Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070430
Gene name
Locationscaffold_4:1274285..1275407
Strand+
Gene length (bp)1122
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain 1.2E-51 114 287
PF02749 QRPTase_N Quinolinate phosphoribosyl transferase, N-terminal domain 1.6E-19 48 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43619|NADC_YEAST Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA6 PE=1 SV=1 1 288 4.0E-105
sp|A7SG73|NADC_NEMVE Nicotinate-nucleotide pyrophosphorylase [carboxylating] (Fragment) OS=Nematostella vectensis GN=qprt PE=3 SV=1 3 288 2.0E-91
sp|Q75JX0|NADC_DICDI Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Dictyostelium discoideum GN=qprt PE=3 SV=1 9 290 1.0E-86
sp|Q91X91|NADC_MOUSE Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mus musculus GN=Qprt PE=1 SV=1 20 288 6.0E-84
sp|Q5I0M2|NADC_RAT Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Rattus norvegicus GN=Qprt PE=2 SV=1 2 288 1.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43619|NADC_YEAST Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA6 PE=1 SV=1 1 288 4.0E-105
sp|A7SG73|NADC_NEMVE Nicotinate-nucleotide pyrophosphorylase [carboxylating] (Fragment) OS=Nematostella vectensis GN=qprt PE=3 SV=1 3 288 2.0E-91
sp|Q75JX0|NADC_DICDI Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Dictyostelium discoideum GN=qprt PE=3 SV=1 9 290 1.0E-86
sp|Q91X91|NADC_MOUSE Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mus musculus GN=Qprt PE=1 SV=1 20 288 6.0E-84
sp|Q5I0M2|NADC_RAT Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Rattus norvegicus GN=Qprt PE=2 SV=1 2 288 1.0E-82
sp|Q15274|NADC_HUMAN Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Homo sapiens GN=QPRT PE=1 SV=3 6 288 1.0E-80
sp|Q3T063|NADC_BOVIN Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Bos taurus GN=QPRT PE=2 SV=1 2 288 2.0E-72
sp|P74301|NADC_SYNY3 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nadC PE=3 SV=1 9 290 5.0E-45
sp|O28439|NADC_ARCFU Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=nadC PE=3 SV=1 41 288 7.0E-45
sp|Q57916|NADC_METJA Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=nadC PE=3 SV=1 47 290 1.0E-41
sp|P30819|NADC_PSEAE Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nadC PE=3 SV=2 1 288 4.0E-41
sp|P30012|NADC_SALTY Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nadC PE=1 SV=3 49 288 1.0E-38
sp|O27860|NADC_METTH Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=nadC PE=3 SV=1 49 289 2.0E-38
sp|P39666|NADC_BACSU Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Bacillus subtilis (strain 168) GN=nadC PE=1 SV=2 34 292 2.0E-38
sp|Q9ZU32|NADC_ARATH Nicotinate-nucleotide pyrophosphorylase [carboxylating], chloroplastic OS=Arabidopsis thaliana GN=QPT PE=2 SV=2 11 289 1.0E-34
sp|Q9ZJN2|NADC_HELPJ Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nadC PE=3 SV=1 14 288 3.0E-33
sp|P30011|NADC_ECOLI Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Escherichia coli (strain K12) GN=nadC PE=3 SV=7 49 289 4.0E-33
sp|Q0IZS0|NADC_ORYSJ Nicotinate-nucleotide pyrophosphorylase [carboxylating], chloroplastic OS=Oryza sativa subsp. japonica GN=Os09g0553600 PE=2 SV=1 11 289 3.0E-32
sp|O25909|NADC_HELPY Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nadC PE=1 SV=1 35 288 4.0E-32
sp|P77938|NADC_RHORU Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Rhodospirillum rubrum GN=nadC PE=3 SV=1 49 288 7.0E-31
sp|P46714|NADC_MYCLE Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mycobacterium leprae (strain TN) GN=nadC PE=3 SV=1 49 288 6.0E-27
sp|P9WJJ7|NADC_MYCTU Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nadC PE=1 SV=1 49 288 2.0E-24
sp|P9WJJ6|NADC_MYCTO Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nadC PE=3 SV=1 49 288 2.0E-24
sp|P58496|MODD_ECO57 Putative pyrophosphorylase ModD OS=Escherichia coli O157:H7 GN=modD PE=3 SV=1 14 233 1.0E-07
sp|Q57278|MODD_HAEIN Putative pyrophosphorylase ModD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=modD PE=3 SV=1 21 274 1.0E-07
sp|P59245|MODD_ECOL6 Putative pyrophosphorylase ModD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=modD PE=3 SV=1 14 233 1.0E-07
sp|P94777|MODD_ECO27 Putative pyrophosphorylase ModD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=modD PE=3 SV=4 14 233 2.0E-07
sp|Q9CLU4|MODD_PASMU Putative pyrophosphorylase ModD OS=Pasteurella multocida (strain Pm70) GN=modD PE=3 SV=1 20 274 2.0E-07
sp|Q08384|MODD_RHOCA Putative pyrophosphorylase ModD OS=Rhodobacter capsulatus GN=modD PE=3 SV=1 23 174 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016763 pentosyltransferase activity Yes
GO:0004514 nicotinate-nucleotide diphosphorylase (carboxylating) activity Yes
GO:0009435 NAD biosynthetic process Yes
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0072524 pyridine-containing compound metabolic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019359 nicotinamide nucleotide biosynthetic process No
GO:0008152 metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0019362 pyridine nucleotide metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009058 biosynthetic process No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0016757 glycosyltransferase activity No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0019363 pyridine nucleotide biosynthetic process No
GO:0009987 cellular process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046496 nicotinamide nucleotide metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0016740 transferase activity No
GO:0009117 nucleotide metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070430
MPKQYAHLLPPTWKTQVSVWLAEDTPSFDYGGYVVGEAEREAFLFGKGKQSAVLAGSPFFTEVFEQLGCSVEWHL
NDGDSFVPIKHVATVRGKARHLLLGERVALNILARCSGIATKSQSILSQARSYGYTGLIAGTRKTTPGFRLVEKY
GMLVGGIDSHRHDLSSMIMLKDNHIWSSGSITEAIKEARKVGGFSLLLDVEVRNREEAEEAIAAGADVIMLDNME
GDELINVAIELKRKWKGQRKFLFESSGNITEENLQSRAHNAIDILSTSAVHQSVQHVDFSLKLQRPNLESL*
Coding >AgabiH97|070430
ATGCCGAAACAATATGCACACTTACTTCCTCCTACCTGGAAAACACAGGTTTCTGTTTGGTTAGCAGAAGACACC
CCTTCGTTCGATTACGGAGGTTATGTCGTTGGGGAAGCCGAAAGAGAAGCGTTCTTATTCGGAAAGGGGAAGCAA
TCTGCCGTACTTGCCGGTTCACCTTTTTTCACCGAAGTCTTTGAACAACTCGGTTGCTCGGTGGAATGGCATTTG
AATGACGGCGATTCTTTCGTGCCTATCAAACACGTTGCCACCGTTCGTGGAAAAGCACGGCACCTATTATTGGGC
GAACGCGTCGCTCTCAATATTCTAGCTCGTTGTAGTGGAATAGCGACTAAGTCCCAGAGTATTCTCAGTCAAGCG
CGAAGTTATGGTTATACTGGTCTTATTGCGGGTACCCGCAAGACTACCCCCGGCTTCCGCCTTGTGGAGAAATAT
GGTATGCTTGTTGGCGGTATCGACTCTCATCGGCACGATCTTTCAAGCATGATAATGCTCAAAGATAACCACATT
TGGTCCTCCGGATCAATTACAGAGGCAATCAAGGAAGCTCGGAAAGTCGGTGGATTCAGTCTACTTCTTGACGTT
GAAGTAAGAAATAGAGAGGAAGCTGAAGAAGCTATCGCGGCAGGGGCAGATGTCATCATGCTTGATAACATGGAA
GGTGATGAATTAATTAATGTGGCTATCGAGTTGAAACGAAAGTGGAAGGGACAACGCAAGTTTTTATTTGAATCT
AGCGGGAATATCACGGAAGAGAACCTGCAGAGCAGAGCTCATAACGCTATAGATATATTGAGTACCAGCGCGGTC
CATCAGTCTGTGCAGCACGTTGATTTTAGCCTTAAGTTACAGAGACCTAACTTAGAGTCTCTATGA
Transcript >AgabiH97|070430
ATGCCGAAACAATATGCACACTTACTTCCTCCTACCTGGAAAACACAGGTTTCTGTTTGGTTAGCAGAAGACACC
CCTTCGTTCGATTACGGAGGTTATGTCGTTGGGGAAGCCGAAAGAGAAGCGTTCTTATTCGGAAAGGGGAAGCAA
TCTGCCGTACTTGCCGGTTCACCTTTTTTCACCGAAGTCTTTGAACAACTCGGTTGCTCGGTGGAATGGCATTTG
AATGACGGCGATTCTTTCGTGCCTATCAAACACGTTGCCACCGTTCGTGGAAAAGCACGGCACCTATTATTGGGC
GAACGCGTCGCTCTCAATATTCTAGCTCGTTGTAGTGGAATAGCGACTAAGTCCCAGAGTATTCTCAGTCAAGCG
CGAAGTTATGGTTATACTGGTCTTATTGCGGGTACCCGCAAGACTACCCCCGGCTTCCGCCTTGTGGAGAAATAT
GGTATGCTTGTTGGCGGTATCGACTCTCATCGGCACGATCTTTCAAGCATGATAATGCTCAAAGATAACCACATT
TGGTCCTCCGGATCAATTACAGAGGCAATCAAGGAAGCTCGGAAAGTCGGTGGATTCAGTCTACTTCTTGACGTT
GAAGTAAGAAATAGAGAGGAAGCTGAAGAAGCTATCGCGGCAGGGGCAGATGTCATCATGCTTGATAACATGGAA
GGTGATGAATTAATTAATGTGGCTATCGAGTTGAAACGAAAGTGGAAGGGACAACGCAAGTTTTTATTTGAATCT
AGCGGGAATATCACGGAAGAGAACCTGCAGAGCAGAGCTCATAACGCTATAGATATATTGAGTACCAGCGCGGTC
CATCAGTCTGTGCAGCACGTTGATTTTAGCCTTAAGTTACAGAGACCTAACTTAGAGTCTCTATGA
Gene >AgabiH97|070430
ATGCCGAAACAATATGCACACTTACTTCCTCCTACCTGGAAAACACAGGTTTCTGTTTGGTTAGCAGAAGACACC
CCTTCGTTCGATTACGGAGGTTATGTCGTTGGGGAAGCCGAAAGAGAAGCGTTCTTATTCGGAAAGGGGAAGCAA
TCTGCCGTACTTGCCGGTTCACCTTTTTTCACCGAAGTCTTTGAACAACTCGGTTGCTCGTAAGTGGCGCAGTGT
ATTGTTATTGTAGAAGGTTCTACTTCGGCTAATCACCAAATGTTCTTTCATTAGGGTGGAATGGCATTTGAATGA
CGGCGATTCTTTCGTGCCTATCAAACACGTTGCCACCGTTCGTGGAAAAGCACGGCACCTATTATTGGGCGAACG
CGTCGCTCTCAATATTCTAGCTCGTTGTAGTGGAATAGCGACTAAGTAGGTTCCATTTAAACCCAGCTTTTGATG
TTTTCCATTCACGTTTGGTTAGGTCCCAGAGTATTCTCAGTCAAGCGCGAAGTTATGGTTATACTGGTCTTATTG
CGGGTACCCGCAAGACTACCCCCGGCTTCCGCCTTGTGGAGAAATATGGTATGCTTGTTGGCGGTATCGACTCTC
ATCGGCACGATCTTTCAAGCATGATAATGCTCAAAGATAACCACATTTGGTCCTCCGGTTAGTTTTTTTTCTTCC
TCTCATGCAAGTATCTTGTTAACCTCCAAGGCGCAGGATCAATTACAGAGGCAATCAAGGAAGCTCGGAAAGTCG
GTGGATTCAGTCTACTTCTTGACGTTGAAGTAAGAAATAGAGAGGAAGCTGAAGAAGCTATCGCGGCAGGGGCAG
ATGTCATCATGCTTGATAACATGGAAGGTGATGAATTAATTAATGTGGCTATCGAGTTGAAACGAAAGTGGAAGG
GACAACGCAAGTTTTTATTTGAATCTAGCGGGAATATCACGGAAGAGAACCTGCAGAGCAGAGCTCATAACGGTC
GGTGCTGCATTGTAACATCTTACAAGCCTGATACCAACACTCCAATTTCTAGCTATAGATATATTGAGTACCAGC
GCGGTCCATCAGTCTGTGCAGCACGTTGATTTTAGCCTTAAGTTACAGAGACCTAACTTAGAGTCTCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail