Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070100
Gene name
Locationscaffold_4:1207882..1213741
Strand+
Gene length (bp)5859
Transcript length (bp)4863
Coding sequence length (bp)4863
Protein length (aa) 1621

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00621 RhoGEF RhoGEF domain 1.1E-33 460 643
PF13445 zf-RING_UBOX RING-type zinc-finger 2.5E-07 173 213
PF14634 zf-RING_5 zinc-RING finger domain 2.7E-07 173 217
PF13639 zf-RING_2 Ring finger domain 2.7E-06 172 216
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 2.0E-06 171 218
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.2E-05 173 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09733|GEF2_SCHPO Rho guanine nucleotide exchange factor gef2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gef2 PE=1 SV=1 459 727 2.0E-22
sp|Q70Z35|PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens GN=PREX2 PE=2 SV=1 458 784 5.0E-13
sp|Q07139|ECT2_MOUSE Protein ECT2 OS=Mus musculus GN=Ect2 PE=1 SV=2 455 727 6.0E-13
sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens GN=ECT2 PE=1 SV=4 455 727 3.0E-12
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 458 724 7.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09733|GEF2_SCHPO Rho guanine nucleotide exchange factor gef2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gef2 PE=1 SV=1 459 727 2.0E-22
sp|Q70Z35|PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens GN=PREX2 PE=2 SV=1 458 784 5.0E-13
sp|Q07139|ECT2_MOUSE Protein ECT2 OS=Mus musculus GN=Ect2 PE=1 SV=2 455 727 6.0E-13
sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens GN=ECT2 PE=1 SV=4 455 727 3.0E-12
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 458 724 7.0E-12
sp|Q3LAC4|PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus GN=Prex2 PE=1 SV=2 458 784 2.0E-11
sp|P91620|SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster GN=sif PE=2 SV=2 410 745 2.0E-11
sp|Q21653|OSG1_CAEEL Rho guanine nucleotide exchange factor osg-1 OS=Caenorhabditis elegans GN=osg-1 PE=2 SV=4 463 683 7.0E-11
sp|Q96PE2|ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens GN=ARHGEF17 PE=1 SV=1 460 725 3.0E-10
sp|P91621|SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster GN=sif PE=2 SV=2 431 745 4.0E-10
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 434 647 5.0E-10
sp|O88842|FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus GN=Fgd3 PE=1 SV=1 452 647 1.0E-09
sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 434 647 1.0E-09
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 427 646 2.0E-09
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 452 629 2.0E-09
sp|Q5JSP0|FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens GN=FGD3 PE=1 SV=1 457 647 3.0E-09
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 444 646 3.0E-09
sp|Q80U35|ARHGH_MOUSE Rho guanine nucleotide exchange factor 17 OS=Mus musculus GN=Arhgef17 PE=1 SV=2 460 725 3.0E-09
sp|A1IGU5|ARH37_HUMAN Rho guanine nucleotide exchange factor 37 OS=Homo sapiens GN=ARHGEF37 PE=2 SV=2 443 629 6.0E-09
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 460 726 7.0E-09
sp|Q5R5T1|FGD3_PONAB FYVE, RhoGEF and PH domain-containing protein 3 OS=Pongo abelii GN=FGD3 PE=2 SV=1 457 647 1.0E-08
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 458 727 1.0E-08
sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3 457 627 1.0E-08
sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 460 663 2.0E-08
sp|Q8C033|ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 OS=Mus musculus GN=Arhgef10 PE=1 SV=2 460 663 3.0E-08
sp|A2AWP8|ARGAL_MOUSE Rho guanine nucleotide exchange factor 10-like protein OS=Mus musculus GN=Arhgef10l PE=1 SV=1 460 659 3.0E-08
sp|Q5RDK0|ARHG9_PONAB Rho guanine nucleotide exchange factor 9 OS=Pongo abelii GN=ARHGEF9 PE=2 SV=1 459 629 3.0E-08
sp|Q58DL7|ARHG9_BOVIN Rho guanine nucleotide exchange factor 9 OS=Bos taurus GN=ARHGEF9 PE=2 SV=1 459 629 4.0E-08
sp|Q9H7P9|PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens GN=PLEKHG2 PE=1 SV=3 455 657 5.0E-08
sp|Q5R5M3|ARGAL_PONAB Rho guanine nucleotide exchange factor 10-like protein OS=Pongo abelii GN=ARHGEF10L PE=2 SV=1 460 659 6.0E-08
sp|Q29RM4|ARGAL_BOVIN Rho guanine nucleotide exchange factor 10-like protein OS=Bos taurus GN=ARHGEF10L PE=2 SV=1 460 659 8.0E-08
sp|Q9HCE6|ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens GN=ARHGEF10L PE=1 SV=3 460 659 8.0E-08
sp|P52734|FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus GN=Fgd1 PE=1 SV=2 444 615 9.0E-08
sp|P98174|FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens GN=FGD1 PE=1 SV=2 451 615 1.0E-07
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 460 639 1.0E-07
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 461 733 2.0E-07
sp|Q8BY35|FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus GN=Fgd2 PE=1 SV=1 460 634 2.0E-07
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 458 727 2.0E-07
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 461 733 2.0E-07
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 461 733 2.0E-07
sp|Q13009|TIAM1_HUMAN T-lymphoma invasion and metastasis-inducing protein 1 OS=Homo sapiens GN=TIAM1 PE=1 SV=2 449 623 2.0E-07
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 461 733 2.0E-07
sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens GN=FGD2 PE=1 SV=1 460 634 3.0E-07
sp|A2AAJ9|OBSCN_MOUSE Obscurin OS=Mus musculus GN=Obscn PE=1 SV=2 457 627 4.0E-07
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 422 726 4.0E-07
sp|Q8CHT1|NGEF_MOUSE Ephexin-1 OS=Mus musculus GN=Ngef PE=1 SV=1 457 730 5.0E-07
sp|Q9QX73|ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus GN=Arhgef9 PE=1 SV=1 459 629 6.0E-07
sp|Q5BKC9|NGEF_RAT Ephexin-1 OS=Rattus norvegicus GN=Ngef PE=1 SV=2 453 730 8.0E-07
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 422 726 9.0E-07
sp|Q60610|TIAM1_MOUSE T-lymphoma invasion and metastasis-inducing protein 1 OS=Mus musculus GN=Tiam1 PE=1 SV=1 449 623 9.0E-07
sp|P15498|VAV_HUMAN Proto-oncogene vav OS=Homo sapiens GN=VAV1 PE=1 SV=4 451 730 1.0E-06
sp|Q3UTH8|ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus GN=Arhgef9 PE=1 SV=1 459 629 1.0E-06
sp|O43307|ARHG9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens GN=ARHGEF9 PE=1 SV=3 459 629 1.0E-06
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 459 641 1.0E-06
sp|P54100|VAV_RAT Proto-oncogene vav OS=Rattus norvegicus GN=Vav1 PE=2 SV=1 451 789 1.0E-06
sp|Q5ZLX4|ARHG3_CHICK Rho guanine nucleotide exchange factor 3 OS=Gallus gallus GN=Arhgef3 PE=2 SV=1 461 733 2.0E-06
sp|Q9ULL1|PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens GN=PLEKHG1 PE=1 SV=2 460 626 2.0E-06
sp|O94887|FARP2_HUMAN FERM, RhoGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens GN=FARP2 PE=1 SV=3 460 610 3.0E-06
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 422 724 4.0E-06
sp|Q9NR80|ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens GN=ARHGEF4 PE=1 SV=3 459 629 4.0E-06
sp|Q55E26|GXCB_DICDI Rac guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gxcB PE=2 SV=1 440 659 6.0E-06
sp|Q008S8|ECT2L_HUMAN Epithelial cell-transforming sequence 2 oncogene-like OS=Homo sapiens GN=ECT2L PE=2 SV=2 440 727 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0005488 binding No
GO:0030695 GTPase regulator activity No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator activity No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070100
MPTTPERPSSLVLSSSRGRAAPVNNPQDSESDSDHESLVQVQFKALMRNVRELENNLKMMRKQNIQLQQKLDGYE
DDTPITPRKRTSVNIETKVKIRNLEARVEELEKRNSRLNKKVKQLRDKELQAEADELIPRCSDDEIHDQDGFQRM
RKLLRRFSKWMSITTLAEDPEDCPICLEQLKKKKAYAIPCEHLICTECLPQISKGADETVMCPQCRRVFPREEVG
LLQYTETERWDELLKLAGESTHINYGGGETTSEQEEEDFIDDDESRTVLSEGGVIQDQSEEDSENEGVHDESRAD
STTPGGPVSYAESPTREKRKKMEELASTRSKRQRLVRVRHVTAPSWLSSSSLEAAQSMSVSTSPRKTIPLATGDE
LRLRTKSLTQTTTKRAFYCGVVVEGSENGKRLPDEIQDLVLSLGQPVAFTTSEMFSSSSTSSISNLDAPTQRKRA
LTDTSALVSVINELVSSERTYVKRLQMLKNDYADPLRSFARSKDTAIIPAYEAKTLFGNIDNLLPVNEAFLMDLE
KMQAPNGSRTVGGVGDVALRHFKELRGFEQYKQYYVKREDAQLIFEREASKKSSRFAAYIDHIKYQATDPKNRVG
LRELLMEPVQRIPRYTLLFRTMLKHMAPEDPQRAKIVEADEIASIIALAEADEQTKRAAVFYCLTATIDGFPPDL
FSNSRKFIDCIDVEDILSEPPISSAVSASSSSGSSLHCTLFLFDDKLVIVKRPGNGEKGGKALTGLSELNKVTKA
GGIPTGKKKSGMTCKGVVDVTDVVATDIGGVDFHLFLESPPQDQNERWSGRPFRSYTAVSPPIPSNFDPARIEAD
KLRFLENLWHVQAMYRSRSGQSVVLCSEEEEVESRAGKTTIARTYFNVYQRTAFLQELKKTKILVHIDPLGSADP
IPFGIGAPPFARIRVQPLAGGLCRYSVSSDDPDDETEEDIVQTERVPSRVIQTIHQFGFFEFKTGKNSLPSTPTS
RSRVGRFGLDAISRNLFTSRPGSVSDFFAGSINGRKIKTSTVSRSSMYTQTTNTTGDGSSTKFSSRSNSTAATTV
FSTDEDSMLSPTKSSKSQKTLLTRARSPAASASESERDSSRPASRAESLSVPTAENGPEYSDYEDEDGTIGEKIK
DIDTSDYNLAKQLELARQNSLHQHANLTLSMDAPLEDTIYEEGPPASLHLSPSDANPQRSTSLRPESLLHSPDQL
HRPVSRQSDRRPVGPRSISPSPAPESPTSELSYLSDDHASVSESELSQFSLAITARQGPLRTPIRRSKRQPFPTI
EDTPKASSSNSVFAAATTNSSLASCQVEPLSIKKKNSTRSSTASTSPLARKLNSRASGNRVVSPRRTSPQVKKPK
QVATNIKSEMLEHVSQLALSTKEDLELSRRIVKKIKLEVEGSRSTTSRSPFIEEASRPSSPEKNSRIPLTTPNAP
LTKEARARMEEMRAMIGRRQAVEPAPVGRSRTNIFDTSRSHPSPVSDESSRRIEDLISDADKNLAQAMNHHEELQ
SEFQNLVARHKEKMIELERARSDLQHSKRQCELVKSLLADATAEKDIMYEAFNEELDSMYNDASLPDDEAFHALA
RDLRETKETRNNLSRENSQLKRKVAELESQQQEWASLLRANGLIS*
Coding >AgabiH97|070100
ATGCCCACCACTCCCGAACGACCATCTTCTCTCGTGCTGTCCAGTTCTCGGGGGCGCGCCGCGCCGGTCAACAAC
CCCCAGGACTCAGAGTCTGACAGCGACCACGAGAGCCTTGTCCAGGTCCAGTTCAAAGCCCTCATGCGAAATGTT
CGTGAGCTCGAAAATAACCTGAAAATGATGAGAAAGCAAAACATCCAACTTCAACAAAAACTCGACGGTTACGAA
GATGATACTCCAATCACGCCAAGAAAGAGGACCTCCGTGAACATTGAGACAAAAGTCAAGATTCGCAATTTAGAA
GCCAGGGTAGAAGAACTCGAAAAGAGAAACTCCCGGCTGAACAAGAAGGTCAAGCAGTTGCGGGACAAAGAATTA
CAGGCTGAAGCCGACGAATTGATTCCTCGGTGTTCTGATGATGAAATTCATGACCAAGATGGATTTCAGAGGATG
AGAAAGCTGTTGCGCAGGTTTTCGAAATGGATGAGTATTACCACGCTCGCAGAGGATCCCGAAGACTGTCCGATT
TGCTTAGAGCAACTCAAAAAAAAGAAAGCTTATGCGATACCTTGTGAGCATCTCATTTGCACCGAGTGCCTCCCA
CAAATTAGCAAGGGAGCCGACGAGACAGTTATGTGTCCGCAATGCCGGCGTGTTTTTCCTCGAGAAGAAGTCGGA
TTACTCCAATACACAGAAACGGAAAGATGGGACGAGCTTTTGAAGCTGGCTGGCGAGTCCACACACATTAACTAC
GGAGGTGGAGAGACGACCTCGGAACAGGAAGAAGAAGATTTTATTGACGATGACGAATCAAGAACGGTCTTATCG
GAAGGCGGTGTCATTCAAGATCAAAGTGAAGAAGACAGCGAAAATGAAGGGGTTCACGATGAAAGCAGGGCTGAT
TCCACGACACCTGGTGGTCCTGTTTCATACGCAGAGTCGCCAACTCGAGAGAAGCGAAAGAAGATGGAGGAATTG
GCATCGACCAGGAGCAAGAGGCAGAGGCTGGTGCGCGTACGACACGTGACCGCGCCTTCTTGGTTGAGCAGTTCC
TCTCTTGAAGCGGCCCAATCCATGTCCGTTTCCACTTCCCCCCGAAAAACAATTCCCCTCGCAACAGGTGATGAG
CTCCGGCTTCGCACAAAATCACTCACACAAACAACGACCAAGCGTGCCTTCTACTGTGGTGTAGTCGTCGAAGGC
TCGGAAAATGGAAAGCGACTCCCCGATGAGATACAGGATCTAGTGCTTTCCCTGGGTCAGCCTGTCGCATTCACC
ACGAGCGAAATGTTCTCTTCATCCTCCACTTCGTCTATCTCCAATCTTGACGCTCCTACACAACGGAAACGCGCA
CTCACCGATACCTCCGCTCTCGTCTCTGTTATCAATGAACTGGTCTCAAGCGAGCGCACCTATGTCAAACGTCTA
CAAATGCTCAAGAACGATTATGCCGATCCGCTACGCAGTTTTGCTCGCAGCAAAGATACCGCCATAATACCCGCA
TACGAAGCCAAAACACTCTTTGGAAACATTGATAACCTTCTCCCTGTCAATGAGGCATTTCTTATGGATTTGGAA
AAGATGCAAGCGCCCAATGGTTCGCGAACCGTGGGAGGTGTCGGAGATGTTGCATTACGACACTTCAAAGAGTTG
CGGGGTTTCGAACAATACAAACAATACTATGTCAAGCGAGAAGACGCGCAACTCATATTTGAGCGGGAGGCATCC
AAAAAATCTTCACGATTTGCAGCGTACATTGATCATATCAAATATCAAGCTACCGATCCCAAGAATCGTGTTGGC
CTGCGAGAACTTCTCATGGAACCTGTGCAACGAATACCAAGATACACTCTTCTGTTTCGGACCATGTTGAAGCAT
ATGGCACCAGAAGATCCACAGCGAGCAAAAATAGTCGAGGCAGATGAAATCGCAAGTATAATTGCGCTTGCTGAG
GCAGATGAACAGACAAAGCGCGCTGCGGTATTCTACTGCCTAACAGCCACAATTGACGGATTCCCTCCCGACCTC
TTCTCCAACTCACGGAAATTCATTGACTGTATTGACGTCGAAGATATCCTATCCGAGCCACCCATATCATCAGCG
GTCTCTGCATCAAGCAGCTCAGGTAGTTCTCTCCATTGTACACTATTCCTTTTCGACGACAAACTCGTAATTGTT
AAACGACCTGGAAATGGTGAAAAGGGAGGAAAAGCGTTGACAGGCTTGAGTGAATTGAACAAAGTCACAAAGGCC
GGTGGTATCCCTACGGGTAAGAAAAAAAGCGGAATGACGTGCAAAGGCGTTGTAGACGTTACGGATGTTGTAGCG
ACTGATATCGGCGGGGTTGATTTTCATCTTTTTCTCGAGAGTCCACCGCAGGATCAAAATGAGCGCTGGTCAGGT
CGTCCCTTCCGATCTTACACCGCTGTCAGTCCTCCAATACCCTCCAATTTCGATCCAGCGCGCATTGAAGCCGAC
AAACTCCGTTTCCTCGAGAATTTATGGCATGTGCAGGCGATGTACCGTTCCCGTTCCGGCCAGTCTGTAGTCCTA
TGTTCTGAGGAGGAAGAAGTGGAATCTCGTGCTGGAAAAACAACGATTGCCCGTACTTATTTCAATGTCTATCAG
CGAACTGCTTTTCTACAAGAACTCAAGAAGACTAAGATCCTTGTTCACATTGATCCCTTAGGGTCCGCTGATCCG
ATTCCGTTTGGCATAGGGGCTCCCCCTTTTGCTCGAATACGCGTGCAACCCCTGGCGGGAGGACTTTGTCGTTAT
TCTGTATCATCGGATGACCCAGATGATGAAACAGAAGAAGACATAGTTCAAACGGAACGCGTTCCAAGCCGTGTC
ATCCAAACTATCCATCAGTTCGGGTTCTTTGAATTTAAAACGGGAAAGAATTCCCTGCCATCGACACCTACAAGT
CGTTCCCGCGTTGGTCGGTTTGGCCTGGATGCCATATCTCGAAACTTGTTTACTAGTCGTCCCGGGTCCGTTTCG
GACTTTTTCGCCGGCTCAATCAATGGCCGTAAGATTAAGACATCGACTGTCAGTCGATCGTCCATGTACACCCAA
ACTACGAACACCACTGGCGACGGTAGTTCGACCAAGTTCTCTTCGAGGTCAAACTCCACAGCCGCAACAACGGTC
TTCTCAACGGACGAAGATTCAATGCTCAGTCCTACCAAATCATCGAAATCTCAGAAGACTTTGCTTACGCGTGCA
AGATCTCCAGCAGCATCTGCGTCAGAATCTGAGAGGGATTCTAGTAGGCCCGCGTCACGTGCAGAATCGTTGTCC
GTGCCAACGGCCGAAAACGGTCCTGAGTACAGTGACTACGAAGATGAGGATGGGACGATAGGCGAGAAGATCAAG
GACATTGATACTTCAGACTATAATCTCGCAAAGCAATTGGAGCTTGCTAGACAAAATAGTTTACATCAACATGCC
AACCTTACTTTGTCCATGGATGCACCTTTGGAAGATACCATTTACGAAGAGGGCCCGCCAGCGTCTTTACATTTA
TCACCTTCTGATGCCAACCCTCAACGGTCAACATCACTCCGACCCGAATCGCTACTACATTCTCCCGATCAGCTT
CACCGACCCGTTTCTAGGCAATCTGATCGTCGTCCTGTAGGACCTCGGAGCATTTCCCCTTCACCTGCGCCAGAA
AGTCCAACAAGCGAACTTTCTTACCTCTCGGACGACCATGCATCTGTCTCAGAGTCTGAATTGTCTCAGTTTTCA
TTAGCCATAACTGCACGTCAAGGTCCATTGCGAACACCTATCCGCCGCAGCAAACGCCAACCCTTCCCCACCATT
GAGGATACGCCGAAAGCTTCAAGTTCCAATTCAGTATTTGCCGCCGCCACCACGAATTCGAGTTTAGCATCGTGT
CAGGTTGAACCCCTGTCTATCAAGAAGAAAAACTCTACAAGGTCTTCAACAGCAAGTACGTCTCCCCTAGCCAGG
AAACTCAACTCACGAGCATCTGGCAACCGCGTTGTTTCCCCGCGCCGCACATCGCCACAAGTAAAAAAGCCAAAG
CAAGTGGCCACGAACATCAAGTCCGAAATGCTCGAACACGTGTCTCAATTAGCCTTGTCAACGAAGGAGGACCTC
GAACTGTCAAGGCGGATTGTAAAGAAAATCAAGCTTGAGGTGGAAGGAAGTAGATCTACGACCTCGCGTAGTCCA
TTCATTGAAGAGGCCTCTCGACCGTCTTCCCCTGAGAAGAACTCGCGAATTCCTTTAACAACGCCTAATGCCCCT
TTGACCAAGGAGGCTAGGGCCCGCATGGAAGAGATGCGTGCCATGATTGGCAGACGGCAAGCGGTGGAACCTGCG
CCTGTTGGAAGAAGCCGAACTAACATATTCGATACCTCTCGTTCTCACCCATCACCAGTGTCTGACGAATCTTCC
CGAAGAATAGAAGATCTGATATCAGACGCGGACAAAAACCTCGCGCAAGCCATGAATCACCATGAAGAGCTGCAG
AGCGAATTCCAGAATCTAGTAGCTCGGCATAAGGAGAAAATGATCGAACTGGAAAGGGCGAGGAGTGATTTACAA
CATTCGAAAAGGCAATGTGAGCTTGTCAAAAGCCTTTTGGCCGATGCAACGGCAGAGAAAGACATCATGTACGAA
GCTTTCAATGAAGAGCTGGATAGCATGTATAACGATGCAAGTCTTCCCGATGACGAGGCTTTCCATGCCTTGGCA
AGGGATTTACGAGAGACTAAAGAAACAAGGAATAATCTCAGTCGAGAAAACTCGCAATTAAAGCGTAAAGTCGCG
GAGCTTGAATCACAACAACAAGAATGGGCCTCCCTTCTTCGTGCTAATGGCTTAATCTCATAG
Transcript >AgabiH97|070100
ATGCCCACCACTCCCGAACGACCATCTTCTCTCGTGCTGTCCAGTTCTCGGGGGCGCGCCGCGCCGGTCAACAAC
CCCCAGGACTCAGAGTCTGACAGCGACCACGAGAGCCTTGTCCAGGTCCAGTTCAAAGCCCTCATGCGAAATGTT
CGTGAGCTCGAAAATAACCTGAAAATGATGAGAAAGCAAAACATCCAACTTCAACAAAAACTCGACGGTTACGAA
GATGATACTCCAATCACGCCAAGAAAGAGGACCTCCGTGAACATTGAGACAAAAGTCAAGATTCGCAATTTAGAA
GCCAGGGTAGAAGAACTCGAAAAGAGAAACTCCCGGCTGAACAAGAAGGTCAAGCAGTTGCGGGACAAAGAATTA
CAGGCTGAAGCCGACGAATTGATTCCTCGGTGTTCTGATGATGAAATTCATGACCAAGATGGATTTCAGAGGATG
AGAAAGCTGTTGCGCAGGTTTTCGAAATGGATGAGTATTACCACGCTCGCAGAGGATCCCGAAGACTGTCCGATT
TGCTTAGAGCAACTCAAAAAAAAGAAAGCTTATGCGATACCTTGTGAGCATCTCATTTGCACCGAGTGCCTCCCA
CAAATTAGCAAGGGAGCCGACGAGACAGTTATGTGTCCGCAATGCCGGCGTGTTTTTCCTCGAGAAGAAGTCGGA
TTACTCCAATACACAGAAACGGAAAGATGGGACGAGCTTTTGAAGCTGGCTGGCGAGTCCACACACATTAACTAC
GGAGGTGGAGAGACGACCTCGGAACAGGAAGAAGAAGATTTTATTGACGATGACGAATCAAGAACGGTCTTATCG
GAAGGCGGTGTCATTCAAGATCAAAGTGAAGAAGACAGCGAAAATGAAGGGGTTCACGATGAAAGCAGGGCTGAT
TCCACGACACCTGGTGGTCCTGTTTCATACGCAGAGTCGCCAACTCGAGAGAAGCGAAAGAAGATGGAGGAATTG
GCATCGACCAGGAGCAAGAGGCAGAGGCTGGTGCGCGTACGACACGTGACCGCGCCTTCTTGGTTGAGCAGTTCC
TCTCTTGAAGCGGCCCAATCCATGTCCGTTTCCACTTCCCCCCGAAAAACAATTCCCCTCGCAACAGGTGATGAG
CTCCGGCTTCGCACAAAATCACTCACACAAACAACGACCAAGCGTGCCTTCTACTGTGGTGTAGTCGTCGAAGGC
TCGGAAAATGGAAAGCGACTCCCCGATGAGATACAGGATCTAGTGCTTTCCCTGGGTCAGCCTGTCGCATTCACC
ACGAGCGAAATGTTCTCTTCATCCTCCACTTCGTCTATCTCCAATCTTGACGCTCCTACACAACGGAAACGCGCA
CTCACCGATACCTCCGCTCTCGTCTCTGTTATCAATGAACTGGTCTCAAGCGAGCGCACCTATGTCAAACGTCTA
CAAATGCTCAAGAACGATTATGCCGATCCGCTACGCAGTTTTGCTCGCAGCAAAGATACCGCCATAATACCCGCA
TACGAAGCCAAAACACTCTTTGGAAACATTGATAACCTTCTCCCTGTCAATGAGGCATTTCTTATGGATTTGGAA
AAGATGCAAGCGCCCAATGGTTCGCGAACCGTGGGAGGTGTCGGAGATGTTGCATTACGACACTTCAAAGAGTTG
CGGGGTTTCGAACAATACAAACAATACTATGTCAAGCGAGAAGACGCGCAACTCATATTTGAGCGGGAGGCATCC
AAAAAATCTTCACGATTTGCAGCGTACATTGATCATATCAAATATCAAGCTACCGATCCCAAGAATCGTGTTGGC
CTGCGAGAACTTCTCATGGAACCTGTGCAACGAATACCAAGATACACTCTTCTGTTTCGGACCATGTTGAAGCAT
ATGGCACCAGAAGATCCACAGCGAGCAAAAATAGTCGAGGCAGATGAAATCGCAAGTATAATTGCGCTTGCTGAG
GCAGATGAACAGACAAAGCGCGCTGCGGTATTCTACTGCCTAACAGCCACAATTGACGGATTCCCTCCCGACCTC
TTCTCCAACTCACGGAAATTCATTGACTGTATTGACGTCGAAGATATCCTATCCGAGCCACCCATATCATCAGCG
GTCTCTGCATCAAGCAGCTCAGGTAGTTCTCTCCATTGTACACTATTCCTTTTCGACGACAAACTCGTAATTGTT
AAACGACCTGGAAATGGTGAAAAGGGAGGAAAAGCGTTGACAGGCTTGAGTGAATTGAACAAAGTCACAAAGGCC
GGTGGTATCCCTACGGGTAAGAAAAAAAGCGGAATGACGTGCAAAGGCGTTGTAGACGTTACGGATGTTGTAGCG
ACTGATATCGGCGGGGTTGATTTTCATCTTTTTCTCGAGAGTCCACCGCAGGATCAAAATGAGCGCTGGTCAGGT
CGTCCCTTCCGATCTTACACCGCTGTCAGTCCTCCAATACCCTCCAATTTCGATCCAGCGCGCATTGAAGCCGAC
AAACTCCGTTTCCTCGAGAATTTATGGCATGTGCAGGCGATGTACCGTTCCCGTTCCGGCCAGTCTGTAGTCCTA
TGTTCTGAGGAGGAAGAAGTGGAATCTCGTGCTGGAAAAACAACGATTGCCCGTACTTATTTCAATGTCTATCAG
CGAACTGCTTTTCTACAAGAACTCAAGAAGACTAAGATCCTTGTTCACATTGATCCCTTAGGGTCCGCTGATCCG
ATTCCGTTTGGCATAGGGGCTCCCCCTTTTGCTCGAATACGCGTGCAACCCCTGGCGGGAGGACTTTGTCGTTAT
TCTGTATCATCGGATGACCCAGATGATGAAACAGAAGAAGACATAGTTCAAACGGAACGCGTTCCAAGCCGTGTC
ATCCAAACTATCCATCAGTTCGGGTTCTTTGAATTTAAAACGGGAAAGAATTCCCTGCCATCGACACCTACAAGT
CGTTCCCGCGTTGGTCGGTTTGGCCTGGATGCCATATCTCGAAACTTGTTTACTAGTCGTCCCGGGTCCGTTTCG
GACTTTTTCGCCGGCTCAATCAATGGCCGTAAGATTAAGACATCGACTGTCAGTCGATCGTCCATGTACACCCAA
ACTACGAACACCACTGGCGACGGTAGTTCGACCAAGTTCTCTTCGAGGTCAAACTCCACAGCCGCAACAACGGTC
TTCTCAACGGACGAAGATTCAATGCTCAGTCCTACCAAATCATCGAAATCTCAGAAGACTTTGCTTACGCGTGCA
AGATCTCCAGCAGCATCTGCGTCAGAATCTGAGAGGGATTCTAGTAGGCCCGCGTCACGTGCAGAATCGTTGTCC
GTGCCAACGGCCGAAAACGGTCCTGAGTACAGTGACTACGAAGATGAGGATGGGACGATAGGCGAGAAGATCAAG
GACATTGATACTTCAGACTATAATCTCGCAAAGCAATTGGAGCTTGCTAGACAAAATAGTTTACATCAACATGCC
AACCTTACTTTGTCCATGGATGCACCTTTGGAAGATACCATTTACGAAGAGGGCCCGCCAGCGTCTTTACATTTA
TCACCTTCTGATGCCAACCCTCAACGGTCAACATCACTCCGACCCGAATCGCTACTACATTCTCCCGATCAGCTT
CACCGACCCGTTTCTAGGCAATCTGATCGTCGTCCTGTAGGACCTCGGAGCATTTCCCCTTCACCTGCGCCAGAA
AGTCCAACAAGCGAACTTTCTTACCTCTCGGACGACCATGCATCTGTCTCAGAGTCTGAATTGTCTCAGTTTTCA
TTAGCCATAACTGCACGTCAAGGTCCATTGCGAACACCTATCCGCCGCAGCAAACGCCAACCCTTCCCCACCATT
GAGGATACGCCGAAAGCTTCAAGTTCCAATTCAGTATTTGCCGCCGCCACCACGAATTCGAGTTTAGCATCGTGT
CAGGTTGAACCCCTGTCTATCAAGAAGAAAAACTCTACAAGGTCTTCAACAGCAAGTACGTCTCCCCTAGCCAGG
AAACTCAACTCACGAGCATCTGGCAACCGCGTTGTTTCCCCGCGCCGCACATCGCCACAAGTAAAAAAGCCAAAG
CAAGTGGCCACGAACATCAAGTCCGAAATGCTCGAACACGTGTCTCAATTAGCCTTGTCAACGAAGGAGGACCTC
GAACTGTCAAGGCGGATTGTAAAGAAAATCAAGCTTGAGGTGGAAGGAAGTAGATCTACGACCTCGCGTAGTCCA
TTCATTGAAGAGGCCTCTCGACCGTCTTCCCCTGAGAAGAACTCGCGAATTCCTTTAACAACGCCTAATGCCCCT
TTGACCAAGGAGGCTAGGGCCCGCATGGAAGAGATGCGTGCCATGATTGGCAGACGGCAAGCGGTGGAACCTGCG
CCTGTTGGAAGAAGCCGAACTAACATATTCGATACCTCTCGTTCTCACCCATCACCAGTGTCTGACGAATCTTCC
CGAAGAATAGAAGATCTGATATCAGACGCGGACAAAAACCTCGCGCAAGCCATGAATCACCATGAAGAGCTGCAG
AGCGAATTCCAGAATCTAGTAGCTCGGCATAAGGAGAAAATGATCGAACTGGAAAGGGCGAGGAGTGATTTACAA
CATTCGAAAAGGCAATGTGAGCTTGTCAAAAGCCTTTTGGCCGATGCAACGGCAGAGAAAGACATCATGTACGAA
GCTTTCAATGAAGAGCTGGATAGCATGTATAACGATGCAAGTCTTCCCGATGACGAGGCTTTCCATGCCTTGGCA
AGGGATTTACGAGAGACTAAAGAAACAAGGAATAATCTCAGTCGAGAAAACTCGCAATTAAAGCGTAAAGTCGCG
GAGCTTGAATCACAACAACAAGAATGGGCCTCCCTTCTTCGTGCTAATGGCTTAATCTCATAG
Gene >AgabiH97|070100
ATGCCCACCACTCCCGAACGACCATCTTCTCTCGTGCTGTCCAGTTCTCGGGGGCGCGCCGCGCCGGTCAACAAC
CCCCAGGACTCAGAGTCTGACAGCGACCACGAGAGCCTTGTCCAGGTGCGGTAGTTGCTTTTATAGCTCCTTATA
ATTCGTACATACTCTCTTGTATTTTTTATTCTACATGCGTATAAACCACAGGTCCAGTTCAAAGCCCTCATGCGA
AATGTTCGTGAGCTCGAAAATAACCTGAAAATGATGAGAAAGCAAAACATCCAACTTCAACAAAAACTCGACGGT
TACGAAGATGATACTCCAATCACGCCAAGAAAGAGGACCTCCGTGAACATTGAGACAAAAGTCAAGATTCGCAAT
TTAGAAGCCAGGGTAGAAGAACTCGAAAAGGTTGCGTTGGAAACTGCTTGTGTGACTCGGATTCTCACCGCTGGC
AGAGAAACTCCCGGCTGAACAAGAAGGTCAAGCAGGTATGTCTCATCTGCTATCAAATCCCATATCCTCTAAGTC
GAGTGTAGTTGCGGGACAAAGAATTACAGGCTGAAGCCGACGAATTGATTCCTCGGTGTTCTGATGATGAAATTC
ATGACCAAGATGGATTTCAGAGGATGAGAAAGGTTGGCGCTATTAAATATCGACCACGCTTGTTGGTGCTGACAT
TGATATAGCTGTTGCGCAGGTTTTCGAAATGGATGAGTATTACCACGCTCGCAGAGGATCCCGAAGACTGTCCGA
TTTGCTTAGAGCAACTCAAAAAAAAGAAAGCTTATGCGTATGTCAGAATTAGCAATTGGATAATTGGGGACTGAG
ATGAGGATCGACATCAGGATACCTTGTGAGCATCTCATTTGCACCGAGTGCCTCCCACAAATTAGCAAGGGAGCC
GACGAGACAGTTATGTGTCCGCAATGCCGGCGTGTTTTTCCTCGAGAAGAAGTCGGATTACTCCAATACACAGAA
ACGGAAAGATGGGACGAGCTTTTGAAGCTGGCTGGCGAGTCCACACACATTAACTACGGAGGTGGAGAGACGACC
TCGGAACAGGAAGAAGAAGATTTTATTGACGATGACGAATCAAGGTGGGCCCTTGTGCGGAATCAAATTTGTGAG
GCTGAGCCTGTGTTAGAACGGTCTTATCGGAAGGCGGTGTCATTCAAGATCAAAGTGAAGAAGACAGCGAAAATG
AAGGGGTTCACGATGAAAGCAGGGCTGATTCCACGACACCTGGTGGTCCTGTTTCATACGCAGAGTCGCCAACTC
GAGAGAAGCGAAAGAAGATGGAGGAATTGGCATCGACCAGGAGCAAGAGGCAGAGGGTACTGTAACTCGTCCCGG
GATATTAACATAACGCCGACATGATGATGTAATAAGGGCGTCAATATAGCTGGTGCGCGTACGACACGTGACCGC
GCCTTCTTGGTTGAGCAGTTCCTCTCTTGAAGCGGCCCAATCCATGTCCGTTTCCACTTCCCCCCGAAAAACAAT
TCCCCTCGCAACAGGTGATGAGCTCCGGCTTCGCACAAAATCACTCACACAAACAACGACCAAGCGTGCCTTCTA
CTGTGGTGTAGTCGTCGAAGGCTCGGAAAATGGAAAGCGACTCCCCGATGGTACTTGAAGAGTTTCACACTATGG
CGTCAATCTGACCGTTGGACAGAGATACAGGATCTAGTGCTTTCCCTGGGTCAGCCTGTCGCATTCACCACGAGC
GAAATGTTCTCTTCATCCTCCACTTCGTCTATCTCCAATCTTGTACGTACCTTGTTCGGTATTTGGCATTAGCCG
AATCTCTGCGTATTAACTCCCTCCTAATCAATGATGTAGGACGCTCCTACACAACGGAAACGCGCACTCACCGAT
ACCTCCGCTCTCGTCTCTGTTATCAATGAACTGGTCTCAAGCGAGCGCACCTATGTCAAACGTCTACAAATGCTC
AAGAACGATTATGCCGATCCGCTACGCAGTTTTGCTCGCAGCAAAGATACCGCCATAATACCCGCATACGAAGCC
AAAACACTCTTTGGAAACATTGATAACCTTCTCCCTGTCAATGAGGCATTTCTTATGGATTTGGAAAAGATGCAA
GCGCCCAATGGTTCGCGAACCGTGGGAGGTGTCGGAGATGTTGCATTACGACACTTCAAAGAGTTGCGGGGTTTC
GAACAATACAAACAATACTATGTCAAGCGAGAAGACGCGCAACTCATATTTGAGCGGGAGGCATCCAAAAAATCT
TCACGATTTGCAGCGTACATTGATGTACGTCTATCCTTTCCAACTGCCTGTGATTCGAGTTTATTCCGTCATGTT
AGCATATCAAATATCAAGCTACCGATCCCAAGAATCGTGTTGGCCTGCGAGAACTTCTCATGGAACCTGTGCAAC
GAATACCAAGATACACTCTTCTGTTTCGGACCATGTTGAAGCATATGGCACCAGAAGATCCACAGCGAGCAAAAA
TAGTCGAGGCAGATGAAATCGCAAGTATAATTGCGCTTGCTGAGGCAGATGAACAGACAAAGCGCGCTGCGGTAT
TCTACTGCCTAACAGCCACAATTGACGGATTCCCTCCCGACCTCTTCTCCAACTCACGGAAATTCATTGACTGTA
TTGACGTCGAAGATATCCTATCCGAGCCACCCATATCATCAGCGGTCTCTGCATCAAGCAGCTCAGGTAGTTCTC
TCCATTGTACACTATTCCTTTTCGACGACAAACTCGTAATTGTTAAACGACCTGGAAATGGTGAAAAGGGAGGAA
AAGCGTTGACAGGCTTGAGTGAATTGAACAAAGTCACAAAGGCCGGTGGTATCCCTACGGGTAAGAAAAAAAGCG
GAATGACGTGCAAAGGCGTTGTAGACGTTACGGATGTTGTAGCGACTGATATCGGCGGGGTTGGTAGGTCATGAC
CTAGGTTTTGCTGCAGAGACGTCAACTCAATCAATGACAGATTTTCATCTTTTTCTCGAGAGTCCACCGCAGGAT
CAAAATGAGCGCTGGTCAGGTCGTCCCTTCCGATCTTACACCGCTGTCAGTCCTCCAATACCCTCCAATTTCGAT
CCAGCGCGCATTGAAGCCGACAAACTCCGTTTCCTCGAGAATTTATGGCATGTGCAGGCGATGTACCGTTCCCGT
TCCGGCCAGTCTGTAGTCCTATGTTCTGAGGAGGAAGAAGTGGAATCTCGTGCTGGAAAAACAACGATTGCCCGT
ACTTATTTCAATGTCTATCAGCGAACTGCTTTTCTACAAGAACTCAAGAAGGTAATCAGATTATCTTTGTTTATT
CAAGCGTGACTAACTATCCAATGACGTAGACTAAGATCCTTGTTCACATTGATCCCTTAGGGTCCGCTGATCCGA
TTCCGTTTGGCATAGGGGCTCCCCCTTTTGCTCGAATACGCGTGCAACCCCTGGCGGGAGGACTTTGTCGTTATT
CTGTATCATCGGATGACCCAGATGATGAAACAGAAGAAGACATAGTTCAAACGGAACGCGTTCCAAGCCGTGTCA
TCCAAACTAGTGAGTTATCCCGATCACGTTGACCCTTTCATAGACGCTCAGGCCAACTCAGTCCATCAGTTCGGG
TTCTTTGAATTTAAAACGGGAAAGAATTCCCTGCCATCGACACCTACAAGTCGTTCCCGCGTTGGTCGGTTTGGC
CTGGATGCCATATCTCGAAACTTGTTTACTAGTCGTCCCGGGTCCGTTTCGGACTTTTTCGCCGGCTCAATCAAT
GGCCGTAAGATTAAGACATCGACTGTCAGTCGATCGTCCATGTACACCCAAACTACGAACACCACTGGCGACGGT
AGTTCGACCAAGTTCTCTTCGAGGTCAAACTCCACAGCCGCAACAACGGTCTTCTCAACGGACGAAGATTCAATG
CTCAGTCCTACCAAATCATCGAAATCTCAGAAGACTTTGCTTACGCGTGCAAGATCTCCAGCAGCATCTGCGTCA
GAATCTGAGAGGGATTCTAGTAGGCCCGCGTCACGTGCAGAATCGTTGTCCGTGCCAACGGCCGAAAACGGTCCT
GAGTACAGTGACTACGAAGATGAGGATGGGACGATAGGCGAGAAGATCAAGGACATTGATACTTCAGACTATAAT
CTCGCAAAGCAATTGGAGCTTGCTAGACAAAATAGTTTACATCAACATGCCAACCTTACTTTGTCCATGGATGCA
CCTTTGGAAGATACCATTTACGAAGGTTAGTATGGCCTTTTCGAACAGCTTGCCGGTTAGCTTACAAACCGGTTC
AGAGGGCCCGCCAGCGTCTTTACATTTATCACCTTCTGATGCCAACCCTCAACGGTCAACATCACTCCGACCCGA
ATCGCTACTACATTCTCCCGATCAGCTTCACCGACCCGTTTCTAGGCAATCTGATCGTCGTCCTGTAGGACCTCG
GAGCATTTCCCCTTCACCTGCGCCAGAAAGTCCAACAAGCGAACTTTCTTACCTCTCGGACGACCATGCATCTGT
CTCAGAGTCTGAATTGTCTCAGTTTTCATTAGCCATAACTGCACGTCAAGGTCCATTGCGAACACCTATCCGCCG
CAGCAAACGCCAACCCTTCCCCACCATTGAGGATACGCCGAAAGCTTCAAGTTCCAATTCAGTATTTGCCGCCGC
CACCACGAATTCGAGTTTAGCATCGTGTCAGGTTGAACCCCTGTCTATCAAGAAGAAAAACTCTACAAGGTCTTC
AACAGCAAGTACGTCTCCCCTAGCCAGGAAACTCAACTCACGAGCATCTGGCAACCGCGTTGTTTCCCCGCGCCG
CACATCGCCACAAGTAAAAAAGCCAAAGCAAGTGGCCACGAACATCAAGTCCGAAATGCTCGAACACGTGTCTCA
ATTAGCCTTGTCAACGAAGGAGGACGTATGTGGTTACCTCTTCGAATTTTTAAAGTGGAAATCTCACCATGATCC
AGCTCGAACTGTCAAGGCGGATTGTAAAGAAAATCAAGCTTGAGGTGGAAGGAAGTAGATCTACGACCTCGCGTA
GTCCATTCATTGAAGAGGCCTCTCGACCGTCTTCCCCTGAGAAGAACTCGCGAATTCCTTTAACAACGCCTAATG
CCCCTTTGGTGTGTATATACACGCACCCTTCTCACGTATTATTCAACTCATACCGTATCAGACCAAGGAGGCTAG
GGCCCGCATGGAAGAGATGCGTGCCATGATTGGCAGACGGCAAGCGGTGGAACCTGCGCCTGTTGGAAGAAGCCG
AACTAACATATTCGATACCTCTCGTTCTCACCCATCACCAGTGTCTGACGAATCTTCCCGAAGAATAGAAGATCT
GATATCAGACGCGGACAAAAACCTCGCGCAAGCCATGAATCACCATGAAGAGCTGCAGAGCGAATTCCAGAATCT
AGTAGCTCGGCATAAGGAGGTTGGTCATCCTCAATCATGCGCATACGTTAACAATACAAATGTTAATTTCTGTAT
GTAGAAAATGATCGAACTGGAAAGGGCGAGGAGTGATTTACAACATTCGAAAAGGCAATGTGAGCTTGTCAAAAG
CCTTTTGGCCGATGCAACGGCAGAGAAAGACATCATGTACGAAGCTTTCAATGAAGAGCTGGATAGCATGTATAA
CGATGCAAGTCTTCCCGATGACGAGGCTTTCCATGCCTTGGCAAGGGATTTACGAGAGACTAAAGAAACAAGGAA
TAATCTCAGTCGAGAAAACTCGTTGAGTAATCTAATGATTAAATCTAATTCTCGCTGATCAAAGTCTTCTATAGG
CAATTAAAGCGTAAAGTCGCGGAGCTTGAATCACAACAACAAGAATGGGCCTCCCTTCTTCGTGCTAATGGCTTA
ATCTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail