Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|070040
Gene name
Locationscaffold_4:1198348..1200594
Strand+
Gene length (bp)2246
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.8E-11 292 329
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 2.6E-10 393 578
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.9E-06 292 329
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 8.3E-08 289 333
PF13445 zf-RING_UBOX RING-type zinc-finger 1.5E-05 292 327
PF13639 zf-RING_2 Ring finger domain 1.4E-06 291 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q17RB8|LONF1_HUMAN LON peptidase N-terminal domain and RING finger protein 1 OS=Homo sapiens GN=LONRF1 PE=1 SV=2 289 444 9.0E-20
sp|O60106|YOXA_SCHPO LON peptidase N-terminal domain and RING finger protein C14F5.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.10c PE=3 SV=1 241 592 2.0E-19
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 289 501 2.0E-19
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 289 501 2.0E-19
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 289 444 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q17RB8|LONF1_HUMAN LON peptidase N-terminal domain and RING finger protein 1 OS=Homo sapiens GN=LONRF1 PE=1 SV=2 289 444 9.0E-20
sp|O60106|YOXA_SCHPO LON peptidase N-terminal domain and RING finger protein C14F5.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.10c PE=3 SV=1 241 592 2.0E-19
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 289 501 2.0E-19
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 289 501 2.0E-19
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 289 444 3.0E-19
sp|Q1L5Z9|LONF2_HUMAN LON peptidase N-terminal domain and RING finger protein 2 OS=Homo sapiens GN=LONRF2 PE=2 SV=3 287 588 4.0E-16
sp|Q0IIM1|RN168_BOVIN E3 ubiquitin-protein ligase RNF168 OS=Bos taurus GN=RNF168 PE=2 SV=2 287 377 1.0E-07
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 218 357 1.0E-06
sp|F6UA42|UHRF1_XENTR E3 ubiquitin-protein ligase UHRF1 OS=Xenopus tropicalis GN=uhrf1 PE=3 SV=2 179 363 1.0E-06
sp|Q8N448|LNX2_HUMAN Ligand of Numb protein X 2 OS=Homo sapiens GN=LNX2 PE=1 SV=1 274 333 2.0E-06
sp|Q7TMI3|UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus GN=Uhrf2 PE=1 SV=1 276 353 2.0E-06
sp|Q5R4I2|RNF8_PONAB E3 ubiquitin-protein ligase RNF8 OS=Pongo abelii GN=RNF8 PE=2 SV=1 275 363 2.0E-06
sp|Q9P3U8|YJ95_SCHPO Uncharacterized RING finger protein C548.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC548.05c PE=3 SV=1 265 333 2.0E-06
sp|O76064|RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens GN=RNF8 PE=1 SV=1 270 363 2.0E-06
sp|Q91XL2|LNX2_MOUSE Ligand of Numb protein X 2 OS=Mus musculus GN=Lnx2 PE=1 SV=2 274 333 3.0E-06
sp|Q7T308|RN168_DANRE E3 ubiquitin-protein ligase RNF168 OS=Danio rerio GN=rnf168 PE=2 SV=1 292 353 4.0E-06
sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 273 352 4.0E-06
sp|Q8IYW5|RN168_HUMAN E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens GN=RNF168 PE=1 SV=1 287 364 6.0E-06
sp|P10862|RAD18_YEAST Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD18 PE=1 SV=1 282 359 6.0E-06
sp|Q6FPI4|RAD18_CANGA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD18 PE=3 SV=1 290 333 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|070040
MMHIHVFYLATNRFGPGPHRPNAQFSRPPLSPCPLASASRTSLGTGAATPTTDPAADPPTPPCRESPGPPPLSPA
AVDALFCCAVCHGPLRQPATLHCGHSVCAVHVTGPSDQPPPDSPLPPRCPLRSCDSTLVPSPAQPRIPASSRVRY
HPAPDAAARPVLVQPETVPEPRLDVTLSKVLDLVARTKQALLEDATTDSSDGEPDSHSSAHDHSVRRPRKRRRRR
ISPPPEDDSADDLLSHLRKQAVHQRTLSHDEPVLPSLPPSQTDTPLPRSKDAVLARFQKDLLVELTCEICFVLLY
QPITTPCQHTFCAKCLHRSLDHSPACPLCRQDLPGFAYFQDHPTNKTLLSIILKTWPMLYRERAQFPRSSHSITL
FRTKVPPHAPQMPRIAESPVWYDYGTKTSVQMLPDGRSMVETWGTFRFRIFERGTLDGYMVGRIERIDDYPEDLD
ASSFLFPSNSIITSPETPSSSSSSSASTPSDPAHPPTPPSLPIPIHPNSPTNEELMTTCRTFLHRLQRGTAPWVV
QRLSSTYGTMPTDPSAFSFWVALVLPIDEHEKAKLLPLRSARLRLLLLVHWIEQLNSQWWFSSGCTVL*
Coding >AgabiH97|070040
ATGATGCACATTCACGTGTTCTATTTAGCAACAAATCGATTTGGCCCAGGCCCTCACCGACCCAATGCACAATTC
TCCCGCCCGCCTCTCTCTCCATGCCCTCTCGCAAGCGCAAGCAGGACGAGCTTGGGGACCGGTGCGGCGACGCCG
ACCACCGATCCTGCCGCAGATCCGCCCACCCCTCCCTGCCGCGAGTCTCCTGGCCCCCCGCCGCTTTCACCCGCC
GCCGTCGACGCTCTCTTCTGCTGCGCCGTCTGCCATGGCCCCCTCCGCCAGCCGGCCACCCTCCACTGCGGCCAT
TCCGTCTGTGCCGTCCATGTCACTGGACCCAGCGACCAGCCGCCTCCGGACTCGCCGCTCCCTCCCCGGTGTCCT
CTCCGCAGCTGCGACTCGACGCTTGTGCCGTCTCCGGCCCAGCCCCGCATCCCCGCATCTTCCCGCGTGCGATAC
CATCCGGCGCCCGATGCTGCCGCCCGTCCAGTCCTCGTCCAGCCGGAAACAGTGCCCGAGCCGCGTCTGGACGTC
ACCCTGAGCAAGGTCCTTGACCTGGTCGCTCGCACCAAGCAAGCTCTCCTCGAGGACGCGACCACTGATTCTTCC
GACGGAGAACCCGATTCCCATTCTTCCGCCCATGATCATTCAGTCCGTCGACCCCGCAAGCGCCGACGGCGTCGT
ATCAGTCCACCTCCCGAGGACGACAGTGCCGATGATCTCCTCTCCCATCTCAGAAAACAGGCAGTTCATCAACGC
ACCTTGTCCCATGACGAGCCTGTTCTTCCGTCATTACCGCCTTCCCAAACCGATACTCCCTTGCCCCGTTCGAAA
GATGCCGTCCTGGCCCGCTTCCAGAAAGATCTCCTTGTAGAACTCACCTGCGAGATATGCTTCGTCCTTCTTTAT
CAGCCGATTACCACCCCATGTCAACATACCTTTTGTGCGAAATGTCTACACAGATCCCTGGACCACAGCCCTGCC
TGTCCCCTCTGCAGACAAGATCTTCCTGGCTTTGCCTACTTCCAGGATCACCCCACCAATAAAACCCTCCTGTCC
ATCATTCTCAAAACTTGGCCAATGCTCTACAGGGAACGTGCTCAGTTTCCCAGGAGCTCCCACTCTATTACACTT
TTTCGAACCAAGGTACCGCCTCATGCTCCGCAGATGCCTAGAATCGCAGAATCCCCGGTTTGGTATGATTATGGC
ACCAAAACCAGTGTCCAGATGCTCCCAGACGGCCGTAGCATGGTCGAGACCTGGGGGACTTTCCGTTTTCGTATA
TTCGAACGTGGCACGCTGGATGGGTATATGGTTGGGCGAATAGAAAGAATCGACGATTACCCTGAGGATCTTGAC
GCGTCTTCCTTTCTTTTCCCTTCAAATTCAATCATCACCTCGCCAGAAACTCCCTCCTCTTCCTCTTCCTCTTCT
GCATCAACACCATCCGATCCTGCCCACCCACCTACACCACCATCACTCCCAATCCCAATTCATCCAAACTCGCCA
ACGAATGAAGAATTGATGACAACGTGTCGAACCTTCCTCCATCGTCTACAACGGGGCACTGCACCTTGGGTTGTT
CAACGCCTCTCAAGCACATACGGCACAATGCCCACCGATCCTTCTGCCTTTTCATTCTGGGTAGCGCTCGTCCTG
CCTATTGATGAACACGAAAAGGCTAAACTGTTACCGCTGAGGAGTGCCCGATTACGATTGTTGTTATTGGTCCAT
TGGATTGAACAGCTGAATAGTCAATGGTGGTTTTCGAGTGGATGTACCGTTCTATGA
Transcript >AgabiH97|070040
ATGATGCACATTCACGTGTTCTATTTAGCAACAAATCGATTTGGCCCAGGCCCTCACCGACCCAATGCACAATTC
TCCCGCCCGCCTCTCTCTCCATGCCCTCTCGCAAGCGCAAGCAGGACGAGCTTGGGGACCGGTGCGGCGACGCCG
ACCACCGATCCTGCCGCAGATCCGCCCACCCCTCCCTGCCGCGAGTCTCCTGGCCCCCCGCCGCTTTCACCCGCC
GCCGTCGACGCTCTCTTCTGCTGCGCCGTCTGCCATGGCCCCCTCCGCCAGCCGGCCACCCTCCACTGCGGCCAT
TCCGTCTGTGCCGTCCATGTCACTGGACCCAGCGACCAGCCGCCTCCGGACTCGCCGCTCCCTCCCCGGTGTCCT
CTCCGCAGCTGCGACTCGACGCTTGTGCCGTCTCCGGCCCAGCCCCGCATCCCCGCATCTTCCCGCGTGCGATAC
CATCCGGCGCCCGATGCTGCCGCCCGTCCAGTCCTCGTCCAGCCGGAAACAGTGCCCGAGCCGCGTCTGGACGTC
ACCCTGAGCAAGGTCCTTGACCTGGTCGCTCGCACCAAGCAAGCTCTCCTCGAGGACGCGACCACTGATTCTTCC
GACGGAGAACCCGATTCCCATTCTTCCGCCCATGATCATTCAGTCCGTCGACCCCGCAAGCGCCGACGGCGTCGT
ATCAGTCCACCTCCCGAGGACGACAGTGCCGATGATCTCCTCTCCCATCTCAGAAAACAGGCAGTTCATCAACGC
ACCTTGTCCCATGACGAGCCTGTTCTTCCGTCATTACCGCCTTCCCAAACCGATACTCCCTTGCCCCGTTCGAAA
GATGCCGTCCTGGCCCGCTTCCAGAAAGATCTCCTTGTAGAACTCACCTGCGAGATATGCTTCGTCCTTCTTTAT
CAGCCGATTACCACCCCATGTCAACATACCTTTTGTGCGAAATGTCTACACAGATCCCTGGACCACAGCCCTGCC
TGTCCCCTCTGCAGACAAGATCTTCCTGGCTTTGCCTACTTCCAGGATCACCCCACCAATAAAACCCTCCTGTCC
ATCATTCTCAAAACTTGGCCAATGCTCTACAGGGAACGTGCTCAGTTTCCCAGGAGCTCCCACTCTATTACACTT
TTTCGAACCAAGGTACCGCCTCATGCTCCGCAGATGCCTAGAATCGCAGAATCCCCGGTTTGGTATGATTATGGC
ACCAAAACCAGTGTCCAGATGCTCCCAGACGGCCGTAGCATGGTCGAGACCTGGGGGACTTTCCGTTTTCGTATA
TTCGAACGTGGCACGCTGGATGGGTATATGGTTGGGCGAATAGAAAGAATCGACGATTACCCTGAGGATCTTGAC
GCGTCTTCCTTTCTTTTCCCTTCAAATTCAATCATCACCTCGCCAGAAACTCCCTCCTCTTCCTCTTCCTCTTCT
GCATCAACACCATCCGATCCTGCCCACCCACCTACACCACCATCACTCCCAATCCCAATTCATCCAAACTCGCCA
ACGAATGAAGAATTGATGACAACGTGTCGAACCTTCCTCCATCGTCTACAACGGGGCACTGCACCTTGGGTTGTT
CAACGCCTCTCAAGCACATACGGCACAATGCCCACCGATCCTTCTGCCTTTTCATTCTGGGTAGCGCTCGTCCTG
CCTATTGATGAACACGAAAAGGCTAAACTGTTACCGCTGAGGAGTGCCCGATTACGATTGTTGTTATTGGTCCAT
TGGATTGAACAGCTGAATAGTCAATGGTGGTTTTCGAGTGGATGTACCGTTCTATGA
Gene >AgabiH97|070040
ATGATGCACATTCACGTGTTCTATTTAGCAACAAATCGATTTGGCCCAGGCCCTCACCGACCCAATGCACAATTC
TCCCGCCCGCCTCTCTCTCCATGCCCTCTCGCAAGCGCAAGCAGGACGAGCTTGGGGACCGGTGCGGCGACGCCG
ACCACCGTGAGCTTTCTGTCCGTCCCGCTGCCGCTGACGCCGACGCTCCTCGCCAGGATCCTGCCGCAGATCCGC
CCACCCCTCCCTGCCGCGAGTCTCCTGGCCCCCCGCCGCTTTCACCCGCCGCCGTCGACGCTCTCTTCTGCTGCG
CCGTCTGCCATGGCCCCCTCCGCCAGCCGGCCACCCTCCACTGCGGCCATTCCGTCTGTGCCGTCCATGTCACTG
GACCCAGCGACCAGCCGCCTCCGGACTCGCCGCTCCCTCCCCGGTGTCCTCTCCGCAGCTGCGACTCGACGCTTG
TGCCGTCTCCGGCCCAGCCCCGCATCCCCGCATCTTCCCGCGTGCGATACCATCCGGCGCCCGATGCTGCCGCCC
GTCCAGTCCTCGTCCAGCCGGAAACAGTGCCCGAGCCGCGTCTGGACGTCACCCTGAGCAAGGTCCTTGACCTGG
TCGCTCGCACCAAGCAAGCTCTCCTCGAGGACGCGACCACTGATTCTTCCGACGGAGAACCCGATTCCCATTCTT
CCGCCCATGATCATTCAGTCCGTCGACCCCGCAAGCGCCGACGGCGTCGTATCAGTCCACCTCCCGAGGACGACA
GTGCCGATGATCTCCTCTCCCATCTCAGAAAACAGGCAGTTCATCAACGCACCTTGTCCCATGACGAGCCTGTTC
TTCCGTCATTACCGCCTTCCCAAACCGATACTCCCTTGCCCCGTTCGAAAGATGCCGTCCTGGCCCGCTTCCAGA
AAGATCTCCTTGTAGAACTCACCTGCGAGATATGCTTCGTCCTTCTTTATCAGCCGATTACCACCCCATGTCAAC
ATGTAAGACCCATCCCCTCACTTATACTCCAGATCTAATCCTCCTCCTCCAGACCTTTTGTGCGAAATGTCTACA
CAGATCCCTGGACCACAGCCCTGCCTGTCCCCTCTGCAGACAAGATCTTCCTGGCTTTGCCTACTTCCAGGATCA
CCCCACCAATAAAACCCTCCTGTCCATCAGTCAGTACTACCTCACCCCTCCCACCTTGTTTTCTGACCAGGTGTC
CCATAGTTCTCAAAACTTGGCCAATGCTCTACAGGGAACGTGGTGAGGCCCTGGCTGCCGAAGAACGCGACGCTC
GTCTTGATACCCCAATATTCGTCTGTCAGCTCAGTTTCCCAGGAGCTCCCACTCTATTACACTTTTTCGAACCAA
GGTACGCGTCCATTGTCCCCTCATAGGCCGACATTTAACATTTTCTGGTCTCCAAGGTACCGCCTCATGCTCCGC
AGATGCCTAGAATCGCAGAATCCCCGGTTTGGTATGATTATGGCACCAAAACCAGGTGCAGGATCGCCCCAAACC
GATTATGGTACCATGCTAGAAATTCGCAGTGTCCAGATGCTCCCAGACGGCCGTAGCATGGTCGAGACCTGGGGG
ACTTTCCGTTTTCGTATATTCGAACGTGGCACGCTGGATGGGTATATGGTTGGGCGAATAGAAAGGCAAGTTCAA
TCGGATCGCCATCATGAAATTCAAGTCATTAATCACGTAATCTGCAATCAGAATCGACGATTACCCTGAGGATCT
TGACGCGTCTTCCTTTCTTTTCCCTTCAAATTCAATCATCACCTCGCCAGAAACTCCCTCCTCTTCCTCTTCCTC
TTCTGCATCAACACCATCCGATCCTGCCCACCCACCTACACCACCATCACTCCCAATCCCAATTCATCCAAACTC
GCCAACGAATGAAGAATTGATGACAACGTGTCGAACCTTCCTCCATCGTCTACAACGGGGCACTGCACCTTGGGT
TGTTCAACGCCTCTCAAGCACATACGGCACAATGCCCACCGATCCTTCTGCCTTTTCATTCTGGGTAGCGCTCGT
CCTGCCTATTGATGAACACGAAAAGGCTAAACTGTTACCGCTGAGGAGTGCCCGATTACGATTGTTGTTATTGGT
CCATTGGATTGAACAGCTGAATAGTCAATGGTACGCCTTTGTGTGGAAGGTGGTGGCATGCTGCATGTGGACAGC
TTTTGTGCTTACGATTTCGCGTTTGGTTGGTTTTATATAGGTGGTTTTCGAGTGGATGTACCGTTCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail