Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069900
Gene name
Locationscaffold_4:1160894..1161895
Strand+
Gene length (bp)1001
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01161 PBP Phosphatidylethanolamine-binding protein 2.2E-11 88 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31044|PEBP1_RAT Phosphatidylethanolamine-binding protein 1 OS=Rattus norvegicus GN=Pebp1 PE=1 SV=3 71 215 8.0E-09
sp|Q9XH44|CET1_TOBAC CEN-like protein 1 OS=Nicotiana tabacum GN=CET1 PE=2 SV=1 28 215 1.0E-08
sp|Q8VIN1|PEBP2_MOUSE Phosphatidylethanolamine-binding protein 2 OS=Mus musculus GN=Pbp2 PE=1 SV=1 71 215 7.0E-08
sp|Q9XFK7|MFT_ARATH Protein MOTHER of FT and TF 1 OS=Arabidopsis thaliana GN=MFT PE=1 SV=1 34 215 8.0E-08
sp|P13696|PEBP1_BOVIN Phosphatidylethanolamine-binding protein 1 OS=Bos taurus GN=PEBP1 PE=1 SV=2 101 215 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31044|PEBP1_RAT Phosphatidylethanolamine-binding protein 1 OS=Rattus norvegicus GN=Pebp1 PE=1 SV=3 71 215 8.0E-09
sp|Q9XH44|CET1_TOBAC CEN-like protein 1 OS=Nicotiana tabacum GN=CET1 PE=2 SV=1 28 215 1.0E-08
sp|Q8VIN1|PEBP2_MOUSE Phosphatidylethanolamine-binding protein 2 OS=Mus musculus GN=Pbp2 PE=1 SV=1 71 215 7.0E-08
sp|Q9XFK7|MFT_ARATH Protein MOTHER of FT and TF 1 OS=Arabidopsis thaliana GN=MFT PE=1 SV=1 34 215 8.0E-08
sp|P13696|PEBP1_BOVIN Phosphatidylethanolamine-binding protein 1 OS=Bos taurus GN=PEBP1 PE=1 SV=2 101 215 2.0E-07
sp|Q8MK67|PEBP1_RABIT Phosphatidylethanolamine-binding protein 1 OS=Oryctolagus cuniculus GN=PEBP1 PE=2 SV=1 101 215 2.0E-07
sp|P31729|OV16_ONCVO OV-16 antigen OS=Onchocerca volvulus GN=OV16 PE=2 SV=2 7 215 3.0E-07
sp|Q3YIX4|PEBP1_CANLF Phosphatidylethanolamine-binding protein 1 OS=Canis lupus familiaris GN=PEBP1 PE=1 SV=1 101 215 4.0E-07
sp|O16264|PEBPH_CAEEL Phosphatidylethanolamine-binding protein homolog F40A3.3 OS=Caenorhabditis elegans GN=F40A3.3 PE=3 SV=1 2 215 5.0E-07
sp|P70296|PEBP1_MOUSE Phosphatidylethanolamine-binding protein 1 OS=Mus musculus GN=Pebp1 PE=1 SV=3 71 215 5.0E-07
sp|P54187|D2_ONCVO Protein D2 (Fragment) OS=Onchocerca volvulus GN=D2 PE=2 SV=1 97 215 1.0E-06
sp|P54186|D1_ONCVO Protein D1 (Fragment) OS=Onchocerca volvulus GN=D1 PE=2 SV=1 97 215 1.0E-06
sp|P54188|D3_ONCVO Protein D3 (Fragment) OS=Onchocerca volvulus GN=D3 PE=2 SV=1 97 215 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069900
MLFFATVVFALHALGRAQTGTNSSSTLSDVAAALTEAKIVPDVIPTFNPNAGLSPIFTGSSGPVQVMPGMPLTMN
DTQAPPQYLLASNSTDLSTSNASWVIAIVDPDAPSPQFLHFIGKDFVVDPNLVVEGGSLTNASGLMNTSQALIEF
VSPSPPPMDAAHRYVVLVYQQPSDFNVTAPAFFSGVNGTDFRQGFSISAFATNTSLGDPIAGTFFLVGSNTSTTT
MVPSSTIMSPPPTSPLPSIVTPPPSPTSPPPATPQEPPPTTTDVPSGGEKVTSWMSLLIVSTLSVAMMLI*
Coding >AgabiH97|069900
ATGCTTTTCTTCGCCACCGTAGTCTTTGCACTGCATGCGCTGGGCAGGGCTCAAACGGGGACCAACTCATCCTCA
ACGCTATCCGATGTTGCTGCAGCCTTGACTGAGGCCAAGATCGTCCCAGACGTCATTCCCACCTTTAATCCCAAT
GCCGGTTTGAGCCCCATCTTTACGGGCTCCTCTGGCCCAGTTCAGGTTATGCCCGGTATGCCTCTCACTATGAAT
GATACCCAGGCTCCACCACAGTATCTTCTCGCATCCAACAGCACTGATTTATCAACGTCGAATGCATCCTGGGTG
ATCGCTATTGTCGATCCCGATGCTCCGTCGCCTCAGTTTCTCCATTTCATTGGGAAAGACTTTGTGGTCGATCCT
AATCTTGTTGTGGAAGGAGGCAGTTTGACGAATGCATCTGGCCTGATGAACACGAGTCAAGCCTTGATAGAATTC
GTCAGCCCGAGCCCTCCACCGATGGATGCCGCACACAGATATGTTGTCCTAGTCTACCAGCAGCCTAGTGATTTC
AACGTCACTGCACCCGCATTTTTCAGCGGCGTGAATGGTACGGACTTCAGACAGGGTTTCAGTATCTCCGCCTTT
GCCACCAATACGTCTCTTGGAGACCCAATTGCTGGGACTTTCTTCTTGGTTGGCTCTAACACCTCTACCACGACA
ATGGTGCCTTCCAGCACCATTATGTCCCCGCCACCGACCTCGCCATTGCCGAGTATTGTAACGCCACCTCCGTCG
CCAACGTCACCTCCCCCGGCTACCCCGCAGGAACCTCCGCCTACAACTACGGATGTGCCCTCTGGAGGAGAGAAG
GTTACCAGCTGGATGTCCTTGCTAATTGTTTCAACTCTAAGTGTAGCCATGATGCTGATTTAG
Transcript >AgabiH97|069900
ATGCTTTTCTTCGCCACCGTAGTCTTTGCACTGCATGCGCTGGGCAGGGCTCAAACGGGGACCAACTCATCCTCA
ACGCTATCCGATGTTGCTGCAGCCTTGACTGAGGCCAAGATCGTCCCAGACGTCATTCCCACCTTTAATCCCAAT
GCCGGTTTGAGCCCCATCTTTACGGGCTCCTCTGGCCCAGTTCAGGTTATGCCCGGTATGCCTCTCACTATGAAT
GATACCCAGGCTCCACCACAGTATCTTCTCGCATCCAACAGCACTGATTTATCAACGTCGAATGCATCCTGGGTG
ATCGCTATTGTCGATCCCGATGCTCCGTCGCCTCAGTTTCTCCATTTCATTGGGAAAGACTTTGTGGTCGATCCT
AATCTTGTTGTGGAAGGAGGCAGTTTGACGAATGCATCTGGCCTGATGAACACGAGTCAAGCCTTGATAGAATTC
GTCAGCCCGAGCCCTCCACCGATGGATGCCGCACACAGATATGTTGTCCTAGTCTACCAGCAGCCTAGTGATTTC
AACGTCACTGCACCCGCATTTTTCAGCGGCGTGAATGGTACGGACTTCAGACAGGGTTTCAGTATCTCCGCCTTT
GCCACCAATACGTCTCTTGGAGACCCAATTGCTGGGACTTTCTTCTTGGTTGGCTCTAACACCTCTACCACGACA
ATGGTGCCTTCCAGCACCATTATGTCCCCGCCACCGACCTCGCCATTGCCGAGTATTGTAACGCCACCTCCGTCG
CCAACGTCACCTCCCCCGGCTACCCCGCAGGAACCTCCGCCTACAACTACGGATGTGCCCTCTGGAGGAGAGAAG
GTTACCAGCTGGATGTCCTTGCTAATTGTTTCAACTCTAAGTGTAGCCATGATGCTGATTTAG
Gene >AgabiH97|069900
ATGCTTTTCTTCGCCACCGTAGTCTTTGCACTGCATGCGCTGGGCAGGGCTCAAACGGGGACCAACTCATCCTCA
ACGCTATCCGATGTTGCTGCAGCCTTGACTGAGGCCAAGATCGTCCCAGACGTCATTCCCACCTTTAATCCCAAT
GCCGGTTTGAGCCCCATCTTTACGGGCTCCTCTGGCCCAGTTCAGGTTATGCCCGGTATGCCTCTCACTATGAAT
GGTACGTACTATGTTTCTAGCAATGGTCTCCCTTTGACTGATGGGGGTCTATAGATACCCAGGCTCCACCACAGT
ATCTTCTCGCATCCAACAGCACTGATTTATCAACGTCGAATGCATCCTGGGTGATCGCTATTGTCGATCCCGATG
CTCCGTCGCCTCAGTTTCTCCATTTCATTGGGAAAGACTTTGTGGTCGATCCTAATCTTGTTGTGGAAGGAGGCA
GTTTGACGAATGCATCTGGCCTGATGAACACGAGTCAAGCCTTGATAGAATTCGTCAGCCCGAGCCCTCCACCGA
TGGATGCCGCACACAGGTCAGTGGAATTTCGTCATCATAAAGTAGGTTGGCAGTGACAAGCTTTGTTACGATGCA
GATATGTTGTCCTAGTCTACCAGCAGCCTAGTGATTTCAACGTCACTGCACCCGCATTTTTCAGCGGCGTGAATG
GTACGGACTTCAGACAGGGTTTCAGTATCTCCGCCTTTGCCACCAATACGTCTCTTGGAGACCCAATTGCTGGGA
CTTTCTTCTTGGTTGGCTCTAACACCTCTACCACGACAATGGTGCCTTCCAGCACCATTATGTCCCCGCCACCGA
CCTCGCCATTGCCGAGTATTGTAACGCCACCTCCGTCGCCAACGTCACCTCCCCCGGCTACCCCGCAGGAACCTC
CGCCTACAACTACGGATGTGCCCTCTGGAGGAGAGAAGGTTACCAGCTGGATGTCCTTGCTAATTGTTTCAACTC
TAAGTGTAGCCATGATGCTGATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail