Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069890
Gene name
Locationscaffold_4:1160055..1160533
Strand+
Gene length (bp)478
Transcript length (bp)423
Coding sequence length (bp)423
Protein length (aa) 141

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D6RMH5|LCL2_COPC7 Long chronological lifespan protein 2 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=LCL2 PE=3 SV=1 62 139 6.0E-34
sp|Q0CE76|LCL2_ASPTN Long chronological lifespan protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lcl2 PE=3 SV=1 11 136 5.0E-11
sp|E6R3N7|LCL2_CRYGW Long chronological lifespan protein 2 OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=LCL2 PE=3 SV=1 78 136 2.0E-10
sp|Q4WES5|LCL2_ASPFU Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lcl2 PE=3 SV=1 11 136 3.0E-10
sp|B0Y310|LCL2_ASPFC Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lcl2 PE=3 SV=1 11 136 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D6RMH5|LCL2_COPC7 Long chronological lifespan protein 2 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=LCL2 PE=3 SV=1 62 139 6.0E-34
sp|Q0CE76|LCL2_ASPTN Long chronological lifespan protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lcl2 PE=3 SV=1 11 136 5.0E-11
sp|E6R3N7|LCL2_CRYGW Long chronological lifespan protein 2 OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=LCL2 PE=3 SV=1 78 136 2.0E-10
sp|Q4WES5|LCL2_ASPFU Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lcl2 PE=3 SV=1 11 136 3.0E-10
sp|B0Y310|LCL2_ASPFC Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lcl2 PE=3 SV=1 11 136 3.0E-10
sp|A1CZR3|LCL2_NEOFI Long chronological lifespan protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lcl2 PE=3 SV=1 11 136 5.0E-10
sp|A1C4T4|LCL2_ASPCL Long chronological lifespan protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lcl2 PE=3 SV=1 12 136 7.0E-10
sp|B8M9Q9|LCL2_TALSN Long chronological lifespan protein 2 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=lcl2 PE=3 SV=1 14 136 2.0E-09
sp|Q2U9Z3|LCL2_ASPOR Long chronological lifespan protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lcl2 PE=3 SV=1 9 136 5.0E-09
sp|B8NQK0|LCL2_ASPFN Long chronological lifespan protein 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lcl2 PE=3 SV=1 9 136 5.0E-09
sp|A2QUM3|LCL2_ASPNC Long chronological lifespan protein 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lcl2 PE=3 SV=1 10 136 1.0E-07
sp|B9WM02|LCL2_CANDC Long chronological lifespan protein 2 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=LCL2 PE=3 SV=1 17 109 3.0E-07
sp|C4R2P5|LCL2_PICPG Long chronological lifespan protein 2 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=LCL2 PE=3 SV=1 15 136 3.0E-07
sp|C4YM26|LCL2_CANAW Long chronological lifespan protein 2 OS=Candida albicans (strain WO-1) GN=LCL2 PE=3 SV=1 17 109 5.0E-07
sp|Q59PT4|LCL2_CANAL Long chronological lifespan protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LCL2 PE=3 SV=1 17 109 5.0E-07
sp|B6HU36|LCL2_PENRW Long chronological lifespan protein 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lcl2 PE=3 SV=1 11 136 6.0E-07
sp|C5FVJ9|LCL2_ARTOC Long chronological lifespan protein 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LCL2 PE=3 SV=1 13 136 1.0E-06
sp|Q0UAF6|LCL2_PHANO Long chronological lifespan protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LCL2 PE=3 SV=1 50 121 1.0E-06
sp|C0S855|LCL2_PARBP Long chronological lifespan protein 2 OS=Paracoccidioides brasiliensis (strain Pb03) GN=LCL2 PE=3 SV=1 56 136 2.0E-06
sp|C1GJL9|LCL2_PARBD Long chronological lifespan protein 2 OS=Paracoccidioides brasiliensis (strain Pb18) GN=LCL2 PE=3 SV=1 56 136 3.0E-06
sp|C1H0A6|LCL2_PARBA Long chronological lifespan protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=LCL2 PE=3 SV=1 56 136 3.0E-06
sp|A5DP59|LCL2_PICGU Long chronological lifespan protein 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=LCL2 PE=3 SV=1 15 109 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069890
MRQHSPSPFYSWLLMAVFLLLQIHVASANYEQLYNLFHGHGGGHHQQQQQQQQQQHHHQQQRTGASQFSAYADSV
ACAHYLCPRTLDCVELPSNCPCPNVEDIKCLIPDMDGDVDDATVVCVRGNQECKEVERLMKKYSQ*
Coding >AgabiH97|069890
ATGCGCCAACATAGCCCATCGCCGTTCTACTCGTGGCTTCTGATGGCAGTCTTTCTTCTTCTCCAAATTCACGTT
GCTTCGGCGAATTACGAACAGTTATACAACCTGTTCCATGGTCACGGTGGAGGACATCATCAACAGCAGCAGCAG
CAGCAACAACAACAGCATCATCATCAACAGCAAAGAACTGGTGCTTCCCAGTTCTCAGCATATGCCGATAGTGTT
GCATGTGCTCACTACCTTTGTCCACGAACGTTGGACTGCGTGGAACTACCCTCGAATTGCCCATGTCCTAATGTT
GAGGATATCAAATGTCTTATCCCAGACATGGATGGAGATGTTGACGATGCGACTGTGGTTTGTGTGCGGGGTAAC
CAAGAGTGCAAAGAGGTGGAAAGGCTGATGAAAAAATACTCTCAATGA
Transcript >AgabiH97|069890
ATGCGCCAACATAGCCCATCGCCGTTCTACTCGTGGCTTCTGATGGCAGTCTTTCTTCTTCTCCAAATTCACGTT
GCTTCGGCGAATTACGAACAGTTATACAACCTGTTCCATGGTCACGGTGGAGGACATCATCAACAGCAGCAGCAG
CAGCAACAACAACAGCATCATCATCAACAGCAAAGAACTGGTGCTTCCCAGTTCTCAGCATATGCCGATAGTGTT
GCATGTGCTCACTACCTTTGTCCACGAACGTTGGACTGCGTGGAACTACCCTCGAATTGCCCATGTCCTAATGTT
GAGGATATCAAATGTCTTATCCCAGACATGGATGGAGATGTTGACGATGCGACTGTGGTTTGTGTGCGGGGTAAC
CAAGAGTGCAAAGAGGTGGAAAGGCTGATGAAAAAATACTCTCAATGA
Gene >AgabiH97|069890
ATGCGCCAACATAGCCCATCGCCGTTCTACTCGTGGCTTCTGATGGCAGTCTTTCTTCTTCTCCAAATTCACGTT
GCTTCGGCGAATTACGAACAGTTATACAACCTGTTCCATGGTCACGGTGGAGGACATCATCAACAGCAGCAGCAG
CAGCAACAACAACAGCATCATCATCAACAGCAAAGAACTGGTGCTTCCCAGTTCTCAGCATATGCCGATAGTGGT
GGGTCGTCATATCCATATTTTAAGCATCTATTGGTAATGAACAATTCTTATAGTTGCATGTGCTCACTACCTTTG
TCCACGAACGTTGGACTGCGTGGAACTACCCTCGAATTGCCCATGTCCTAATGTTGAGGATATCAAATGTCTTAT
CCCAGACATGGATGGAGATGTTGACGATGCGACTGTGGTTTGTGTGCGGGGTAACCAAGAGTGCAAAGAGGTGGA
AAGGCTGATGAAAAAATACTCTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail