAGCCCCAGCACTCCCTCTCCTGGCCCAGC
CCCCCTTCTCCTCGGTCAAGCACGGAGAAGCTCGTCCTTCCACTCTCGGCCTCCTCCCAAAAAACATCCTTCACT
GATGTCCCCTCCGAAGAGTCACGCACGCATCATTTTCCCTCTGTAAGTGTGCACCTTTGTTAAGCTTCTCCTTTA
CTGATTCTGTCTCAGGTGCATGCCCCTATTGTTTTCGTCATATGTCTCTTGCCTATATCTACTGCTCTCGTGTTT
TACTGCACCTCGACCCTGCCAATTACTCTCGCGTGGCCTAGAACACTAGAGGACGTCGCTCAGTTAGGACGTGAA
CTCACGGCTTATACTCAGTCTGGCACTTGGCCCTTGCTTCACGTCATGGGTGTAATGGCCATTACTGCCATCTGG
AAGCACGCCTGGTCTATTCCGGGAAGCGTCATCTGGGTATGTATCCTGTCTCTTACGACTTTATTTATTTTCGTG
CTAAACGCAATCCTTCATTCCAGAACGTGTTGGCCGGAGCACTGTTCTCTCCTATCATTGCAACCCTTTTCCTCA
CGACGCTGACTACTATTGGATCCATTTGTGCCACTCTCCTCGCCACACCTCTTGCTCCATTCCTGACGTATCTTT
TCCCTCGAGCCCTCGACATGACACGTACGGCACTCCACGGCGAATCTGACAATCCGCAGGACGATTCGACCACGG
AAGTGCACAAAAGCAAATCGTCTGCATGGGTCCGGTTGTCAGTCTTGCGGTTGGTTGGGGTTGTACCGTGGTCAG
GCATCAATATCGCGTGCGGAGTGTGCGGGGTTTCACTCGGTGATTGTGTCATGGGCGCTTTCATCGGATGCCTTC
CTTGGACTGCTGTCACGTGCCAGGTAAGTTTCTAGCACAAGACCAGAGTTGCCATTTCTAACTTGCGATCCAGAT
TGGTGACATCCTGCAAACGGTTGTGTCCACATCCTCCAACTCGACGCCCGAGTCGATCTCTTCCATTCTCATGTC
ACCCCGCATCATCATCAAACTCGCCCTTTTGTCTTTCCTCTCCCTCGCCCCCATCCTTGCTCGCAACCGCCTGCG
GAAAATGATTCACCCATCTGTCTTCCAGTCGTCACCGGAAAACGAACAATCTTCCCGGAGAAACTGGGTCCGAGA
TTTGCGTACGAAGATCTCGAAGACGCGGTCACGCGACCGCAAGCCTTCTTTGAAATTGAATATCCTTGTTCAAGA
AAAGCGTGCAATCGAGGAATTACCCTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail