Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070630
Gene name
Locationscaffold_4:1330439..1332161
Strand-
Gene length (bp)1722
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 7.2E-31 27 125
PF00085 Thioredoxin Thioredoxin 8.7E-24 364 469
PF13848 Thioredoxin_6 Thioredoxin-like domain 2.5E-29 160 340

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 25 480 8.0E-154
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 3 520 3.0E-143
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 25 520 6.0E-139
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 12 520 4.0E-132
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 1 489 2.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 25 480 8.0E-154
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 3 520 3.0E-143
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 25 520 6.0E-139
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 12 520 4.0E-132
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 1 489 2.0E-111
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 24 473 1.0E-93
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 21 475 3.0E-92
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 6 473 1.0E-91
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 11 475 7.0E-91
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 16 473 2.0E-90
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 19 473 4.0E-90
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 27 473 8.0E-90
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 22 473 3.0E-89
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 30 498 7.0E-89
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 19 475 2.0E-88
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 6 469 1.0E-87
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 19 475 3.0E-87
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 3 473 6.0E-84
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 22 513 2.0E-82
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 11 473 5.0E-80
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 4 471 3.0E-79
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 27 472 7.0E-79
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 27 472 1.0E-77
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 26 477 1.0E-76
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 125 439 3.0E-76
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 27 470 5.0E-76
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 27 472 7.0E-76
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 27 475 3.0E-75
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 1 474 2.0E-73
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 1 474 2.0E-73
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 27 520 4.0E-73
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 1 474 7.0E-73
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 27 469 8.0E-73
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 27 492 6.0E-72
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 25 475 7.0E-72
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 27 472 2.0E-71
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 5 488 3.0E-71
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 27 471 3.0E-71
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 27 475 5.0E-71
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 27 475 6.0E-71
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 27 470 9.0E-71
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 25 474 3.0E-70
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 1 474 5.0E-70
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 27 482 2.0E-68
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 1 474 7.0E-68
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 24 520 6.0E-67
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 12 476 1.0E-66
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 27 471 9.0E-64
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 24 482 2.0E-63
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 24 472 2.0E-59
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 27 471 2.0E-59
sp|P32474|EUG1_YEAST Protein disulfide-isomerase EUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EUG1 PE=1 SV=1 21 477 6.0E-59
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 12 482 2.0E-56
sp|Q95LM0|PDILT_MACFA Protein disulfide-isomerase-like protein of the testis OS=Macaca fascicularis GN=PDILT PE=2 SV=1 24 517 8.0E-26
sp|Q8N807|PDILT_HUMAN Protein disulfide-isomerase-like protein of the testis OS=Homo sapiens GN=PDILT PE=1 SV=2 24 477 9.0E-26
sp|Q66GQ3|PDI16_ARATH Protein disulfide isomerase-like 1-6 OS=Arabidopsis thaliana GN=PDIL1-6 PE=2 SV=1 27 451 2.0E-25
sp|Q5XI02|PDILT_RAT Protein disulfide-isomerase-like protein of the testis OS=Rattus norvegicus GN=Pdilt PE=1 SV=1 24 519 5.0E-24
sp|Q9DAN1|PDILT_MOUSE Protein disulfide-isomerase-like protein of the testis OS=Mus musculus GN=Pdilt PE=1 SV=2 24 506 8.0E-24
sp|A3KPF5|PDI15_ARATH Protein disulfide isomerase-like 1-5 OS=Arabidopsis thaliana GN=PDIL1-5 PE=2 SV=1 21 427 1.0E-23
sp|Q9D1Q6|ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 10 310 2.0E-23
sp|Q3T0L2|ERP44_BOVIN Endoplasmic reticulum resident protein 44 OS=Bos taurus GN=ERP44 PE=2 SV=1 10 310 7.0E-23
sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 10 310 2.0E-22
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 26 125 4.0E-22
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 30 157 1.0E-21
sp|Q5WA72|PDI15_ORYSJ Protein disulfide isomerase-like 1-5 OS=Oryza sativa subsp. japonica GN=PDIL1-5 PE=2 SV=1 23 473 1.0E-21
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 24 155 2.0E-21
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 16 150 2.0E-21
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 24 319 3.0E-21
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 22 125 8.0E-21
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 11 141 1.0E-20
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 341 475 2.0E-20
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 11 157 5.0E-20
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 15 330 5.0E-20
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 341 475 1.0E-19
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 364 475 2.0E-19
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 24 315 2.0E-19
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 363 487 2.0E-19
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 30 139 4.0E-19
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 362 492 8.0E-19
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 27 131 2.0E-18
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 341 475 2.0E-18
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 26 232 2.0E-18
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 24 278 2.0E-18
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 2 122 2.0E-18
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 371 472 3.0E-18
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 26 232 4.0E-18
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 26 123 4.0E-18
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 26 232 6.0E-18
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 27 129 7.0E-18
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 42 378 7.0E-18
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 27 131 1.0E-17
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 2 122 1.0E-17
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 1 122 1.0E-17
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 25 157 1.0E-17
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 46 155 1.0E-17
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 26 232 2.0E-17
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 1 122 2.0E-17
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 2 122 3.0E-17
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 27 131 4.0E-17
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 27 129 4.0E-17
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 27 164 4.0E-17
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 27 131 5.0E-17
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 371 470 5.0E-17
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 26 126 5.0E-17
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 30 157 5.0E-17
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 1 354 6.0E-17
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 3 129 7.0E-17
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 371 472 1.0E-16
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 1 354 2.0E-16
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 21 172 3.0E-16
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 10 128 3.0E-16
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 1 134 4.0E-16
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 26 129 5.0E-16
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 372 469 7.0E-16
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 14 125 8.0E-16
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 34 319 2.0E-15
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 25 157 3.0E-15
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 23 128 4.0E-15
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 357 470 5.0E-15
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 384 464 6.0E-15
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 384 484 1.0E-14
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 25 125 1.0E-14
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 31 127 2.0E-14
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 381 472 2.0E-14
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 22 140 2.0E-14
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 372 482 3.0E-14
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 25 125 3.0E-14
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 31 127 3.0E-14
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 22 140 4.0E-14
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 22 125 4.0E-14
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 22 140 5.0E-14
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 23 129 6.0E-14
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 22 140 6.0E-14
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 371 480 7.0E-14
sp|Q17688|TXNDL_CAEEL Thioredoxin domain-containing protein C06A6.5 OS=Caenorhabditis elegans GN=C06A6.5 PE=1 SV=2 26 323 9.0E-14
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 372 482 1.0E-13
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 25 125 3.0E-13
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 25 125 3.0E-13
sp|Q9LJU2|PDI53_ARATH Protein disulfide-isomerase 5-3 OS=Arabidopsis thaliana GN=PDIL5-3 PE=2 SV=1 30 142 3.0E-13
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 25 107 3.0E-13
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 355 470 4.0E-13
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 372 482 4.0E-13
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 372 482 6.0E-13
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 12 149 8.0E-13
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 12 149 1.0E-12
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 20 105 1.0E-12
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 22 140 3.0E-12
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 363 473 4.0E-12
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 362 473 6.0E-12
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 371 484 8.0E-12
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 1 152 9.0E-12
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 363 473 1.0E-11
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 349 476 1.0E-11
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 30 125 2.0E-11
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 379 473 3.0E-11
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 20 177 3.0E-11
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 35 111 3.0E-11
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 12 149 4.0E-11
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 12 149 4.0E-11
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 23 125 4.0E-11
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 30 104 5.0E-11
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 29 104 5.0E-11
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 30 117 6.0E-11
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 349 476 7.0E-11
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 18 144 1.0E-10
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 20 177 1.0E-10
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 6 289 1.0E-10
sp|Q8GYD1|PDI51_ARATH Protein disulfide-isomerase 5-1 OS=Arabidopsis thaliana GN=PDIL5-1 PE=2 SV=1 1 129 1.0E-10
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 379 466 2.0E-10
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 379 466 2.0E-10
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 15 149 2.0E-10
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 361 479 3.0E-10
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 25 129 3.0E-10
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 379 466 3.0E-10
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 379 466 3.0E-10
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 348 480 3.0E-10
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 28 134 3.0E-10
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 28 104 3.0E-10
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 28 105 3.0E-10
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 20 177 3.0E-10
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 20 125 4.0E-10
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 362 472 5.0E-10
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 384 467 5.0E-10
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 24 111 5.0E-10
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 24 111 5.0E-10
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 24 111 5.0E-10
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 24 111 5.0E-10
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 378 467 6.0E-10
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 24 135 8.0E-10
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 359 467 8.0E-10
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 348 475 8.0E-10
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 372 466 9.0E-10
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 364 476 1.0E-09
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 384 479 1.0E-09
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 25 105 1.0E-09
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 28 130 1.0E-09
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 25 129 2.0E-09
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 384 444 2.0E-09
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 384 472 2.0E-09
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 27 111 2.0E-09
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 321 489 3.0E-09
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 28 119 3.0E-09
sp|P40557|EPS1_YEAST ER-retained PMA1-suppressing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPS1 PE=1 SV=1 30 130 3.0E-09
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 28 132 3.0E-09
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 364 472 4.0E-09
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 371 465 4.0E-09
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 373 465 4.0E-09
sp|Q6AX23|QSOX2_XENLA Sulfhydryl oxidase 2 OS=Xenopus laevis GN=qsox2 PE=2 SV=1 361 475 4.0E-09
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 311 489 5.0E-09
sp|Q0Z7W6|TMX1_BOVIN Thioredoxin-related transmembrane protein 1 OS=Bos taurus GN=TMX1 PE=2 SV=1 25 137 5.0E-09
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 371 467 6.0E-09
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 30 111 6.0E-09
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 30 111 6.0E-09
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 384 465 7.0E-09
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 27 157 7.0E-09
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 29 140 1.0E-08
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 373 465 1.0E-08
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 29 111 1.0E-08
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 362 471 1.0E-08
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 31 107 1.0E-08
sp|O83889|THIO_TREPA Thioredoxin OS=Treponema pallidum (strain Nichols) GN=trxA PE=3 SV=1 27 111 1.0E-08
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 35 107 1.0E-08
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 40 107 1.0E-08
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 383 470 2.0E-08
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 383 465 2.0E-08
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 373 465 2.0E-08
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 30 105 2.0E-08
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 47 114 2.0E-08
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 362 472 3.0E-08
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 35 107 3.0E-08
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 47 110 3.0E-08
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 379 476 4.0E-08
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 14 108 4.0E-08
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 384 478 5.0E-08
sp|P14949|THIO_BACSU Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 41 107 5.0E-08
sp|Q9H3N1|TMX1_HUMAN Thioredoxin-related transmembrane protein 1 OS=Homo sapiens GN=TMX1 PE=1 SV=1 25 137 5.0E-08
sp|P20857|THIO2_NOSS1 Thioredoxin-2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxB PE=1 SV=3 362 475 6.0E-08
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 383 465 7.0E-08
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 373 472 7.0E-08
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 25 107 7.0E-08
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 25 107 7.0E-08
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 354 476 9.0E-08
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 372 467 9.0E-08
sp|Q1RKN1|THIO_RICBR Thioredoxin OS=Rickettsia bellii (strain RML369-C) GN=trxA PE=3 SV=2 29 111 1.0E-07
sp|P9WG67|THIO_MYCTU Thioredoxin OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxA PE=1 SV=1 29 109 1.0E-07
sp|P9WG66|THIO_MYCTO Thioredoxin OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxA PE=3 SV=1 29 109 1.0E-07
sp|P0A617|THIO_MYCBO Thioredoxin OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trxA PE=3 SV=2 29 109 1.0E-07
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 385 450 2.0E-07
sp|Q8VBT0|TMX1_MOUSE Thioredoxin-related transmembrane protein 1 OS=Mus musculus GN=Tmx1 PE=1 SV=1 46 125 2.0E-07
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 35 111 2.0E-07
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 27 111 2.0E-07
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 385 474 3.0E-07
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 356 453 3.0E-07
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 34 111 3.0E-07
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 25 112 5.0E-07
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 22 107 5.0E-07
sp|P0A4L3|THIO_LISMO Thioredoxin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxA PE=3 SV=1 27 133 5.0E-07
sp|P0A4L4|THIO_LISIN Thioredoxin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxA PE=3 SV=1 27 133 5.0E-07
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 27 111 5.0E-07
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 36 111 5.0E-07
sp|P34723|THIO_PENCH Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 40 107 5.0E-07
sp|Q7TN22|TXD16_MOUSE Thioredoxin domain-containing protein 16 OS=Mus musculus GN=Txndc16 PE=2 SV=1 30 350 5.0E-07
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 27 104 6.0E-07
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 27 104 6.0E-07
sp|O08841|QSOX1_CAVPO Sulfhydryl oxidase 1 OS=Cavia porcellus GN=QSOX1 PE=2 SV=2 25 105 6.0E-07
sp|A4FUW8|TXD11_BOVIN Thioredoxin domain-containing protein 11 OS=Bos taurus GN=TXNDC11 PE=2 SV=1 312 472 7.0E-07
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 27 108 7.0E-07
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 36 107 8.0E-07
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 25 112 9.0E-07
sp|P52232|THIO1_SYNY3 Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 35 109 9.0E-07
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 370 480 1.0E-06
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 363 450 1.0E-06
sp|A4FUW8|TXD11_BOVIN Thioredoxin domain-containing protein 11 OS=Bos taurus GN=TXNDC11 PE=2 SV=1 44 230 1.0E-06
sp|Q54KN7|THIO5_DICDI Putative thioredoxin-5 OS=Dictyostelium discoideum GN=trxE PE=3 SV=1 35 130 1.0E-06
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 45 107 1.0E-06
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 29 111 1.0E-06
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 35 140 1.0E-06
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 28 107 1.0E-06
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 30 129 1.0E-06
sp|Q4L5F0|THIO_STAHJ Thioredoxin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trxA PE=3 SV=1 27 111 1.0E-06
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 45 84 2.0E-06
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 27 104 2.0E-06
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 27 104 2.0E-06
sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 40 113 2.0E-06
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 26 107 2.0E-06
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 367 448 2.0E-06
sp|P09857|THIO_ALLVI Thioredoxin OS=Allochromatium vinosum GN=trxA PE=1 SV=1 27 107 2.0E-06
sp|P96132|THIO_THIRO Thioredoxin (Fragment) OS=Thiocapsa roseopersicina GN=trxA PE=3 SV=1 27 105 2.0E-06
sp|O84544|THIO_CHLTR Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 30 128 2.0E-06
sp|Q6ZRP7|QSOX2_HUMAN Sulfhydryl oxidase 2 OS=Homo sapiens GN=QSOX2 PE=1 SV=3 361 475 2.0E-06
sp|Q6AUC6|QSOX1_ORYSJ Sulfhydryl oxidase 1 OS=Oryza sativa subsp. japonica GN=QSOX1 PE=2 SV=1 22 101 2.0E-06
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 371 466 3.0E-06
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 376 451 3.0E-06
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 385 451 3.0E-06
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 30 107 3.0E-06
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 27 110 3.0E-06
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 27 110 3.0E-06
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 27 110 3.0E-06
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 27 110 3.0E-06
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 27 110 3.0E-06
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 27 110 3.0E-06
sp|Q49WR2|THIO_STAS1 Thioredoxin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trxA PE=3 SV=1 27 111 3.0E-06
sp|Q5UR25|TR362_MIMIV Thioredoxin domain-containing protein R362 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R362 PE=1 SV=1 46 125 3.0E-06
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 25 107 3.0E-06
sp|Q8LD49|TRXX_ARATH Thioredoxin X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2 371 440 3.0E-06
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 370 442 3.0E-06
sp|Q8K2W3|TXD11_MOUSE Thioredoxin domain-containing protein 11 OS=Mus musculus GN=Txndc11 PE=1 SV=1 44 227 3.0E-06
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 35 111 3.0E-06
sp|P0A0K5|THIO_STAAW Thioredoxin OS=Staphylococcus aureus (strain MW2) GN=trxA PE=3 SV=1 27 111 3.0E-06
sp|P0A0K6|THIO_STAAU Thioredoxin OS=Staphylococcus aureus GN=trxA PE=1 SV=1 27 111 3.0E-06
sp|Q6GA69|THIO_STAAS Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1 27 111 3.0E-06
sp|Q6GHU0|THIO_STAAR Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1 27 111 3.0E-06
sp|P99122|THIO_STAAN Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1 27 111 3.0E-06
sp|P0A0K4|THIO_STAAM Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=3 SV=1 27 111 3.0E-06
sp|Q5HGT9|THIO_STAAC Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1 27 111 3.0E-06
sp|Q2YXD0|THIO_STAAB Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1 27 111 3.0E-06
sp|Q2FZD2|THIO_STAA8 Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1 27 111 3.0E-06
sp|Q2FHT6|THIO_STAA3 Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1 27 111 3.0E-06
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 39 107 3.0E-06
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 39 107 4.0E-06
sp|Q9PJK3|THIO_CHLMU Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 34 128 4.0E-06
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 24 109 4.0E-06
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 384 477 5.0E-06
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 385 451 5.0E-06
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 375 451 6.0E-06
sp|Q9H3N1|TMX1_HUMAN Thioredoxin-related transmembrane protein 1 OS=Homo sapiens GN=TMX1 PE=1 SV=1 355 477 6.0E-06
sp|P96132|THIO_THIRO Thioredoxin (Fragment) OS=Thiocapsa roseopersicina GN=trxA PE=3 SV=1 362 444 6.0E-06
sp|Q9ZEE0|THIO_RICPR Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 27 111 6.0E-06
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 45 125 6.0E-06
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 36 111 6.0E-06
sp|Q5JMR9|TRXY_ORYSJ Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 6 125 7.0E-06
sp|Q69AB1|TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus GN=Txndc8 PE=2 SV=1 31 106 7.0E-06
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 363 450 8.0E-06
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 363 450 8.0E-06
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 372 450 8.0E-06
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 39 107 8.0E-06
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 385 468 9.0E-06
sp|Q8K2W3|TXD11_MOUSE Thioredoxin domain-containing protein 11 OS=Mus musculus GN=Txndc11 PE=1 SV=1 367 482 9.0E-06
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 33 111 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070630
MRLCSLTTSASILALASLVFADADSDVLSLTAKTFEESVATEPLMLVEFFAPWCGHCKALAPHYEEAATALKEKE
IKLAKVDCVEEAELCQSNGVQGYPTLKVYRNGTPADYTGPRKADGIISYMVKQSLPAVSEVTPANHEEFTKSDKI
VVIAYLPASDSEPVPVFSTVAEKHRDDYLFGLSTDPANAEAAGVKPPAMVVYRSFDEPRTEFPHPVSGLSVEEIG
DWLLELSVPVIDEVNGENYAIYATSGKPLAYLFLDPSTEEKDKLIEAIRPIAQKYKPKVNFVWIDGVKFGDHGRA
LNLHETKWPAFVIQDLQQQLKYPLDQSKEVTADLVSLWVEQFVKGELEPMLKSEPVPETQDESVYVVVGKEFEEV
VFDDSKDVFIEFYATWCGHCKRLKPTWDSLGDKYASIKDKIIIAKMEATENDLPASVPFRVQGFPTLKFKPAGSR
DFIDYEGDRSLESLVAFVEEHAQNSLEIPEKPVEKHEETPAEEAPVDDSDAAQAPESAPPAEETVAHEEL*
Coding >AgabiH97|070630
ATGCGCTTGTGCTCCCTCACAACCTCTGCCTCGATCCTCGCTTTGGCTTCATTGGTCTTTGCCGACGCGGACTCT
GATGTCCTCAGTCTCACTGCCAAAACCTTTGAGGAGTCTGTTGCAACCGAGCCTCTCATGCTCGTCGAGTTCTTC
GCGCCCTGGTGTGGTCACTGCAAGGCACTGGCACCTCATTATGAGGAGGCAGCCACAGCCCTAAAAGAGAAAGAA
ATTAAGCTCGCTAAAGTCGACTGCGTCGAAGAAGCTGAGCTTTGCCAGAGCAATGGTGTGCAGGGCTACCCTACG
CTCAAAGTGTACAGGAATGGTACACCGGCGGACTATACCGGTCCTCGCAAGGCGGACGGAATTATCAGTTACATG
GTCAAACAATCTCTCCCTGCTGTTTCTGAAGTTACCCCTGCCAACCACGAGGAGTTCACCAAGTCGGACAAGATT
GTCGTCATCGCCTACCTTCCCGCCTCTGATTCCGAGCCTGTACCCGTATTCAGCACCGTTGCTGAAAAGCACCGT
GATGACTACCTCTTCGGTCTTTCGACCGACCCAGCCAACGCTGAGGCTGCCGGTGTCAAGCCACCCGCTATGGTC
GTATATCGCTCTTTCGATGAGCCCCGTACCGAATTCCCTCACCCTGTTTCTGGCCTCAGCGTTGAGGAGATCGGC
GACTGGCTCCTCGAATTGTCAGTTCCGGTTATCGACGAGGTTAATGGCGAGAACTATGCTATTTATGCCACCAGC
GGCAAGCCTCTCGCATATCTATTCCTTGACCCTAGTACCGAGGAAAAAGACAAGCTTATTGAAGCTATACGTCCT
ATTGCTCAGAAGTACAAGCCCAAAGTGAACTTCGTTTGGATTGATGGTGTTAAATTCGGTGATCACGGTCGTGCC
CTCAATCTCCATGAAACAAAATGGCCCGCCTTCGTTATCCAGGACCTCCAACAACAACTCAAATACCCCCTTGAT
CAGTCCAAAGAGGTTACAGCCGACCTCGTTTCTCTATGGGTTGAACAGTTCGTCAAAGGGGAGCTCGAGCCTATG
CTCAAGAGTGAACCTGTTCCGGAAACTCAAGATGAAAGCGTATACGTCGTCGTTGGAAAAGAGTTCGAAGAAGTC
GTGTTTGACGACTCTAAGGATGTTTTCATTGAGTTCTACGCTACCTGGTGTGGTCACTGCAAGCGCCTGAAGCCC
ACTTGGGATTCCCTTGGCGACAAATACGCTTCCATCAAAGACAAGATCATCATCGCCAAGATGGAAGCTACTGAG
AATGACCTTCCTGCCAGCGTCCCCTTCCGTGTCCAAGGATTCCCTACTTTGAAGTTCAAGCCTGCCGGTTCTCGC
GACTTCATTGATTACGAGGGCGACCGTTCTCTTGAAAGCTTGGTTGCATTCGTTGAGGAGCACGCCCAAAATTCT
CTTGAGATCCCGGAGAAGCCCGTTGAGAAGCACGAAGAAACTCCCGCTGAGGAAGCCCCTGTTGACGACAGTGAT
GCAGCACAGGCTCCTGAGAGCGCACCCCCAGCCGAGGAGACTGTGGCACATGAGGAGCTTTGA
Transcript >AgabiH97|070630
ATGCGCTTGTGCTCCCTCACAACCTCTGCCTCGATCCTCGCTTTGGCTTCATTGGTCTTTGCCGACGCGGACTCT
GATGTCCTCAGTCTCACTGCCAAAACCTTTGAGGAGTCTGTTGCAACCGAGCCTCTCATGCTCGTCGAGTTCTTC
GCGCCCTGGTGTGGTCACTGCAAGGCACTGGCACCTCATTATGAGGAGGCAGCCACAGCCCTAAAAGAGAAAGAA
ATTAAGCTCGCTAAAGTCGACTGCGTCGAAGAAGCTGAGCTTTGCCAGAGCAATGGTGTGCAGGGCTACCCTACG
CTCAAAGTGTACAGGAATGGTACACCGGCGGACTATACCGGTCCTCGCAAGGCGGACGGAATTATCAGTTACATG
GTCAAACAATCTCTCCCTGCTGTTTCTGAAGTTACCCCTGCCAACCACGAGGAGTTCACCAAGTCGGACAAGATT
GTCGTCATCGCCTACCTTCCCGCCTCTGATTCCGAGCCTGTACCCGTATTCAGCACCGTTGCTGAAAAGCACCGT
GATGACTACCTCTTCGGTCTTTCGACCGACCCAGCCAACGCTGAGGCTGCCGGTGTCAAGCCACCCGCTATGGTC
GTATATCGCTCTTTCGATGAGCCCCGTACCGAATTCCCTCACCCTGTTTCTGGCCTCAGCGTTGAGGAGATCGGC
GACTGGCTCCTCGAATTGTCAGTTCCGGTTATCGACGAGGTTAATGGCGAGAACTATGCTATTTATGCCACCAGC
GGCAAGCCTCTCGCATATCTATTCCTTGACCCTAGTACCGAGGAAAAAGACAAGCTTATTGAAGCTATACGTCCT
ATTGCTCAGAAGTACAAGCCCAAAGTGAACTTCGTTTGGATTGATGGTGTTAAATTCGGTGATCACGGTCGTGCC
CTCAATCTCCATGAAACAAAATGGCCCGCCTTCGTTATCCAGGACCTCCAACAACAACTCAAATACCCCCTTGAT
CAGTCCAAAGAGGTTACAGCCGACCTCGTTTCTCTATGGGTTGAACAGTTCGTCAAAGGGGAGCTCGAGCCTATG
CTCAAGAGTGAACCTGTTCCGGAAACTCAAGATGAAAGCGTATACGTCGTCGTTGGAAAAGAGTTCGAAGAAGTC
GTGTTTGACGACTCTAAGGATGTTTTCATTGAGTTCTACGCTACCTGGTGTGGTCACTGCAAGCGCCTGAAGCCC
ACTTGGGATTCCCTTGGCGACAAATACGCTTCCATCAAAGACAAGATCATCATCGCCAAGATGGAAGCTACTGAG
AATGACCTTCCTGCCAGCGTCCCCTTCCGTGTCCAAGGATTCCCTACTTTGAAGTTCAAGCCTGCCGGTTCTCGC
GACTTCATTGATTACGAGGGCGACCGTTCTCTTGAAAGCTTGGTTGCATTCGTTGAGGAGCACGCCCAAAATTCT
CTTGAGATCCCGGAGAAGCCCGTTGAGAAGCACGAAGAAACTCCCGCTGAGGAAGCCCCTGTTGACGACAGTGAT
GCAGCACAGGCTCCTGAGAGCGCACCCCCAGCCGAGGAGACTGTGGCACATGAGGAGCTTTGA
Gene >AgabiH97|070630
ATGCGCTTGTGCTCCCTCACAACCTCTGCCTCGATCCTCGCTTTGGCTTCATTGGTCTTTGCCGACGCGGACTCT
GATGTCCTCAGTCTCACTGCCAAAACCTTTGAGGAGTCTGTTGCAACCGAGCCTCTCATGCTCGTCGAGTTCTTC
GCGCCCTGGTGTGGTCACTGCAAGGCACTGGCACCTCATTATGAGGAGGCAGCCACAGCCCTAAAAGAGAAAGAA
ATTAAGCTCGCTAAAGTCGACTGCGTCGAAGAAGCTGAGCTTTGCCAGAGCAATGGTGTGCAGGGCTACCCGTAG
GTTGATTCCATAATCTGTATTCCCACCAGAACTGACACTGCGCATAGTACGCTCAAAGTGTACAGGAATGGTACA
CCGGCGGACTATACCGGTCCTCGCAAGGCGGACGGAATTATCAGTTACATGGTCAAGCGAGTATCATTTATCTAC
GATACATATATTCGTCCTAATTCTTTCTTTGAAGACAATCTCTCCCTGCTGTTTCTGAAGTTACCCCTGCCAACC
ACGAGGAGTTCACCAAGTCGGACAAGATTGTCGTCATCGCCTACCTTCCCGCCTCTGATTCCGAGCCTGTACCCG
TATTCAGCACCGTTGCTGAAAAGCACCGTGATGACTACCTCTTCGGTCTTTCGACCGACCCAGCCAACGCTGAGG
CTGCCGGTGTCAAGCCACCCGCTATGGTCGTATATCGCTCTTTCGATGAGCCCCGTACCGAATTCCCTCACCCTG
TTTCTGGCCTCAGCGTTGAGGAGATCGGCGACTGGCTCCTCGAATTGTCAGTTCCGGTTATCGACGAGGTTAATG
GCGAGAACTATGCTATTTATGCCACCAGCGGCAAGCCTCTCGCATATCTATTCCTTGACCCTAGTACCGAGGAAA
AAGACAAGCTTATTGAAGCTATACGTCCTATTGCTCAGAAGTACAAGCCCAAAGTGAACTTCGTTTGGATTGATG
GTGTTAAATTCGGTGATCACGGTCGTGCCCTCAATCTCCATGAAACAAAATGGCCCGCCTTCGTTATCCAGGACC
TCCAACAACAACTCAAATACCCCCTTGATCAGTCCAAAGAGGTTACAGCCGACCTCGTTTCTCTATGGGTTGAAC
AGTTCGTCAAAGGGGAGCTCGAGCCTATGCTCAAGAGTGAACCTGTTCCGGAAACTCAAGATGAAAGCGTATACG
TCGTCGTTGGAAAAGAGTTCGAAGAAGTCGTGTTTGACGACTCTAAGGATGTTTTCATTGAGTTCTACGCTACCT
GGTGTGGTCACTGCAAGCGCCTGAAGCCCACTTGGGATTCCCTTGGCGACAAATACGCTTCCATCAAAGACAAGA
TCATCATGTCAGTATTTTTTTTTCTCGCTCCACCTGAGCTTGGCTGATCCCGTTTTCTGCAGCGCCAAGATGGAA
GCTACTGAGAATGACCTTCCTGCCAGCGTCCCCTTCCGTGTCCAAGGATTCCCTACTTTGAAGTTCAAGCCTGCC
GGTTCTCGCGACTTCATTGATTACGAGGGCGACCGTTCTCTTGAAAGCTTGGTTGCATTCGTTGAGGAGCACGCC
CAAAATTCTCTTGAGATCCCGGAGAAGCCCGTTGAGAAGCACGAAGAAACTCCCGCTGAGGAAGCCCCTGTTGAC
GACAGTGATGCAGCACAGGCTCCTGAGAGCGCACCCCCAGCCGAGGAGACTGTGGCACATGAGGAGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail