Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070690
Gene name
Locationscaffold_4:1342059..1342922
Strand+
Gene length (bp)863
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 1.6E-27 20 177

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14296|VPS24_SCHPO Vacuolar protein sorting-associated protein 24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps24 PE=3 SV=1 1 157 5.0E-46
sp|Q6NRM7|CHMP3_XENLA Charged multivesicular body protein 3 OS=Xenopus laevis GN=chmp3 PE=2 SV=3 8 193 6.0E-45
sp|Q5BKM3|CHMP3_XENTR Charged multivesicular body protein 3 OS=Xenopus tropicalis GN=chmp3 PE=2 SV=4 8 193 2.0E-44
sp|Q8CGS4|CHMP3_RAT Charged multivesicular body protein 3 OS=Rattus norvegicus GN=Chmp3 PE=1 SV=3 8 178 1.0E-38
sp|Q9CQ10|CHMP3_MOUSE Charged multivesicular body protein 3 OS=Mus musculus GN=Chmp3 PE=1 SV=3 8 178 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14296|VPS24_SCHPO Vacuolar protein sorting-associated protein 24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps24 PE=3 SV=1 1 157 5.0E-46
sp|Q6NRM7|CHMP3_XENLA Charged multivesicular body protein 3 OS=Xenopus laevis GN=chmp3 PE=2 SV=3 8 193 6.0E-45
sp|Q5BKM3|CHMP3_XENTR Charged multivesicular body protein 3 OS=Xenopus tropicalis GN=chmp3 PE=2 SV=4 8 193 2.0E-44
sp|Q8CGS4|CHMP3_RAT Charged multivesicular body protein 3 OS=Rattus norvegicus GN=Chmp3 PE=1 SV=3 8 178 1.0E-38
sp|Q9CQ10|CHMP3_MOUSE Charged multivesicular body protein 3 OS=Mus musculus GN=Chmp3 PE=1 SV=3 8 178 1.0E-38
sp|Q58CS7|CHMP3_BOVIN Charged multivesicular body protein 3 OS=Bos taurus GN=CHMP3 PE=2 SV=4 8 178 2.0E-38
sp|Q5RAU5|CHMP3_PONAB Charged multivesicular body protein 3 OS=Pongo abelii GN=CHMP3 PE=2 SV=3 8 178 2.0E-38
sp|Q4R574|CHMP3_MACFA Charged multivesicular body protein 3 OS=Macaca fascicularis GN=CHMP3 PE=2 SV=3 8 178 2.0E-38
sp|Q9Y3E7|CHMP3_HUMAN Charged multivesicular body protein 3 OS=Homo sapiens GN=CHMP3 PE=1 SV=3 8 178 3.0E-38
sp|Q54P63|CHMP3_DICDI Charged multivesicular body protein 3 OS=Dictyostelium discoideum GN=chmp3 PE=3 SV=1 7 152 3.0E-38
sp|Q6NY88|CHMP3_DANRE Charged multivesicular body protein 3 OS=Danio rerio GN=chmp3 PE=2 SV=3 8 188 1.0E-36
sp|P36095|VPS24_YEAST Vacuolar protein-sorting-associated protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS24 PE=1 SV=1 1 200 2.0E-30
sp|Q9FFB3|VP241_ARATH Vacuolar protein sorting-associated protein 24 homolog 1 OS=Arabidopsis thaliana GN=VPS24-1 PE=1 SV=1 11 150 5.0E-30
sp|Q9LXH5|VP242_ARATH Putative vacuolar protein sorting-associated protein 24 homolog 2 OS=Arabidopsis thaliana GN=VPS24-2 PE=2 SV=1 31 150 4.0E-18
sp|Q5F3A2|CHM2B_CHICK Charged multivesicular body protein 2b OS=Gallus gallus GN=CHMP2B PE=2 SV=1 7 204 4.0E-11
sp|Q6NVL7|CHM2B_XENTR Charged multivesicular body protein 2b OS=Xenopus tropicalis GN=chmp2b PE=2 SV=1 12 204 4.0E-11
sp|Q66IV6|CH2BB_XENLA Charged multivesicular body protein 2b-B OS=Xenopus laevis GN=chmp2b-b PE=2 SV=1 12 204 8.0E-11
sp|Q54DB1|CM2A2_DICDI Charged multivesicular body protein 2a homolog 2 OS=Dictyostelium discoideum GN=chmp2a2 PE=3 SV=1 7 172 2.0E-10
sp|Q3SX42|CHM2B_BOVIN Charged multivesicular body protein 2b OS=Bos taurus GN=CHMP2B PE=2 SV=1 7 204 2.0E-10
sp|Q7SYR0|CH2BA_XENLA Charged multivesicular body protein 2b-A OS=Xenopus laevis GN=chmp2b-a PE=2 SV=1 12 204 3.0E-10
sp|Q8BJF9|CHM2B_MOUSE Charged multivesicular body protein 2b OS=Mus musculus GN=Chmp2b PE=1 SV=1 7 204 6.0E-10
sp|Q6NXD2|CHM2B_DANRE Charged multivesicular body protein 2b OS=Danio rerio GN=chmp2b PE=2 SV=1 12 204 2.0E-09
sp|Q5RAV2|CHM2B_PONAB Charged multivesicular body protein 2b OS=Pongo abelii GN=CHMP2B PE=2 SV=1 7 204 2.0E-09
sp|Q9UQN3|CHM2B_HUMAN Charged multivesicular body protein 2b OS=Homo sapiens GN=CHMP2B PE=1 SV=1 7 204 2.0E-09
sp|Q6DFS6|CHM2A_XENTR Charged multivesicular body protein 2a OS=Xenopus tropicalis GN=chmp2a PE=2 SV=1 7 149 3.0E-09
sp|Q6IP52|CHM2A_XENLA Charged multivesicular body protein 2a OS=Xenopus laevis GN=chmp2a PE=2 SV=1 7 149 3.0E-09
sp|Q9DB34|CHM2A_MOUSE Charged multivesicular body protein 2a OS=Mus musculus GN=Chmp2a PE=1 SV=1 7 149 6.0E-09
sp|O43633|CHM2A_HUMAN Charged multivesicular body protein 2a OS=Homo sapiens GN=CHMP2A PE=1 SV=1 7 149 1.0E-08
sp|Q7ZW25|CHM2A_DANRE Charged multivesicular body protein 2a OS=Danio rerio GN=chmp2a PE=2 SV=1 8 149 4.0E-08
sp|P36108|DID4_YEAST DOA4-independent degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DID4 PE=1 SV=2 7 137 6.0E-08
sp|Q941D5|VPS2C_ARATH Vacuolar protein sorting-associated protein 2 homolog 3 OS=Arabidopsis thaliana GN=VPS2.3 PE=2 SV=1 4 172 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070690
MQAINRFLYGPTPEERVRAWQSKLRAEQRILDREMRQLDLATGKARTTVKQLAMKGDVKSARMLAKEVVRSSRQK
DNLSVSKARLGSISTQLAQQLAMAKVTGSLQKSTEIMKLSNSLIKLPQVSQTMREMSMEMTKAGILEEMLEDTLE
IEEDEELEEEAGAEVDKVLFELTDGKLGLIGPVGTGLPTIESTAEDEETERNMEQYRQQLDGLLST*
Coding >AgabiH97|070690
ATGCAAGCTATCAATCGCTTTCTCTATGGACCAACGCCAGAAGAGCGCGTGCGCGCATGGCAGTCAAAGTTGCGG
GCAGAACAAAGAATTTTGGATCGGGAGATGAGGCAGTTAGACTTGGCCACTGGCAAGGCTCGAACAACCGTTAAA
CAACTTGCTATGAAGGGTGATGTCAAATCTGCGCGTATGTTGGCAAAGGAGGTAGTAAGGAGTAGCAGGCAGAAA
GACAATTTGTCTGTCAGCAAAGCAAGACTTGGTTCAATCAGTACACAACTTGCGCAGCAGTTAGCCATGGCGAAA
GTGACCGGGTCCCTGCAGAAATCGACTGAAATAATGAAGTTGTCTAATTCACTTATCAAGCTTCCCCAGGTTAGC
CAAACCATGCGAGAGATGAGCATGGAGATGACCAAGGCTGGCATATTAGAGGAGATGCTTGAAGACACTCTGGAG
ATTGAGGAGGACGAGGAACTGGAAGAAGAGGCTGGCGCCGAAGTCGATAAAGTGTTATTCGAGTTAACTGATGGA
AAACTTGGCCTTATTGGTCCTGTGGGGACGGGACTCCCGACTATCGAAAGCACCGCAGAAGACGAAGAAACAGAG
CGAAATATGGAACAATATCGGCAACAGCTTGATGGTTTACTCAGCACCTAG
Transcript >AgabiH97|070690
ATGCAAGCTATCAATCGCTTTCTCTATGGACCAACGCCAGAAGAGCGCGTGCGCGCATGGCAGTCAAAGTTGCGG
GCAGAACAAAGAATTTTGGATCGGGAGATGAGGCAGTTAGACTTGGCCACTGGCAAGGCTCGAACAACCGTTAAA
CAACTTGCTATGAAGGGTGATGTCAAATCTGCGCGTATGTTGGCAAAGGAGGTAGTAAGGAGTAGCAGGCAGAAA
GACAATTTGTCTGTCAGCAAAGCAAGACTTGGTTCAATCAGTACACAACTTGCGCAGCAGTTAGCCATGGCGAAA
GTGACCGGGTCCCTGCAGAAATCGACTGAAATAATGAAGTTGTCTAATTCACTTATCAAGCTTCCCCAGGTTAGC
CAAACCATGCGAGAGATGAGCATGGAGATGACCAAGGCTGGCATATTAGAGGAGATGCTTGAAGACACTCTGGAG
ATTGAGGAGGACGAGGAACTGGAAGAAGAGGCTGGCGCCGAAGTCGATAAAGTGTTATTCGAGTTAACTGATGGA
AAACTTGGCCTTATTGGTCCTGTGGGGACGGGACTCCCGACTATCGAAAGCACCGCAGAAGACGAAGAAACAGAG
CGAAATATGGAACAATATCGGCAACAGCTTGATGGTTTACTCAGCACCTAG
Gene >AgabiH97|070690
ATGCAAGCTATCAATCGCTTTCTCTATGGACCAACGCCAGAAGAGCGCGTGCGCGCATGGCAGTCAAAGTTGCGG
GCAGAACAAAGAATTTTGGATCGGGAGATGAGGCAGGTTGGAGATCGTAGCTCTTTGATGATGCTGGATATTAAT
TTTCCAATTTCAGTTAGACTTGGCCACTGGCAAGGCTCGAACAACCGTTAAACAACTTGCTATGAAGGGTGATGT
CAAATCTGCGCGTATGTTGGCAAAGGAGGTAGTAAGGAGTAGCAGGCAGAAAGACAATTTGTCTGTCAGCAAAGC
AAGACTTGGTTCAATCAGTACACAACTTGCGCAGCAGTTAGGTGGGAGCGTAATGCATTCTCAAAAACCACCGAT
TGACACAATTTCATTGCTAGCCATGGCGAAAGTGACCGGGTCCCTGCAGAAATCGACTGAAATAATGAAGTTGTC
TAATTCACTTATCAAGCTTCCCCAGGTTAGCCAAACCATGCGAGAGATGAGCATGGAGATGACCAAGGTACTTCC
AATTTGAGATTCTTTGCATCAATGATAATTAGTCCAATATCCAGGCTGGCATATTAGAGGAGATGCTTGAAGACA
CTCTGGAGATTGAGGAGGACGAGGAACTGGAAGAAGAGGCTGGCGCCGAAGTCGATAAAGTGTTATTCGAGTTAA
CTGATGGAAAACTTGGCCTTATTGGTCCTGTGGGGACGGGACTCCCGGTGAGCCTTACTTGGGAATGTCCTCACT
GATTAAAACTGACATCTCATTTCCAGACTATCGAAAGCACCGCAGAAGACGAAGAAACAGAGCGAAATATGGAAC
AATATCGGCAACAGCTTGATGGTTTACTCAGCACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail