Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070410
Gene name
Locationscaffold_4:1271512..1272232
Strand+
Gene length (bp)720
Transcript length (bp)558
Coding sequence length (bp)558
Protein length (aa) 186

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10342 Kre9_KNH Kre9/KNH-like N-terminal Ig-like domain 1.0E-07 22 116

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74947|YJBA_SCHPO Uncharacterized protein C553.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC553.10 PE=3 SV=1 8 116 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070410
MRSIAITLALVASACAYSVSQPSSSMGWSTSGGQPLTWSRVDTDPTNFTVVLTNQDRSVLPQDQVLIAEQDGVGQ
TKVSCNPPSGGWPVGDHFRVNLVKNVDEQNAILAQSSEFTIKAANTTSSILNISANQPAPTAPVSPPPTSNTDPE
SSDSAPPPAPNGAVTISINTAILAVVGGAIACFTA*
Coding >AgabiH97|070410
ATGCGTTCCATTGCCATTACCCTTGCCCTCGTCGCCTCTGCCTGCGCATACAGTGTCTCTCAACCCAGTAGTTCC
ATGGGTTGGTCAACTTCGGGTGGCCAACCCCTTACCTGGTCTCGAGTTGATACCGACCCGACCAACTTCACAGTT
GTTCTCACCAACCAGGACCGCTCTGTCCTGCCTCAAGACCAAGTTTTAATCGCTGAGCAGGATGGTGTTGGCCAG
ACGAAAGTCTCGTGCAACCCTCCTAGCGGTGGCTGGCCCGTCGGAGATCACTTCAGGGTCAACCTCGTTAAAAAC
GTTGACGAGCAGAACGCCATCTTGGCTCAGTCCAGCGAATTCACGATCAAGGCCGCAAATACCACGTCTAGTATT
TTAAACATCTCAGCAAACCAACCGGCACCAACTGCACCAGTCTCCCCTCCACCCACCTCCAACACAGATCCAGAG
TCCTCAGACAGCGCACCTCCCCCTGCCCCCAATGGCGCTGTTACCATCAGCATCAATACAGCCATTCTAGCTGTT
GTTGGTGGTGCTATCGCATGTTTCACTGCGTAA
Transcript >AgabiH97|070410
ATGCGTTCCATTGCCATTACCCTTGCCCTCGTCGCCTCTGCCTGCGCATACAGTGTCTCTCAACCCAGTAGTTCC
ATGGGTTGGTCAACTTCGGGTGGCCAACCCCTTACCTGGTCTCGAGTTGATACCGACCCGACCAACTTCACAGTT
GTTCTCACCAACCAGGACCGCTCTGTCCTGCCTCAAGACCAAGTTTTAATCGCTGAGCAGGATGGTGTTGGCCAG
ACGAAAGTCTCGTGCAACCCTCCTAGCGGTGGCTGGCCCGTCGGAGATCACTTCAGGGTCAACCTCGTTAAAAAC
GTTGACGAGCAGAACGCCATCTTGGCTCAGTCCAGCGAATTCACGATCAAGGCCGCAAATACCACGTCTAGTATT
TTAAACATCTCAGCAAACCAACCGGCACCAACTGCACCAGTCTCCCCTCCACCCACCTCCAACACAGATCCAGAG
TCCTCAGACAGCGCACCTCCCCCTGCCCCCAATGGCGCTGTTACCATCAGCATCAATACAGCCATTCTAGCTGTT
GTTGGTGGTGCTATCGCATGTTTCACTGCGTAA
Gene >AgabiH97|070410
ATGCGTTCCATTGCCATTACCCTTGCCCTCGTCGCCTCTGCCTGCGCATACAGTGTCTCTCAACCCAGTAGTTCC
ATGGGTTGGTCAACTTCGGGTGGCCAACCGTGAGCACAACCTCTCCTTCCTGTCGATGCACATAGCTCTGACGTC
TGCAATGTCCAGCCTTACCTGGTCTCGAGTTGATACCGACCCGACCAACTTCACAGTTGTTCTCACCAACCAGGT
ACGCAAGGAGAAATTCTCTCACTTGCCCCCTGATGTAACGCTTACCTTTTAGGACCGCTCTGTCCTGCCTCAAGA
CCAAGTTTTAATCGCTGAGCAGGATGGTGTTGGCCAGACGAAAGTCTCGTGCAACCCTCCTAGCGGTGGCTGGCC
CGTCGGAGATCACTTCAGGGTCAACCTCGTTAAAAACGTTGACGAGCAGAACGCCATCTTGGCTCAGTCCAGCGA
ATTCACGATCAAGGCCGCAAATACCACGTCTAGTATTTTAAACATCTCAGCAAACCAACCGTAAGTACCGAGAAG
TGTAGGGTAAAAAGTTCAAGTCTAATTTTTATTAGGGCACCAACTGCACCAGTCTCCCCTCCACCCACCTCCAAC
ACAGATCCAGAGTCCTCAGACAGCGCACCTCCCCCTGCCCCCAATGGCGCTGTTACCATCAGCATCAATACAGCC
ATTCTAGCTGTTGTTGGTGGTGCTATCGCATGTTTCACTGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail