Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070340
Gene name
Locationscaffold_4:1262352..1263446
Strand-
Gene length (bp)1094
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00025 Arf ADP-ribosylation factor family 6.1E-78 101 271
PF00071 Ras Ras family 5.3E-12 113 233
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 1.6E-13 113 223
PF09439 SRPRB Signal recognition particle receptor beta subunit 1.5E-13 111 237
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 9.8E-09 113 235
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.5E-05 113 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM16|ARF_CRYNJ ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARF PE=1 SV=1 95 274 5.0E-118
sp|P0CM17|ARF_CRYNB ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARF PE=3 SV=1 95 274 5.0E-118
sp|P36579|ARF1_SCHPO ADP-ribosylation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf1 PE=2 SV=2 95 271 4.0E-117
sp|Q06396|ARF1_ORYSJ ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3 95 274 6.0E-114
sp|P51823|ARF2_ORYSJ ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2 95 274 7.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM16|ARF_CRYNJ ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARF PE=1 SV=1 95 274 5.0E-118
sp|P0CM17|ARF_CRYNB ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARF PE=3 SV=1 95 274 5.0E-118
sp|P36579|ARF1_SCHPO ADP-ribosylation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf1 PE=2 SV=2 95 271 4.0E-117
sp|Q06396|ARF1_ORYSJ ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3 95 274 6.0E-114
sp|P51823|ARF2_ORYSJ ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2 95 274 7.0E-114
sp|P51821|ARF1_CHLRE ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2 95 274 1.0E-113
sp|O48920|ARF_VIGUN ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3 95 274 2.0E-113
sp|P91924|ARF_DUGJA ADP-ribosylation factor OS=Dugesia japonica PE=2 SV=3 95 274 2.0E-113
sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3 95 274 4.0E-113
sp|P84082|ARF2_RAT ADP-ribosylation factor 2 OS=Rattus norvegicus GN=Arf2 PE=2 SV=1 95 271 7.0E-113
sp|Q8BSL7|ARF2_MOUSE ADP-ribosylation factor 2 OS=Mus musculus GN=Arf2 PE=1 SV=2 95 271 7.0E-113
sp|P84081|ARF2_BOVIN ADP-ribosylation factor 2 OS=Bos taurus GN=ARF2 PE=2 SV=1 95 271 7.0E-113
sp|P36397|ARF1_ARATH ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2 95 274 1.0E-112
sp|P0DH91|ARF2B_ARATH ADP-ribosylation factor 2-B OS=Arabidopsis thaliana GN=ARF2-B PE=2 SV=1 95 272 1.0E-112
sp|Q9LQC8|ARF2A_ARATH ADP-ribosylation factor 2-A OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=2 95 272 1.0E-112
sp|P51824|ARF1_SOLTU ADP-ribosylation factor 1 OS=Solanum tuberosum PE=2 SV=2 95 271 2.0E-112
sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2 95 274 2.0E-112
sp|P22274|ARF_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARF1 PE=3 SV=4 95 273 2.0E-112
sp|P61207|ARF3_TAKRU ADP-ribosylation factor 3 OS=Takifugu rubripes GN=arf3 PE=3 SV=2 95 271 2.0E-112
sp|P61206|ARF3_RAT ADP-ribosylation factor 3 OS=Rattus norvegicus GN=Arf3 PE=2 SV=2 95 271 2.0E-112
sp|Q5R5P7|ARF3_PONAB ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 PE=2 SV=3 95 271 2.0E-112
sp|P61205|ARF3_MOUSE ADP-ribosylation factor 3 OS=Mus musculus GN=Arf3 PE=2 SV=2 95 271 2.0E-112
sp|P61204|ARF3_HUMAN ADP-ribosylation factor 3 OS=Homo sapiens GN=ARF3 PE=1 SV=2 95 271 2.0E-112
sp|Q5E9I6|ARF3_BOVIN ADP-ribosylation factor 3 OS=Bos taurus GN=ARF3 PE=2 SV=3 95 271 2.0E-112
sp|P51822|ARF1_DAUCA ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2 95 274 4.0E-112
sp|P51643|ARF1_XENLA ADP-ribosylation factor 1 OS=Xenopus laevis GN=arf1 PE=2 SV=2 95 271 1.0E-111
sp|P84079|ARF1_RAT ADP-ribosylation factor 1 OS=Rattus norvegicus GN=Arf1 PE=1 SV=2 95 271 1.0E-111
sp|P84078|ARF1_MOUSE ADP-ribosylation factor 1 OS=Mus musculus GN=Arf1 PE=1 SV=2 95 271 1.0E-111
sp|Q4R5P2|ARF1_MACFA ADP-ribosylation factor 1 OS=Macaca fascicularis GN=ARF1 PE=2 SV=3 95 271 1.0E-111
sp|P84077|ARF1_HUMAN ADP-ribosylation factor 1 OS=Homo sapiens GN=ARF1 PE=1 SV=2 95 271 1.0E-111
sp|P84080|ARF1_BOVIN ADP-ribosylation factor 1 OS=Bos taurus GN=ARF1 PE=1 SV=2 95 271 1.0E-111
sp|Q10943|ARF12_CAEEL ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans GN=arf-1.2 PE=2 SV=2 95 274 2.0E-111
sp|P61210|ARF1_LOCMI ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2 95 271 3.0E-111
sp|P61209|ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=2 SV=2 95 271 3.0E-111
sp|Q61LA8|ARF12_CAEBR ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae GN=arf-1.2 PE=3 SV=3 95 274 7.0E-111
sp|Q7RVM2|ARF_NEUCR ADP-ribosylation factor OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08340 PE=3 SV=3 95 274 4.0E-110
sp|O23778|ARF1_CATRO ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3 95 274 2.0E-109
sp|Q75A26|ARF_ASHGO ADP-ribosylation factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARF1 PE=3 SV=3 95 271 1.0E-107
sp|P49702|ARF5_CHICK ADP-ribosylation factor 5 OS=Gallus gallus GN=ARF5 PE=2 SV=2 95 274 3.0E-107
sp|P34727|ARF_AJECA ADP-ribosylation factor OS=Ajellomyces capsulatus GN=ARF PE=1 SV=3 95 273 5.0E-107
sp|Q3SZF2|ARF4_BOVIN ADP-ribosylation factor 4 OS=Bos taurus GN=ARF4 PE=2 SV=3 95 274 6.0E-107
sp|P51644|ARF4_XENLA ADP-ribosylation factor 4 OS=Xenopus laevis GN=arf4 PE=1 SV=2 95 274 7.0E-107
sp|P84083|ARF5_RAT ADP-ribosylation factor 5 OS=Rattus norvegicus GN=Arf5 PE=1 SV=2 95 274 5.0E-106
sp|P84084|ARF5_MOUSE ADP-ribosylation factor 5 OS=Mus musculus GN=Arf5 PE=1 SV=2 95 274 5.0E-106
sp|P84085|ARF5_HUMAN ADP-ribosylation factor 5 OS=Homo sapiens GN=ARF5 PE=1 SV=2 95 274 5.0E-106
sp|O00909|ARF1_DICDI ADP-ribosylation factor 1 OS=Dictyostelium discoideum GN=arfA PE=1 SV=3 95 271 2.0E-105
sp|P40945|ARF2_DROME ADP-ribosylation factor 2 OS=Drosophila melanogaster GN=Arf102F PE=2 SV=2 95 274 1.0E-104
sp|P61751|ARF4_RAT ADP-ribosylation factor 4 OS=Rattus norvegicus GN=Arf4 PE=2 SV=2 95 274 7.0E-104
sp|P61750|ARF4_MOUSE ADP-ribosylation factor 4 OS=Mus musculus GN=Arf4 PE=1 SV=2 95 274 7.0E-104
sp|Q5RCF1|ARF4_PONAB ADP-ribosylation factor 4 OS=Pongo abelii GN=ARF4 PE=2 SV=3 95 274 7.0E-104
sp|P18085|ARF4_HUMAN ADP-ribosylation factor 4 OS=Homo sapiens GN=ARF4 PE=1 SV=3 95 274 7.0E-104
sp|P19146|ARF2_YEAST ADP-ribosylation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF2 PE=1 SV=3 95 271 1.0E-100
sp|P11076|ARF1_YEAST ADP-ribosylation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF1 PE=1 SV=3 95 271 7.0E-100
sp|Q94650|ARF1_PLAFA ADP-ribosylation factor 1 OS=Plasmodium falciparum GN=ARF1 PE=1 SV=3 95 271 1.0E-98
sp|Q7KQL3|ARF1_PLAF7 ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate 3D7) GN=ARF1 PE=1 SV=1 95 271 1.0E-98
sp|Q25761|ARF1_PLAFO ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate NF54) GN=ARF1 PE=2 SV=2 95 271 2.0E-97
sp|P62332|ARF6_RAT ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2 99 270 9.0E-90
sp|Q007T5|ARF6_PIG ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1 99 270 9.0E-90
sp|P62331|ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2 99 270 9.0E-90
sp|P62330|ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2 99 270 9.0E-90
sp|P26990|ARF6_CHICK ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3 99 270 2.0E-89
sp|P51645|ARF6_XENLA ADP-ribosylation factor 6 OS=Xenopus laevis GN=arf6 PE=2 SV=2 99 270 1.0E-87
sp|P26991|ARF_GIAIN ADP-ribosylation factor OS=Giardia intestinalis PE=3 SV=3 95 271 3.0E-87
sp|P40946|ARF3_DROME ADP-ribosylation factor 3 OS=Drosophila melanogaster GN=Arf51F PE=2 SV=3 99 270 4.0E-87
sp|Q9SHU5|ARF4_ARATH Probable ADP-ribosylation factor At2g15310 OS=Arabidopsis thaliana GN=At2g15310 PE=2 SV=3 95 271 1.0E-84
sp|Q9Y7Z2|ARF6_SCHPO ADP-ribosylation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf6 PE=3 SV=1 100 270 5.0E-80
sp|P40940|ARF3_ARATH ADP-ribosylation factor 3 OS=Arabidopsis thaliana GN=ARF3 PE=1 SV=2 95 271 7.0E-75
sp|Q96361|ARF1_BRARP ADP-ribosylation factor 1 OS=Brassica rapa subsp. pekinensis GN=ARF1 PE=2 SV=3 95 271 3.0E-74
sp|Q54V47|ARFJ_DICDI ADP-ribosylation factor J OS=Dictyostelium discoideum GN=arrJ PE=3 SV=1 100 274 6.0E-74
sp|Q54V41|ARFK_DICDI ADP-ribosylation factor K OS=Dictyostelium discoideum GN=arrK PE=3 SV=1 100 274 6.0E-70
sp|Q54JJ3|ARFH_DICDI ADP-ribosylation factor H OS=Dictyostelium discoideum GN=arrH PE=3 SV=1 94 274 6.0E-70
sp|P40994|ARF3_YEAST ADP-ribosylation factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF3 PE=1 SV=2 95 270 2.0E-68
sp|Q94231|ARF11_CAEEL ADP-ribosylation factor 1-like 1 OS=Caenorhabditis elegans GN=arf-1.1 PE=3 SV=3 95 271 6.0E-68
sp|P40616|ARL1_HUMAN ADP-ribosylation factor-like protein 1 OS=Homo sapiens GN=ARL1 PE=1 SV=1 110 274 2.0E-66
sp|Q2YDM1|ARL1_BOVIN ADP-ribosylation factor-like protein 1 OS=Bos taurus GN=ARL1 PE=2 SV=1 110 274 5.0E-66
sp|P61212|ARL1_RAT ADP-ribosylation factor-like protein 1 OS=Rattus norvegicus GN=Arl1 PE=1 SV=1 110 274 6.0E-66
sp|P61211|ARL1_MOUSE ADP-ribosylation factor-like protein 1 OS=Mus musculus GN=Arl1 PE=1 SV=1 110 274 6.0E-66
sp|P36407|TRI23_RAT E3 ubiquitin-protein ligase TRIM23 OS=Rattus norvegicus GN=Trim23 PE=2 SV=2 100 271 5.0E-65
sp|P38116|ARL1_YEAST ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL1 PE=1 SV=4 95 267 1.0E-64
sp|Q8BGX0|TRI23_MOUSE E3 ubiquitin-protein ligase TRIM23 OS=Mus musculus GN=Trim23 PE=2 SV=1 109 271 1.0E-64
sp|P36406|TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens GN=TRIM23 PE=1 SV=1 109 271 1.0E-64
sp|P25160|ARL1_DROME ADP-ribosylation factor-like protein 1 OS=Drosophila melanogaster GN=Arl1 PE=2 SV=5 95 274 2.0E-64
sp|Q20758|ARL1_CAEEL ADP-ribosylation factor-like protein 1 OS=Caenorhabditis elegans GN=arl-1 PE=3 SV=2 95 274 4.0E-64
sp|Q54HK2|ARFF_DICDI ADP-ribosylation factor F OS=Dictyostelium discoideum GN=arrF PE=3 SV=1 108 270 9.0E-63
sp|Q54I24|ARFD_DICDI ADP-ribosylation factor D OS=Dictyostelium discoideum GN=arrD PE=3 SV=2 95 271 1.0E-59
sp|Q9D4P0|ARL5B_MOUSE ADP-ribosylation factor-like protein 5B OS=Mus musculus GN=Arl5b PE=2 SV=3 95 274 1.0E-57
sp|Q96KC2|ARL5B_HUMAN ADP-ribosylation factor-like protein 5B OS=Homo sapiens GN=ARL5B PE=1 SV=1 95 274 1.0E-57
sp|Q80ZU0|ARL5A_MOUSE ADP-ribosylation factor-like protein 5A OS=Mus musculus GN=Arl5a PE=1 SV=1 95 274 5.0E-56
sp|P51646|ARL5A_RAT ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus GN=Arl5a PE=2 SV=1 95 274 1.0E-54
sp|Q9Y689|ARL5A_HUMAN ADP-ribosylation factor-like protein 5A OS=Homo sapiens GN=ARL5A PE=1 SV=1 95 274 1.0E-54
sp|Q55AD9|ARL5_DICDI ADP-ribosylation factor-like protein 5 OS=Dictyostelium discoideum GN=arl5 PE=3 SV=1 95 273 1.0E-54
sp|Q2KJ96|ARL5A_BOVIN ADP-ribosylation factor-like protein 5A OS=Bos taurus GN=ARL5A PE=2 SV=1 95 274 1.0E-54
sp|Q2TA37|ARL2_BOVIN ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=1 SV=1 109 275 2.0E-51
sp|Q9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1 109 275 4.0E-51
sp|P36404|ARL2_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4 109 275 5.0E-51
sp|P34212|ARL5_CAEEL ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans GN=arl-5 PE=3 SV=3 95 271 1.0E-50
sp|B5FYQ0|ARL3_TAEGU ADP-ribosylation factor-like protein 3 OS=Taeniopygia guttata GN=ARL3 PE=2 SV=1 95 274 1.0E-50
sp|O08697|ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus GN=Arl2 PE=1 SV=1 109 275 2.0E-50
sp|Q8QHI3|ARL3_XENLA ADP-ribosylation factor-like protein 3 OS=Xenopus laevis GN=arl3 PE=2 SV=1 95 274 5.0E-50
sp|Q19705|ARL2_CAEEL ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans GN=evl-20 PE=2 SV=2 109 275 9.0E-50
sp|Q8N4G2|ARL14_HUMAN ADP-ribosylation factor-like protein 14 OS=Homo sapiens GN=ARL14 PE=1 SV=2 110 268 2.0E-49
sp|O45379|ARL3_CAEEL ADP-ribosylation factor-like protein 3 OS=Caenorhabditis elegans GN=arl-3 PE=1 SV=1 110 271 4.0E-49
sp|Q1MTE5|ARL3_DANRE ADP-ribosylation factor-like protein 3 OS=Danio rerio GN=arl3 PE=2 SV=1 97 274 5.0E-49
sp|Q627K4|ARL2_CAEBR ADP-ribosylation factor-like protein 2 OS=Caenorhabditis briggsae GN=evl-20.1 PE=3 SV=1 109 275 1.0E-48
sp|Q6P068|ARL5C_MOUSE ADP-ribosylation factor-like protein 5C OS=Mus musculus GN=Arl5c PE=2 SV=1 95 269 2.0E-48
sp|P61208|ARL4C_MOUSE ADP-ribosylation factor-like protein 4C OS=Mus musculus GN=Arl4c PE=2 SV=1 110 274 4.0E-48
sp|P56559|ARL4C_HUMAN ADP-ribosylation factor-like protein 4C OS=Homo sapiens GN=ARL4C PE=1 SV=1 110 274 4.0E-48
sp|A8ISN6|ARL3_CHLRE ADP-ribosylation factor-like protein 3 OS=Chlamydomonas reinhardtii GN=ARL3 PE=1 SV=2 111 271 3.0E-47
sp|P61214|ARL4A_RAT ADP-ribosylation factor-like protein 4A OS=Rattus norvegicus GN=Arl4a PE=2 SV=1 100 274 1.0E-46
sp|P61213|ARL4A_MOUSE ADP-ribosylation factor-like protein 4A OS=Mus musculus GN=Arl4a PE=2 SV=1 100 274 1.0E-46
sp|Q3T0M9|ARL4A_BOVIN ADP-ribosylation factor-like protein 4A OS=Bos taurus GN=ARL4A PE=2 SV=1 100 274 1.0E-46
sp|Q06849|ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster GN=Arl2 PE=2 SV=2 109 275 1.0E-46
sp|P40617|ARL4A_HUMAN ADP-ribosylation factor-like protein 4A OS=Homo sapiens GN=ARL4A PE=1 SV=2 100 274 4.0E-46
sp|Q3SXC5|ARL14_MOUSE ADP-ribosylation factor-like protein 14 OS=Mus musculus GN=Arl14 PE=2 SV=1 110 268 1.0E-45
sp|Q58DI9|ARL11_BOVIN ADP-ribosylation factor-like protein 11 OS=Bos taurus GN=ARL11 PE=2 SV=1 109 269 4.0E-45
sp|P37996|ARL3_RAT ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus GN=Arl3 PE=1 SV=2 95 274 1.0E-44
sp|Q52NJ4|ARL3_PIG ADP-ribosylation factor-like protein 3 OS=Sus scrofa GN=ARL3 PE=2 SV=1 95 274 3.0E-44
sp|Q9WUL7|ARL3_MOUSE ADP-ribosylation factor-like protein 3 OS=Mus musculus GN=Arl3 PE=1 SV=1 95 274 5.0E-44
sp|Q99PE9|ARL4D_MOUSE ADP-ribosylation factor-like protein 4D OS=Mus musculus GN=Arl4d PE=2 SV=2 91 274 5.0E-44
sp|Q2TBW6|ARL3_BOVIN ADP-ribosylation factor-like protein 3 OS=Bos taurus GN=ARL3 PE=2 SV=1 95 274 6.0E-44
sp|P36405|ARL3_HUMAN ADP-ribosylation factor-like protein 3 OS=Homo sapiens GN=ARL3 PE=1 SV=2 95 274 9.0E-44
sp|Q9ZPX1|ARF5_ARATH ADP-ribosylation factor-like protein 2 OS=Arabidopsis thaliana GN=ARL2 PE=2 SV=1 112 275 2.0E-43
sp|Q6P3A9|ARL11_MOUSE ADP-ribosylation factor-like protein 11 OS=Mus musculus GN=Arl11 PE=2 SV=1 109 267 3.0E-43
sp|A6NH57|ARL5C_HUMAN Putative ADP-ribosylation factor-like protein 5C OS=Homo sapiens GN=ARL5C PE=3 SV=4 95 269 7.0E-43
sp|Q5R4G5|ARL6_PONAB ADP-ribosylation factor-like protein 6 OS=Pongo abelii GN=ARL6 PE=2 SV=1 107 271 4.0E-40
sp|Q9H0F7|ARL6_HUMAN ADP-ribosylation factor-like protein 6 OS=Homo sapiens GN=ARL6 PE=1 SV=1 107 271 4.0E-40
sp|Q5M9P8|ARL6_DANRE ADP-ribosylation factor-like protein 6 OS=Danio rerio GN=arl6 PE=2 SV=1 107 271 4.0E-40
sp|Q18510|ARL6_CAEEL ADP-ribosylation factor-like protein 6 OS=Caenorhabditis elegans GN=arl-6 PE=2 SV=1 107 273 7.0E-40
sp|Q969Q4|ARL11_HUMAN ADP-ribosylation factor-like protein 11 OS=Homo sapiens GN=ARL11 PE=1 SV=1 109 274 9.0E-40
sp|O88848|ARL6_MOUSE ADP-ribosylation factor-like protein 6 OS=Mus musculus GN=Arl6 PE=1 SV=1 107 271 1.0E-39
sp|Q60Z38|ARL6_CAEBR ADP-ribosylation factor-like protein 6 OS=Caenorhabditis briggsae GN=arl-6 PE=3 SV=1 107 273 1.0E-39
sp|Q0IIM2|ARL6_BOVIN ADP-ribosylation factor-like protein 6 OS=Bos taurus GN=ARL6 PE=1 SV=1 107 271 2.0E-39
sp|Q5REU3|ARL4D_PONAB ADP-ribosylation factor-like protein 4D OS=Pongo abelii GN=ARL4D PE=2 SV=1 91 274 1.0E-38
sp|P49703|ARL4D_HUMAN ADP-ribosylation factor-like protein 4D OS=Homo sapiens GN=ARL4D PE=1 SV=2 91 274 1.0E-38
sp|Q0VC18|ARL4D_BOVIN ADP-ribosylation factor-like protein 4D OS=Bos taurus GN=ARL4D PE=2 SV=1 91 274 2.0E-38
sp|Q5BK71|ARL11_RAT ADP-ribosylation factor-like protein 11 OS=Rattus norvegicus GN=Arl11 PE=2 SV=1 113 263 2.0E-38
sp|Q54UF1|ARL2_DICDI ADP-ribosylation factor-like protein 2 OS=Dictyostelium discoideum GN=arl2 PE=3 SV=1 113 275 3.0E-37
sp|Q09767|ARL_SCHPO ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp41 PE=3 SV=1 107 271 1.0E-36
sp|Q8IVW1|ARL17_HUMAN ADP-ribosylation factor-like protein 17 OS=Homo sapiens GN=ARL17A PE=2 SV=2 95 181 2.0E-34
sp|Q54R04|ARL8_DICDI ADP-ribosylation factor-like protein 8 OS=Dictyostelium discoideum GN=arl8 PE=3 SV=1 94 267 6.0E-33
sp|Q5RCQ6|ARL3_PONAB ADP-ribosylation factor-like protein 3 OS=Pongo abelii GN=ARL3 PE=2 SV=1 97 274 9.0E-33
sp|Q66HA6|ARL8B_RAT ADP-ribosylation factor-like protein 8B OS=Rattus norvegicus GN=Arl8b PE=2 SV=1 99 267 1.0E-31
sp|Q9CQW2|ARL8B_MOUSE ADP-ribosylation factor-like protein 8B OS=Mus musculus GN=Arl8b PE=1 SV=1 99 267 1.0E-31
sp|Q9NVJ2|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B OS=Homo sapiens GN=ARL8B PE=1 SV=1 99 267 1.0E-31
sp|Q4R4S4|ARL8B_MACFA ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis GN=ARL8B PE=2 SV=1 99 267 3.0E-31
sp|Q6NZW8|AR8BA_DANRE ADP-ribosylation factor-like protein 8B-A OS=Danio rerio GN=arl8ba PE=2 SV=1 99 267 3.0E-31
sp|Q2KI07|ARL8B_BOVIN ADP-ribosylation factor-like protein 8B OS=Bos taurus GN=ARL8B PE=2 SV=1 99 267 6.0E-31
sp|Q5R6E7|ARL8B_PONAB ADP-ribosylation factor-like protein 8B OS=Pongo abelii GN=ARL8B PE=2 SV=1 99 267 3.0E-30
sp|Q63055|ARFRP_RAT ADP-ribosylation factor-related protein 1 OS=Rattus norvegicus GN=Arfrp1 PE=2 SV=1 99 275 7.0E-29
sp|Q8BXL7|ARFRP_MOUSE ADP-ribosylation factor-related protein 1 OS=Mus musculus GN=Arfrp1 PE=1 SV=2 99 275 7.0E-29
sp|Q32LJ2|ARFRP_BOVIN ADP-ribosylation factor-related protein 1 OS=Bos taurus GN=ARFRP1 PE=2 SV=1 99 275 2.0E-28
sp|Q5ZKQ8|ARL8A_CHICK ADP-ribosylation factor-like protein 8A OS=Gallus gallus GN=ARL8A PE=2 SV=1 103 267 2.0E-28
sp|Q96BM9|ARL8A_HUMAN ADP-ribosylation factor-like protein 8A OS=Homo sapiens GN=ARL8A PE=1 SV=1 103 267 2.0E-28
sp|P20606|SAR1_YEAST Small COPII coat GTPase SAR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAR1 PE=1 SV=1 102 271 3.0E-28
sp|Q0UKC0|SAR1_PHANO Small COPII coat GTPase SAR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SAR1 PE=3 SV=2 97 271 4.0E-28
sp|Q5R579|ARFRP_PONAB ADP-ribosylation factor-related protein 1 OS=Pongo abelii GN=ARFRP1 PE=2 SV=1 99 275 6.0E-28
sp|Q13795|ARFRP_HUMAN ADP-ribosylation factor-related protein 1 OS=Homo sapiens GN=ARFRP1 PE=1 SV=1 99 275 6.0E-28
sp|Q9VHV5|ARL8_DROME ADP-ribosylation factor-like protein 8 OS=Drosophila melanogaster GN=Gie PE=1 SV=1 99 267 7.0E-28
sp|A3LTA2|SAR1_PICST Small COPII coat GTPase SAR1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SAR1 PE=3 SV=1 102 271 2.0E-27
sp|Q8VEH3|ARL8A_MOUSE ADP-ribosylation factor-like protein 8A OS=Mus musculus GN=Arl8a PE=1 SV=1 103 267 5.0E-27
sp|Q6P8C8|ARL8A_XENTR ADP-ribosylation factor-like protein 8A OS=Xenopus tropicalis GN=arl8a PE=2 SV=1 103 267 5.0E-27
sp|Q4P0I7|SAR1_USTMA Small COPII coat GTPase SAR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SAR1 PE=3 SV=1 107 271 6.0E-27
sp|Q6FUZ9|SAR1_CANGA Small COPII coat GTPase SAR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SAR1 PE=3 SV=1 102 271 7.0E-27
sp|P0CT17|SAR1_MAGOY Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain Y34) GN=SAR1 PE=2 SV=1 102 271 2.0E-26
sp|P0CT16|SAR1_MAGO7 Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SAR1 PE=3 SV=1 102 271 2.0E-26
sp|P78976|SAR1_HYPJE Small COPII coat GTPase sar1 OS=Hypocrea jecorina GN=sar1 PE=3 SV=1 102 271 2.0E-26
sp|Q02804|ARL3_YEAST ADP-ribosylation factor-like protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL3 PE=1 SV=1 109 273 3.0E-26
sp|Q2HA55|SAR1_CHAGB Small COPII coat GTPase SAR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SAR1 PE=3 SV=2 110 268 3.0E-26
sp|A1CRG9|SAR1_ASPCL Small COPII coat GTPase sar1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sar1 PE=3 SV=1 110 271 4.0E-26
sp|A1D4D1|SAR1_NEOFI Small COPII coat GTPase sar1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sar1 PE=3 SV=1 110 271 5.0E-26
sp|Q4WJS7|SAR1_ASPFU Small COPII coat GTPase sar1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sar1 PE=3 SV=1 110 271 6.0E-26
sp|Q01475|SAR1_SCHPO Small COPII coat GTPase sar1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sar1 PE=1 SV=1 107 271 7.0E-26
sp|Q09654|TRI23_CAEEL E3 ubiquitin-protein ligase arc-1 OS=Caenorhabditis elegans GN=arc-1 PE=3 SV=3 111 223 1.0E-25
sp|Q59S78|SAR1_CANAL Small COPII coat GTPase SAR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAR1 PE=3 SV=2 107 271 1.0E-25
sp|P0C583|SAR1_NEUCR Small COPII coat GTPase sar1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vtr-7 PE=3 SV=1 113 271 2.0E-25
sp|Q5BGB9|SAR1_EMENI Small COPII coat GTPase sar1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sar1 PE=3 SV=1 110 271 2.0E-25
sp|Q877B9|SAR1_ASPOR Small COPII coat GTPase sar1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sar1 PE=3 SV=1 110 271 2.0E-25
sp|P0C951|SAR1_ASPNC Small COPII coat GTPase SAR1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sar1 PE=3 SV=1 110 271 2.0E-25
sp|Q8SQH8|ARF_ENCCU ADP-ribosylation factor OS=Encephalitozoon cuniculi (strain GB-M1) GN=ARF-1 PE=1 SV=3 94 237 3.0E-25
sp|A5E5G3|SAR1_LODEL Small COPII coat GTPase SAR1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SAR1 PE=3 SV=2 107 271 3.0E-25
sp|Q0CUN7|SAR1_ASPTN Small COPII coat GTPase sar1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sar1 PE=3 SV=1 110 271 5.0E-25
sp|A5DR82|SAR1_PICGU Small COPII coat GTPase SAR1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SAR1 PE=3 SV=3 102 271 8.0E-25
sp|P52884|SAR2_SOLLC GTP-binding protein SAR2 OS=Solanum lycopersicum GN=SAR2 PE=2 SV=1 102 242 1.0E-24
sp|Q6CB54|SAR1_YARLI Small COPII coat GTPase SAR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SAR1 PE=3 SV=1 102 240 1.0E-24
sp|P0CR30|SAR1_CRYNJ Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SAR1 PE=3 SV=1 102 271 2.0E-24
sp|P0CR31|SAR1_CRYNB Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SAR1 PE=3 SV=1 102 271 2.0E-24
sp|Q755D7|SAR1_ASHGO Small COPII coat GTPase SAR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SAR1 PE=3 SV=1 107 271 3.0E-24
sp|A8INQ0|ARL13_CHLRE ADP-ribosylation factor-like protein 13B OS=Chlamydomonas reinhardtii GN=ARL13 PE=1 SV=1 109 273 4.0E-24
sp|Q6CWR7|SAR1_KLULA Small COPII coat GTPase SAR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SAR1 PE=3 SV=1 102 271 6.0E-24
sp|Q6BVA7|SAR1_DEBHA Small COPII coat GTPase SAR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SAR1 PE=3 SV=1 102 271 7.0E-24
sp|P0C950|SAR1_ASPNG Small COPII coat GTPase SAR1 OS=Aspergillus niger GN=sar1 PE=3 SV=1 110 271 8.0E-24
sp|Q54Y14|SAR1B_DICDI GTP-binding protein Sar1B OS=Dictyostelium discoideum GN=sarB PE=3 SV=1 109 267 9.0E-23
sp|Q9CQC9|SAR1B_MOUSE GTP-binding protein SAR1b OS=Mus musculus GN=Sar1b PE=1 SV=1 107 271 9.0E-23
sp|Q23445|SAR1_CAEEL GTP-binding protein SAR1 OS=Caenorhabditis elegans GN=ZK180.4 PE=3 SV=1 107 258 1.0E-22
sp|Q3SXY8|AR13B_HUMAN ADP-ribosylation factor-like protein 13B OS=Homo sapiens GN=ARL13B PE=1 SV=1 110 273 1.0E-22
sp|Q9QVY3|SAR1B_CRIGR GTP-binding protein SAR1b OS=Cricetulus griseus GN=SAR1B PE=1 SV=1 107 271 1.0E-22
sp|Q9Y6B6|SAR1B_HUMAN GTP-binding protein SAR1b OS=Homo sapiens GN=SAR1B PE=1 SV=1 107 271 1.0E-22
sp|Q5HZY2|SAR1B_RAT GTP-binding protein SAR1b OS=Rattus norvegicus GN=Sar1b PE=2 SV=1 107 271 2.0E-22
sp|Q5PYH3|SAR1B_PIG GTP-binding protein SAR1b OS=Sus scrofa GN=SAR1B PE=2 SV=1 107 271 2.0E-22
sp|Q3T0T7|SAR1B_BOVIN GTP-binding protein SAR1b OS=Bos taurus GN=SAR1B PE=2 SV=1 107 271 2.0E-22
sp|O04267|SAR1B_BRACM GTP-binding protein SAR1B OS=Brassica campestris GN=SAR1B PE=2 SV=1 107 271 2.0E-22
sp|Q01474|SAR1B_ARATH GTP-binding protein SAR1B OS=Arabidopsis thaliana GN=SAR1B PE=1 SV=1 107 271 3.0E-22
sp|Q9QXJ4|ARL10_MOUSE ADP-ribosylation factor-like protein 10 OS=Mus musculus GN=Arl10 PE=1 SV=2 114 262 3.0E-22
sp|Q9P4C8|SAR1_PICPG Small COPII coat GTPase SAR1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SAR1 PE=3 SV=1 102 271 4.0E-22
sp|O04266|SAR1A_BRACM GTP-binding protein SAR1A OS=Brassica campestris GN=SAR1A PE=2 SV=1 102 271 7.0E-22
sp|O04834|SAR1A_ARATH GTP-binding protein SAR1A OS=Arabidopsis thaliana GN=SAR1A PE=2 SV=1 102 239 1.0E-21
sp|Q5RFN0|ARL15_PONAB ADP-ribosylation factor-like protein 15 OS=Pongo abelii GN=ARL15 PE=2 SV=1 108 267 2.0E-21
sp|Q9NXU5|ARL15_HUMAN ADP-ribosylation factor-like protein 15 OS=Homo sapiens GN=ARL15 PE=1 SV=1 108 267 2.0E-21
sp|Q8MQT8|SAR1_GIAIN GTP-binding protein Sar1 OS=Giardia intestinalis GN=SAR1 PE=3 SV=1 105 268 2.0E-21
sp|Q52NJ3|SAR1A_PIG GTP-binding protein SAR1a OS=Sus scrofa GN=SAR1A PE=2 SV=1 107 271 3.0E-21
sp|Q3T0D7|SAR1A_BOVIN GTP-binding protein SAR1a OS=Bos taurus GN=SAR1A PE=2 SV=1 107 271 3.0E-21
sp|Q5R548|SAR1A_PONAB GTP-binding protein SAR1a OS=Pongo abelii GN=SAR1A PE=2 SV=1 107 271 3.0E-21
sp|Q9NR31|SAR1A_HUMAN GTP-binding protein SAR1a OS=Homo sapiens GN=SAR1A PE=1 SV=1 107 271 3.0E-21
sp|P39110|CIN4_YEAST GTP-binding protein CIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN4 PE=1 SV=1 95 240 6.0E-21
sp|Q559R0|SAR1A_DICDI GTP-binding protein Sar1A OS=Dictyostelium discoideum GN=sarA PE=1 SV=1 105 226 6.0E-21
sp|Q640N2|AR13B_MOUSE ADP-ribosylation factor-like protein 13B OS=Mus musculus GN=Arl13b PE=1 SV=2 110 267 6.0E-21
sp|Q5EA19|ARL15_BOVIN ADP-ribosylation factor-like protein 15 OS=Bos taurus GN=ARL15 PE=2 SV=1 108 252 7.0E-21
sp|Q8N8L6|ARL10_HUMAN ADP-ribosylation factor-like protein 10 OS=Homo sapiens GN=ARL10 PE=2 SV=1 114 262 7.0E-21
sp|Q1ZXA5|ARLX_DICDI ADP-ribosylation factor-like protein DDB_G0292332 OS=Dictyostelium discoideum GN=DDB_G0292332 PE=3 SV=1 113 270 1.0E-20
sp|Q8BGR6|ARL15_MOUSE ADP-ribosylation factor-like protein 15 OS=Mus musculus GN=Arl15 PE=1 SV=1 108 267 1.0E-20
sp|P36536|SAR1A_MOUSE GTP-binding protein SAR1a OS=Mus musculus GN=Sar1a PE=1 SV=1 107 271 3.0E-20
sp|Q6T311|ARL9_HUMAN ADP-ribosylation factor-like protein 9 OS=Homo sapiens GN=ARL9 PE=2 SV=1 109 239 3.0E-17
sp|Q8JHI3|AR13B_DANRE ADP-ribosylation factor-like protein 13B OS=Danio rerio GN=arl13b PE=1 SV=1 110 273 5.0E-17
sp|P52885|SAR1_TOBAC GTP-binding protein SAR1 OS=Nicotiana tabacum GN=SAR1 PE=2 SV=1 107 206 3.0E-15
sp|Q8SS09|SAR1_ENCCU Small COPII coat GTPase SAR1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SAR1 PE=1 SV=1 103 224 3.0E-15
sp|Q0P5N6|ARL16_HUMAN ADP-ribosylation factor-like protein 16 OS=Homo sapiens GN=ARL16 PE=1 SV=1 108 269 4.0E-13
sp|Q9D416|AR13A_MOUSE ADP-ribosylation factor-like protein 13A OS=Mus musculus GN=Arl13a PE=2 SV=1 109 272 9.0E-12
sp|Q5H913|AR13A_HUMAN ADP-ribosylation factor-like protein 13A OS=Homo sapiens GN=ARL13A PE=2 SV=2 109 267 2.0E-11
sp|Q6AXT3|AR13A_RAT ADP-ribosylation factor-like protein 13A OS=Rattus norvegicus GN=Arl13a PE=2 SV=1 109 274 3.0E-11
sp|H2L0N8|ARL13_CAEEL ADP-ribosylation factor-like protein 13B OS=Caenorhabditis elegans GN=arl-13 PE=1 SV=1 109 223 5.0E-11
sp|Q54YV7|ARFL_DICDI ADP-ribosylation factor L OS=Dictyostelium discoideum GN=arrL PE=3 SV=1 112 270 1.0E-10
sp|Q54K69|RAB7B_DICDI Ras-related protein Rab-7B OS=Dictyostelium discoideum GN=rab7B PE=3 SV=1 108 226 1.0E-09
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 112 225 1.0E-09
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 112 239 1.0E-08
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 112 192 2.0E-08
sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 11 187 3.0E-08
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 112 224 3.0E-08
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 112 232 4.0E-08
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 112 239 5.0E-08
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 112 243 5.0E-08
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 113 224 6.0E-08
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 112 239 6.0E-08
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 112 239 6.0E-08
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 112 255 6.0E-08
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 112 239 6.0E-08
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 112 239 6.0E-08
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 112 239 6.0E-08
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 112 239 6.0E-08
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 113 224 7.0E-08
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 112 243 7.0E-08
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 112 239 7.0E-08
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 112 239 7.0E-08
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 112 255 9.0E-08
sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 108 187 1.0E-07
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 110 232 1.0E-07
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 112 226 1.0E-07
sp|Q9SF92|RAC2B_ARATH Ras-related protein RABC2b OS=Arabidopsis thaliana GN=RABC2B PE=2 SV=1 112 192 1.0E-07
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 112 224 1.0E-07
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 112 224 1.0E-07
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 112 239 2.0E-07
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 112 230 2.0E-07
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 110 224 2.0E-07
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 112 271 3.0E-07
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 112 224 3.0E-07
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 112 239 3.0E-07
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 112 243 3.0E-07
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 112 224 4.0E-07
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 110 224 4.0E-07
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 112 256 4.0E-07
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 112 226 5.0E-07
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 112 226 5.0E-07
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 112 230 5.0E-07
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 112 243 5.0E-07
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 112 243 5.0E-07
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 112 226 5.0E-07
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 112 226 5.0E-07
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 112 239 6.0E-07
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 112 243 6.0E-07
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 112 243 6.0E-07
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 112 239 7.0E-07
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 110 271 7.0E-07
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 112 243 7.0E-07
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 112 230 7.0E-07
sp|P41776|GNAI_HOMAM Guanine nucleotide-binding protein G(i) subunit alpha OS=Homarus americanus PE=2 SV=2 138 224 7.0E-07
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 112 243 7.0E-07
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 112 243 8.0E-07
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 112 243 8.0E-07
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 112 243 8.0E-07
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 112 243 8.0E-07
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 112 271 9.0E-07
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 112 224 9.0E-07
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 112 243 1.0E-06
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 112 226 1.0E-06
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 112 224 1.0E-06
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 112 243 1.0E-06
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 111 224 1.0E-06
sp|Q5UQ27|RABL_MIMIV Probable Rab-related GTPase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R214 PE=3 SV=1 113 224 1.0E-06
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 111 224 1.0E-06
sp|Q558I0|RABF1_DICDI Ras-related protein RabF1 OS=Dictyostelium discoideum GN=rabF1-1 PE=3 SV=1 112 224 1.0E-06
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 112 243 1.0E-06
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 112 243 2.0E-06
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 112 223 2.0E-06
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 112 223 2.0E-06
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 112 223 2.0E-06
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 111 223 2.0E-06
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 111 224 2.0E-06
sp|Q8CAM5|RAB36_MOUSE Ras-related protein Rab-36 OS=Mus musculus GN=Rab36 PE=1 SV=1 108 224 2.0E-06
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 112 271 2.0E-06
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 112 224 2.0E-06
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 112 224 2.0E-06
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 112 242 2.0E-06
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 112 243 2.0E-06
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 112 225 2.0E-06
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 112 271 2.0E-06
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 112 224 2.0E-06
sp|P35293|RAB18_MOUSE Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 112 271 2.0E-06
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 112 271 3.0E-06
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 112 271 3.0E-06
sp|Q5EB77|RAB18_RAT Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 112 271 3.0E-06
sp|P38146|YPT10_YEAST GTP-binding protein YPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT10 PE=1 SV=2 112 242 3.0E-06
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 112 229 3.0E-06
sp|Q60W52|GPA3_CAEBR Guanine nucleotide-binding protein alpha-3 subunit OS=Caenorhabditis briggsae GN=gpa-3 PE=3 SV=1 136 258 3.0E-06
sp|Q8BHD0|RB39A_MOUSE Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 111 224 3.0E-06
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 112 192 4.0E-06
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 113 275 4.0E-06
sp|P91907|GPA15_CAEEL Guanine nucleotide-binding protein alpha-15 subunit OS=Caenorhabditis elegans GN=gpa-15 PE=2 SV=2 140 224 4.0E-06
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 112 225 4.0E-06
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 112 224 4.0E-06
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 112 225 5.0E-06
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 112 225 5.0E-06
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 112 225 5.0E-06
sp|P28052|GPA3_CAEEL Guanine nucleotide-binding protein alpha-3 subunit OS=Caenorhabditis elegans GN=gpa-3 PE=1 SV=2 136 258 5.0E-06
sp|O00194|RB27B_HUMAN Ras-related protein Rab-27B OS=Homo sapiens GN=RAB27B PE=1 SV=4 112 275 5.0E-06
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 112 232 5.0E-06
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 112 242 6.0E-06
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 112 226 6.0E-06
sp|Q5ZHV1|RB33B_CHICK Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 110 228 6.0E-06
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 112 239 6.0E-06
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 112 232 6.0E-06
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 111 224 7.0E-06
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 111 224 7.0E-06
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 111 224 7.0E-06
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 112 223 8.0E-06
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 112 239 8.0E-06
sp|Q93743|GPA6_CAEEL Guanine nucleotide-binding protein alpha-6 subunit OS=Caenorhabditis elegans GN=gpa-6 PE=2 SV=2 140 224 9.0E-06
sp|P38401|GNAI1_CAVPO Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Cavia porcellus GN=GNAI1 PE=2 SV=3 138 224 1.0E-05
sp|P10824|GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Rattus norvegicus GN=Gnai1 PE=1 SV=3 138 224 1.0E-05
sp|B2RSH2|GNAI1_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Mus musculus GN=Gnai1 PE=1 SV=1 138 224 1.0E-05
sp|P63096|GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Homo sapiens GN=GNAI1 PE=1 SV=2 138 224 1.0E-05
sp|P63097|GNAI1_BOVIN Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Bos taurus GN=GNAI1 PE=2 SV=2 138 224 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070340
MTKHTDFRADLRSAQQSLRKNVSERSTLATWKGRGRDGFQFKYKQVGMVLFAITSQRNFKLCPTLRASLKHFVHL
TYSSSFTTLLTTPSAHSENMGMTISRVLHSILGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETV
EYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVSEAREELQRMLNEDELRDAVLLVYANKQDLP
NAMNAAEITDKLGLHGLRQRTWYIQATCATSGDGLYEGLEWLSSNIGRRV*
Coding >AgabiH97|070340
ATGACAAAACATACCGACTTCCGTGCCGACCTCCGTAGCGCGCAGCAAAGTCTGCGAAAAAACGTGTCGGAGCGG
AGCACACTAGCGACGTGGAAGGGACGTGGAAGGGACGGTTTTCAATTCAAATATAAACAGGTGGGGATGGTCTTG
TTTGCCATCACATCCCAGCGGAACTTTAAATTGTGTCCCACGCTAAGAGCTTCTCTCAAACACTTCGTGCACCTT
ACTTACTCCTCATCCTTCACAACTCTCCTCACAACACCCTCGGCTCATTCTGAAAACATGGGTATGACAATTTCC
AGAGTTCTACACAGCATCCTCGGAAAGAGGGAGATGCGCATATTGATGGTTGGTCTCGATGCCGCTGGGAAGACC
ACCATCCTTTATAAACTCAAGCTTGGCGAGATTGTCACGACCATCCCTACCATCGGATTCAACGTTGAGACTGTT
GAATATAAAAACATTTCCTTCACCGTCTGGGACGTCGGAGGTCAGGACAAGATCCGCCCTCTTTGGAGGCATTAT
TTCCAGAACACTCAGGGCCTTATCTTCGTTGTGGACTCGAATGATCGAGAGCGTGTTTCGGAGGCTCGGGAGGAG
TTGCAACGAATGCTGAATGAAGATGAGCTACGAGATGCCGTCCTTTTGGTCTATGCCAACAAGCAGGATCTGCCG
AACGCCATGAATGCCGCGGAAATAACTGACAAACTCGGTCTCCATGGCCTTAGGCAGCGAACCTGGTATATACAG
GCCACCTGTGCCACTTCCGGTGATGGTCTTTATGAGGGCCTGGAATGGCTCAGTTCAAACATTGGGCGCCGAGTA
TAA
Transcript >AgabiH97|070340
ATGACAAAACATACCGACTTCCGTGCCGACCTCCGTAGCGCGCAGCAAAGTCTGCGAAAAAACGTGTCGGAGCGG
AGCACACTAGCGACGTGGAAGGGACGTGGAAGGGACGGTTTTCAATTCAAATATAAACAGGTGGGGATGGTCTTG
TTTGCCATCACATCCCAGCGGAACTTTAAATTGTGTCCCACGCTAAGAGCTTCTCTCAAACACTTCGTGCACCTT
ACTTACTCCTCATCCTTCACAACTCTCCTCACAACACCCTCGGCTCATTCTGAAAACATGGGTATGACAATTTCC
AGAGTTCTACACAGCATCCTCGGAAAGAGGGAGATGCGCATATTGATGGTTGGTCTCGATGCCGCTGGGAAGACC
ACCATCCTTTATAAACTCAAGCTTGGCGAGATTGTCACGACCATCCCTACCATCGGATTCAACGTTGAGACTGTT
GAATATAAAAACATTTCCTTCACCGTCTGGGACGTCGGAGGTCAGGACAAGATCCGCCCTCTTTGGAGGCATTAT
TTCCAGAACACTCAGGGCCTTATCTTCGTTGTGGACTCGAATGATCGAGAGCGTGTTTCGGAGGCTCGGGAGGAG
TTGCAACGAATGCTGAATGAAGATGAGCTACGAGATGCCGTCCTTTTGGTCTATGCCAACAAGCAGGATCTGCCG
AACGCCATGAATGCCGCGGAAATAACTGACAAACTCGGTCTCCATGGCCTTAGGCAGCGAACCTGGTATATACAG
GCCACCTGTGCCACTTCCGGTGATGGTCTTTATGAGGGCCTGGAATGGCTCAGTTCAAACATTGGGCGCCGAGTA
TAA
Gene >AgabiH97|070340
ATGACAAAACATACCGACTTCCGTGCCGACCTCCGTAGCGCGCAGCAAAGTCTGCGAAAAAACGTGTCGGAGCGG
AGCACACTAGCGACGTGGAAGGGACGTGGAAGGGACGGTTTTCAATTCAAATATAAACAGGTGGGGATGGTCTTG
TTTGCCATCACATCCCAGCGGAACTTTAAATTGTGTCCCACGCTAAGAGCTTCTCTCAAACACTTCGTGCACCTT
ACTTACTCCTCATCCTTCACAACTCTCCTCACAACACCCTCGGCTCATTCTGAAAACATGGGTATGACAATTTCC
AGAGTTCTACACAGCATCCTCGGAAAGAGGGAGATGCGTAAGTTCAGTATTTTGCTCGGATTTCAAATGTCACTC
TAATTCTCGTGTCGTGTCATCCAGGCATATTGATGGTAAAGTGGCCAAATAATATTCCAGTCTGTATGATCCTCA
GCCATATTTCAGGTTGGTCTCGATGCCGCTGGGAAGACCACCATCCTTTATAAACTCAAGCTTGGCGAGATTGTC
ACGACCATCCCTACCATCGGTAAGTGTTTATTACGATACATTCATGGCGGTTTCTAACGTTAATCAGGATTCAAC
GTTGAGACTGTTGAATATAAAAACATTTCCTTCACCGTCTGGGACGTCGGAGGTCAGGACAAGATCCGCCCTCTT
TGGAGGCATTGTAGGCATTCCCCTTACTTGACTTCCTAGGGCATAAGCCTCTTATACACTTCTCAGATTTCCAGA
ACACTCAGGGCCTTATCTTCGTTGTGGACTCGAATGATCGAGAGCGTGTTTCGGAGGCTCGGGAGGAGTTGCAAC
GAATGCTGAATGAAGATGAGCTACGAGATGCCGTCCTTTTGGTCTATGCCAACAAGCAGGATCTGCCGAACGCCA
TGAATGCCGCGGAAATAACTGACAAACTCGGTCTCCATGGCCTTAGGCAGCGAACCTGGTATATACAGGTATGTT
CATCAATAACATCAATGACTCCAGTCGCTCATGATATACAGGCCACCTGTGCCACTTCCGGTGATGGTCTTTATG
AGGGCCTGGAATGGCTCAGTTCAAACATTGGGCGCCGAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail