Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069850
Gene name
Locationscaffold_4:1153189..1154798
Strand-
Gene length (bp)1609
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11931 SF3a60_Prp9_C SF3a60/Prp9 C-terminal 3.7E-53 264 383
PF16837 SF3A3 Pre-mRNA-splicing factor SF3A3, of SF3a complex, Prp9 5.1E-12 37 76
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 2.4E-07 160 183
PF12874 zf-met Zinc-finger of C2H2 type 6.3E-06 160 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59706|SAP61_SCHPO Pre-mRNA-splicing factor sap61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap61 PE=1 SV=1 32 383 5.0E-67
sp|Q9D554|SF3A3_MOUSE Splicing factor 3A subunit 3 OS=Mus musculus GN=Sf3a3 PE=1 SV=2 260 383 1.0E-46
sp|Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 OS=Homo sapiens GN=SF3A3 PE=1 SV=1 260 383 1.0E-46
sp|O46106|NOI_DROME Splicing factor 3A subunit 3 OS=Drosophila melanogaster GN=noi PE=1 SV=1 260 383 1.0E-46
sp|P19736|PRP9_YEAST Pre-mRNA-splicing factor PRP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP9 PE=1 SV=1 37 383 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59706|SAP61_SCHPO Pre-mRNA-splicing factor sap61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap61 PE=1 SV=1 32 383 5.0E-67
sp|Q9D554|SF3A3_MOUSE Splicing factor 3A subunit 3 OS=Mus musculus GN=Sf3a3 PE=1 SV=2 260 383 1.0E-46
sp|Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 OS=Homo sapiens GN=SF3A3 PE=1 SV=1 260 383 1.0E-46
sp|O46106|NOI_DROME Splicing factor 3A subunit 3 OS=Drosophila melanogaster GN=noi PE=1 SV=1 260 383 1.0E-46
sp|P19736|PRP9_YEAST Pre-mRNA-splicing factor PRP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP9 PE=1 SV=1 37 383 1.0E-39
sp|Q9D554|SF3A3_MOUSE Splicing factor 3A subunit 3 OS=Mus musculus GN=Sf3a3 PE=1 SV=2 38 145 6.0E-10
sp|Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 OS=Homo sapiens GN=SF3A3 PE=1 SV=1 38 145 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0005681 spliceosomal complex Yes
GO:0003723 RNA binding Yes
GO:0006396 RNA processing No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:1901360 organic cyclic compound metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0005488 binding No
GO:0016070 RNA metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0006397 mRNA processing No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:1990904 ribonucleoprotein complex No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0008152 metabolic process No
GO:0008380 RNA splicing No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0016071 mRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069850
MTSRISTRGIDLELASFLDEPGQEEDDFGEEDPISLMFSGEEAYGKYCDLYANHVAYTNLKGIDKRPAYLQYLDL
LLPEEGTLVHQDIPKDTRFSRQYESYIKDLYNYLLSFTKRTQPLMDVESQQNQLISQFEQKWDAKELPEWDDVIE
NAPINGNGIWCAACQKHYAKQTVYDAHLSSKKHIKAMNKQAAAGEPPKNPNGSPMPEMLHTIRTWPRPYWFSLTA
REREQELLDQANPPPPAAAAKDGAAEEEEEEERIYNPLKLPLGWDGKPIPYWLYKLHGLGVEYRCEICSDHVYMG
RKNFDRHFQESRHAFGMRALGLPNTKHFHEITRIEDALALAEKLKQEGRHEIFEQETMEELEDTEGNVYNRKTYE
DLKKQGLI*
Coding >AgabiH97|069850
ATGACCTCTCGGATTTCTACTCGCGGAATTGACCTGGAGCTGGCCTCGTTTCTGGATGAACCCGGCCAGGAAGAA
GACGACTTTGGCGAGGAGGATCCCATCTCACTCATGTTCTCCGGTGAAGAGGCCTACGGCAAATACTGTGACCTC
TACGCGAACCACGTCGCCTACACAAATCTGAAAGGCATAGACAAGCGACCGGCATACCTCCAATACCTTGATCTT
CTTTTACCAGAGGAAGGTACCCTCGTTCACCAGGACATTCCCAAAGACACTCGCTTTTCTCGGCAGTACGAGTCT
TATATCAAGGACTTGTACAATTACCTGCTTTCCTTCACAAAACGGACGCAGCCGCTCATGGACGTTGAAAGTCAA
CAAAACCAGTTAATTTCGCAGTTTGAACAGAAATGGGACGCGAAAGAGCTGCCCGAGTGGGATGATGTGATAGAG
AATGCGCCAATAAACGGGAATGGGATTTGGTGCGCCGCTTGCCAAAAACATTACGCCAAACAAACAGTGTACGAC
GCCCATCTTTCATCCAAAAAACACATCAAAGCGATGAACAAGCAAGCAGCCGCGGGTGAGCCGCCCAAAAACCCC
AACGGCTCGCCTATGCCCGAAATGCTGCATACTATACGTACATGGCCACGGCCTTATTGGTTTTCGCTTACTGCC
CGAGAGCGTGAACAAGAGCTTCTCGATCAGGCCAATCCTCCTCCACCCGCGGCTGCTGCTAAAGACGGCGCCGCG
GAGGAAGAGGAGGAAGAGGAAAGGATCTATAATCCCCTCAAGTTACCACTCGGTTGGGATGGAAAGCCCATTCCA
TATTGGCTATACAAACTCCATGGACTCGGGGTGGAGTACAGATGTGAGATTTGCTCAGATCACGTCTATATGGGA
AGGAAAAACTTTGATCGTCACTTTCAAGAGTCTCGCCATGCTTTTGGAATGCGTGCCCTTGGTCTCCCTAATACA
AAACACTTCCACGAGATCACGCGTATCGAGGATGCCCTGGCCCTTGCCGAAAAACTCAAGCAAGAAGGTCGTCAC
GAGATTTTCGAGCAAGAAACAATGGAAGAACTCGAAGATACCGAGGGTAATGTGTATAACCGCAAGACCTATGAA
GACTTGAAGAAGCAAGGCCTAATTTAA
Transcript >AgabiH97|069850
ATGACCTCTCGGATTTCTACTCGCGGAATTGACCTGGAGCTGGCCTCGTTTCTGGATGAACCCGGCCAGGAAGAA
GACGACTTTGGCGAGGAGGATCCCATCTCACTCATGTTCTCCGGTGAAGAGGCCTACGGCAAATACTGTGACCTC
TACGCGAACCACGTCGCCTACACAAATCTGAAAGGCATAGACAAGCGACCGGCATACCTCCAATACCTTGATCTT
CTTTTACCAGAGGAAGGTACCCTCGTTCACCAGGACATTCCCAAAGACACTCGCTTTTCTCGGCAGTACGAGTCT
TATATCAAGGACTTGTACAATTACCTGCTTTCCTTCACAAAACGGACGCAGCCGCTCATGGACGTTGAAAGTCAA
CAAAACCAGTTAATTTCGCAGTTTGAACAGAAATGGGACGCGAAAGAGCTGCCCGAGTGGGATGATGTGATAGAG
AATGCGCCAATAAACGGGAATGGGATTTGGTGCGCCGCTTGCCAAAAACATTACGCCAAACAAACAGTGTACGAC
GCCCATCTTTCATCCAAAAAACACATCAAAGCGATGAACAAGCAAGCAGCCGCGGGTGAGCCGCCCAAAAACCCC
AACGGCTCGCCTATGCCCGAAATGCTGCATACTATACGTACATGGCCACGGCCTTATTGGTTTTCGCTTACTGCC
CGAGAGCGTGAACAAGAGCTTCTCGATCAGGCCAATCCTCCTCCACCCGCGGCTGCTGCTAAAGACGGCGCCGCG
GAGGAAGAGGAGGAAGAGGAAAGGATCTATAATCCCCTCAAGTTACCACTCGGTTGGGATGGAAAGCCCATTCCA
TATTGGCTATACAAACTCCATGGACTCGGGGTGGAGTACAGATGTGAGATTTGCTCAGATCACGTCTATATGGGA
AGGAAAAACTTTGATCGTCACTTTCAAGAGTCTCGCCATGCTTTTGGAATGCGTGCCCTTGGTCTCCCTAATACA
AAACACTTCCACGAGATCACGCGTATCGAGGATGCCCTGGCCCTTGCCGAAAAACTCAAGCAAGAAGGTCGTCAC
GAGATTTTCGAGCAAGAAACAATGGAAGAACTCGAAGATACCGAGGGTAATGTGTATAACCGCAAGACCTATGAA
GACTTGAAGAAGCAAGGCCTAATTTAA
Gene >AgabiH97|069850
ATGACCTCTCGGATTTCTACTCGCGGTTGGTAAAAATACAGGAACACCACAACAAGTATCCTGATTCTGCTCCAG
GAATTGACCTGGAGCTGGCCTCGTTTCTGGATGAACCCGGCCAGGAAGAAGACGACTTTGGCGAGGAGGATCGTG
CGTCTCTGTTCCCCCGTAATAGCCCATTCTCACCTACTCACCCGTTGCACCGGCAGCCATCTCACTCATGTTCTC
CGGTGAAGAGGCCTACGGCAAATACTGTGACCTCTACGCGAACCACGTCGCCTACACAAATCTGAAAGGCATAGA
CAAGCGACCGGCATACCTCCAATACCTTGATCTTCTTTTACCAGAGGAAGGTACCCTCGTTCACCAGGACATTCC
CAAAGACACTCGCTTTTCTCGGCAGTACGAGTCGTGAGTCTTTACCACTCAGATGCCCCGTGCACACTCTAACAC
GTTCCAGTTATATCAAGGACTTGTACAATTACCTGCTTTCCTTCACAAAACGGACGCAGCCGCTCATGGACGTTG
AAAGTCAACAAAACCAGTTAATTTCGCAGTTTGAACAGAAATGGGACGCGAAAGAGCTGCCCGAGTGGGATGATG
TGATAGAGAATGCGCCAATAAACGGGAATGGGATTTGGTGCGCCGCTTGTGAGTGTCTCCTCAGTTCAATTGCTT
CTCATACTAACCCTCTCAGGCCAAAAACATTACGCCAAACAAACAGTGTACGACGCCCATCTTTCATCCAAAAAA
CACATCAAAGCGATGAACAAGCAAGCAGCCGCGGGTGAGCCGCCCAAAAACCCCAACGGCTCGCCTATGCCCGGT
TCAAATGCAAGTCAAGCCAGCGCACCATCAGCTGCTAAACTGCGGATAAGAAATGCTGCATACTATACGTACATG
GCCACGGCCTTATTGGTAATCTTGGCACCTGTCATTAATGAAACAAAATCCAACGTAGAGCGAAGGTTTTCGCTT
ACTGCCCGAGAGCGTGAACAAGAGCTTCTCGATCAGGCCAATCCTCCTCCACCCGCGGCTGCTGCTAAAGACGGC
GCCGCGGAGGAAGAGGAGGAAGAGGAAAGGATCTATAATCCCCTCAAGTTACCACTCGGTTGGGATGGAAAGCCC
ATTCCATATTGGCTATACAAACTCCATGGACTCGGGGTGGAGTACAGATGTGAGATTTGCTCAGATCACGTCTAT
ATGGGAAGGTGAGCATCTGCAGTGTGCAAGACAACTATGACTGATTACTTTTGCCTAGGAAAAACTTTGATCGTC
ACTTTCAAGTATGTCCCATCAACGAGCAAGTACAATAGCTAAACATAGTCATAGGAGTCTCGCCATGCTTTTGGA
ATGCGTGCCCTTGGTCTCCCTAATACAAAACACTTCCACGAGATCACGCGTATCGAGGATGCCCTGGCCCGTAAG
CATATAGCCTCGTATCATTTATGAACCCTAGCCCTCATCGTTCTTCCTAGTTGCCGAAAAACTCAAGCAAGAAGG
TCGTCACGAGATTTTCGAGCAAGAAACAATGGAAGAACTCGAAGATACCGAGGGTAATGTGTATAACCGCAAGAC
CTATGAAGACTTGAAGAAGCAAGGCCTAATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail