Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069800
Gene name
Locationscaffold_4:1136949..1137773
Strand-
Gene length (bp)824
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 7.4E-10 10 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60074|DID2_SCHPO Vacuolar protein-sorting-associated protein 46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=did2 PE=3 SV=2 1 200 1.0E-79
sp|Q6PHF0|CHM1A_DANRE Charged multivesicular body protein 1a OS=Danio rerio GN=chmp1a PE=2 SV=1 4 200 6.0E-66
sp|O96552|CHMP1_DICDI Charged multivesicular body protein 1 OS=Dictyostelium discoideum GN=chmp1 PE=3 SV=1 4 200 1.0E-64
sp|Q6NUD8|CHM1A_XENLA Charged multivesicular body protein 1a OS=Xenopus laevis GN=chmp1a PE=2 SV=1 4 200 4.0E-63
sp|Q921W0|CHM1A_MOUSE Charged multivesicular body protein 1a OS=Mus musculus GN=Chmp1a PE=1 SV=1 4 200 9.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60074|DID2_SCHPO Vacuolar protein-sorting-associated protein 46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=did2 PE=3 SV=2 1 200 1.0E-79
sp|Q6PHF0|CHM1A_DANRE Charged multivesicular body protein 1a OS=Danio rerio GN=chmp1a PE=2 SV=1 4 200 6.0E-66
sp|O96552|CHMP1_DICDI Charged multivesicular body protein 1 OS=Dictyostelium discoideum GN=chmp1 PE=3 SV=1 4 200 1.0E-64
sp|Q6NUD8|CHM1A_XENLA Charged multivesicular body protein 1a OS=Xenopus laevis GN=chmp1a PE=2 SV=1 4 200 4.0E-63
sp|Q921W0|CHM1A_MOUSE Charged multivesicular body protein 1a OS=Mus musculus GN=Chmp1a PE=1 SV=1 4 200 9.0E-62
sp|Q5R605|CHM1A_PONAB Charged multivesicular body protein 1a OS=Pongo abelii GN=CHMP1A PE=2 SV=1 4 200 4.0E-61
sp|Q9HD42|CHM1A_HUMAN Charged multivesicular body protein 1a OS=Homo sapiens GN=CHMP1A PE=1 SV=1 4 200 4.0E-61
sp|P69771|DID2_YEAST Vacuolar protein-sorting-associated protein 46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DID2 PE=1 SV=1 4 200 4.0E-56
sp|Q9CQD4|CH1B2_MOUSE Charged multivesicular body protein 1b-2 OS=Mus musculus GN=Chmp1b2 PE=2 SV=2 1 200 1.0E-53
sp|Q5E994|CHM1B_BOVIN Charged multivesicular body protein 1b OS=Bos taurus GN=CHMP1B PE=2 SV=1 1 200 3.0E-52
sp|Q5ZKX1|CHM1B_CHICK Charged multivesicular body protein 1b OS=Gallus gallus GN=CHMP1B PE=2 SV=1 1 200 6.0E-52
sp|Q7ZVB1|CHM1B_DANRE Charged multivesicular body protein 1b OS=Danio rerio GN=chmp1b PE=2 SV=1 1 200 1.0E-51
sp|Q7LBR1|CHM1B_HUMAN Charged multivesicular body protein 1b OS=Homo sapiens GN=CHMP1B PE=1 SV=1 1 200 2.0E-51
sp|Q99LU0|CH1B1_MOUSE Charged multivesicular body protein 1b-1 OS=Mus musculus GN=Chmp1b1 PE=1 SV=1 1 200 3.0E-51
sp|Q8LE58|CHM1A_ARATH ESCRT-related protein CHMP1A OS=Arabidopsis thaliana GN=CHMP1A PE=1 SV=1 8 200 4.0E-51
sp|Q6DF27|CHM1B_XENTR Charged multivesicular body protein 1b OS=Xenopus tropicalis GN=chmp1b PE=2 SV=1 1 200 1.0E-49
sp|Q7SZB5|CHM1B_XENLA Charged multivesicular body protein 1b OS=Xenopus laevis GN=chmp1b PE=2 SV=1 1 200 2.0E-49
sp|Q84VG1|CHMP1_ORYSJ ESCRT-related protein CHMP1 OS=Oryza sativa subsp. japonica GN=CHMP1 PE=2 SV=1 1 200 1.0E-41
sp|Q9SSM4|CHM1B_ARATH ESCRT-related protein CHMP1B OS=Arabidopsis thaliana GN=CHMP1B PE=1 SV=1 1 200 1.0E-41
sp|Q9SKI2|VPS2A_ARATH Vacuolar protein sorting-associated protein 2 homolog 1 OS=Arabidopsis thaliana GN=VPS2.1 PE=1 SV=2 36 194 3.0E-09
sp|Q54DB1|CM2A2_DICDI Charged multivesicular body protein 2a homolog 2 OS=Dictyostelium discoideum GN=chmp2a2 PE=3 SV=1 36 185 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069800
MSNLEKTLFQLKFTAKTLGRQAKKAQKDENTEKARVKKALQQGNTEGARIYASNAIRKKSESLNLLRLSSRLDAV
ASRVETAVTMRQVTGNMTSVVRGMDKAMESMNLERISMVMDKFESQFSDLDVQTGYMEDAMGSTTAVSAPQDQID
MLLRQTAEEANIELQHDLAIQDVTALGAPSPKERVLEEDETLAERLRALRPAT*
Coding >AgabiH97|069800
ATGAGCAATCTTGAAAAGACACTGTTCCAGCTTAAGTTCACGGCGAAGACACTAGGCCGTCAAGCAAAGAAAGCC
CAGAAAGACGAAAACACAGAAAAGGCGAGAGTAAAGAAGGCTCTGCAACAGGGAAACACTGAAGGGGCTCGGATA
TATGCCTCCAATGCTATCAGAAAGAAAAGTGAATCCCTTAATCTGCTCAGATTATCGAGTCGTCTCGACGCAGTG
GCAAGTCGAGTAGAGACTGCCGTGACTATGCGTCAAGTCACCGGCAACATGACGTCCGTCGTGCGGGGTATGGAT
AAAGCTATGGAGAGCATGAACCTTGAAAGGATATCGATGGTAATGGATAAGTTTGAGTCGCAATTTTCCGATCTC
GATGTCCAGACAGGGTACATGGAGGACGCAATGGGATCCACGACCGCTGTCTCGGCGCCACAAGATCAGATTGAC
ATGCTTTTACGCCAGACAGCAGAGGAAGCTAATATTGAACTCCAACACGACCTTGCTATTCAGGATGTAACAGCC
CTCGGTGCACCAAGCCCGAAAGAACGTGTTTTGGAGGAAGATGAGACTCTGGCAGAACGCCTCCGTGCTTTGCGA
CCTGCTACATAA
Transcript >AgabiH97|069800
ATGAGCAATCTTGAAAAGACACTGTTCCAGCTTAAGTTCACGGCGAAGACACTAGGCCGTCAAGCAAAGAAAGCC
CAGAAAGACGAAAACACAGAAAAGGCGAGAGTAAAGAAGGCTCTGCAACAGGGAAACACTGAAGGGGCTCGGATA
TATGCCTCCAATGCTATCAGAAAGAAAAGTGAATCCCTTAATCTGCTCAGATTATCGAGTCGTCTCGACGCAGTG
GCAAGTCGAGTAGAGACTGCCGTGACTATGCGTCAAGTCACCGGCAACATGACGTCCGTCGTGCGGGGTATGGAT
AAAGCTATGGAGAGCATGAACCTTGAAAGGATATCGATGGTAATGGATAAGTTTGAGTCGCAATTTTCCGATCTC
GATGTCCAGACAGGGTACATGGAGGACGCAATGGGATCCACGACCGCTGTCTCGGCGCCACAAGATCAGATTGAC
ATGCTTTTACGCCAGACAGCAGAGGAAGCTAATATTGAACTCCAACACGACCTTGCTATTCAGGATGTAACAGCC
CTCGGTGCACCAAGCCCGAAAGAACGTGTTTTGGAGGAAGATGAGACTCTGGCAGAACGCCTCCGTGCTTTGCGA
CCTGCTACATAA
Gene >AgabiH97|069800
ATGAGCAATCTTGAAAGTGGGTGGTTCTATAAATTACGCTTATGGTATACTGACGTTGACTAGAGACACTGTTCC
AGCTTAAGGCAGGTTCTCAATCGTAACATCCTACCATGTCGTCATCTCATTAACATCGAACTCAGTTCACGGCGA
AGACACTAGGCCGTCAAGCAAAGAAAGCCCAGAAAGACGAAAACACAGAAAAGGCGAGAGTAAAGAAGGTGTGTT
GAACGATCCAACATATCATTTGGGTCGATCCTTAGATTCTGCTCGGTGTAGGCTCTGCAACAGGGAAACACTGAA
GGGGCTCGGATATATGCCTCCAATGCTATCAGAAAGAAAAGTGAATCCCTTAATCTGCTCAGATTATCGAGTCGT
CTCGACGCAGTGGCAAGTCGAGTAGAGACTGCCGTGACTATGCGTCAAGTCACCGGCAACATGACGTCCGTCGTG
CGGGGTATGGATAAAGCTATGGAGAGCATGAACCTTGAAAGGGTATGCCGAATGTATCATGCTCAAGAAAAGCCA
TCTTATCGTCATTTTAGATATCGATGGTAATGGATAAGTTTGAGTCGCAATTTTCCGATCTCGATGTCCAGACAG
GGTACATGGAGGACGCAATGGGATCCACGACCGCTGTCTCGGCGCCACAAGATCAGATTGACATGCTTTTACGCC
AGACAGCAGAGGAAGCTAATATTGAACTCCAACACGACCTTGCTATTCAGGATGTAACAGCCCTCGGTGCACCAA
GCCCGAAAGAACGTGTTTTGGAGGAAGATGAGACTCTGGCAGAACGCCTCCGTGCTTTGCGACCTGCTACATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail