Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069770
Gene name
Locationscaffold_4:1129791..1130820
Strand-
Gene length (bp)1029
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 8.5E-46 13 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4QQV8|CHMP5_RAT Charged multivesicular body protein 5 OS=Rattus norvegicus GN=Chmp5 PE=2 SV=1 1 200 3.0E-60
sp|Q9D7S9|CHMP5_MOUSE Charged multivesicular body protein 5 OS=Mus musculus GN=Chmp5 PE=1 SV=1 1 200 3.0E-60
sp|Q5RBR3|CHMP5_PONAB Charged multivesicular body protein 5 OS=Pongo abelii GN=CHMP5 PE=2 SV=1 1 200 1.0E-59
sp|Q9NZZ3|CHMP5_HUMAN Charged multivesicular body protein 5 OS=Homo sapiens GN=CHMP5 PE=1 SV=1 1 200 1.0E-59
sp|Q9VVI9|CHMP5_DROME Charged multivesicular body protein 5 OS=Drosophila melanogaster GN=Vps60 PE=1 SV=2 1 201 5.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4QQV8|CHMP5_RAT Charged multivesicular body protein 5 OS=Rattus norvegicus GN=Chmp5 PE=2 SV=1 1 200 3.0E-60
sp|Q9D7S9|CHMP5_MOUSE Charged multivesicular body protein 5 OS=Mus musculus GN=Chmp5 PE=1 SV=1 1 200 3.0E-60
sp|Q5RBR3|CHMP5_PONAB Charged multivesicular body protein 5 OS=Pongo abelii GN=CHMP5 PE=2 SV=1 1 200 1.0E-59
sp|Q9NZZ3|CHMP5_HUMAN Charged multivesicular body protein 5 OS=Homo sapiens GN=CHMP5 PE=1 SV=1 1 200 1.0E-59
sp|Q9VVI9|CHMP5_DROME Charged multivesicular body protein 5 OS=Drosophila melanogaster GN=Vps60 PE=1 SV=2 1 201 5.0E-58
sp|Q6DD52|CHMP5_XENLA Charged multivesicular body protein 5 OS=Xenopus laevis GN=chmp5 PE=2 SV=1 1 167 6.0E-58
sp|Q7T339|CHMP5_DANRE Charged multivesicular body protein 5 OS=Danio rerio GN=chmp5 PE=2 SV=1 1 197 1.0E-56
sp|Q5FW29|CHMP5_XENTR Charged multivesicular body protein 5 OS=Xenopus tropicalis GN=chmp5 PE=2 SV=1 1 167 1.0E-54
sp|Q54JK4|CHMP5_DICDI Charged multivesicular body protein 5 OS=Dictyostelium discoideum GN=chmp5 PE=3 SV=1 1 183 6.0E-43
sp|O74422|YQ56_SCHPO Uncharacterized protein C162.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.06c PE=3 SV=1 1 195 7.0E-42
sp|Q03390|VPS60_YEAST Vacuolar protein-sorting-associated protein 60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS60 PE=1 SV=2 1 197 4.0E-31
sp|Q8IL52|YSNF1_PLAF7 Uncharacterized protein PF14_0397 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0397 PE=3 SV=2 60 199 6.0E-12
sp|Q6BSH2|SNF7_DEBHA Vacuolar-sorting protein SNF7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SNF7 PE=3 SV=2 1 192 1.0E-07
sp|Q6IQ73|CHM4C_DANRE Charged multivesicular body protein 4c OS=Danio rerio GN=chmp4c PE=2 SV=1 36 160 3.0E-06
sp|A2VDY3|CHM4A_BOVIN Charged multivesicular body protein 4a OS=Bos taurus GN=CHMP4A PE=2 SV=1 1 160 5.0E-06
sp|Q5XGW6|CHM4B_XENLA Charged multivesicular body protein 4b OS=Xenopus laevis GN=chmp4b PE=2 SV=1 1 160 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069770
MNRIFGSSASKKPKPTLQDAITSTDSRMASIEVKVRKLDGELARYKDQMSKMRGGPGKEAIQQRALRTLKQKKMY
EGQLAQLTQQSFNMESAALTTENLRNTMATMDAMQTANKELKKQYGKIDIDKIENIHYDMEDLLEQANEVQEMLG
RSYAVPDELDEADLEAELEALALDEEEEGPSYLSDLNKVPDFVDEAPVETPEGPEKEAVRTTT*
Coding >AgabiH97|069770
ATGAACCGCATATTTGGCTCGTCCGCAAGCAAGAAACCCAAGCCAACACTCCAAGATGCCATTACATCGACAGAC
TCGCGTATGGCCTCTATAGAGGTGAAAGTGAGGAAGTTAGATGGTGAATTAGCGCGATACAAGGATCAAATGAGT
AAAATGCGTGGAGGACCTGGTAAAGAAGCAATTCAACAGCGTGCACTACGAACACTCAAACAGAAAAAGATGTAC
GAAGGTCAACTTGCGCAACTCACACAACAATCATTCAACATGGAGTCCGCTGCACTAACAACTGAGAACTTAAGA
AACACTATGGCAACCATGGACGCCATGCAGACTGCAAACAAAGAACTAAAGAAACAATATGGCAAGATTGATATT
GACAAGATCGAGAACATTCACTATGATATGGAAGATTTGCTTGAACAAGCGAATGAAGTTCAAGAAATGTTGGGA
CGGTCTTACGCTGTACCAGATGAACTTGACGAGGCTGACCTTGAAGCGGAGCTGGAGGCATTGGCTCTGGATGAG
GAGGAGGAAGGCCCATCTTATCTTTCGGACCTGAATAAAGTACCCGACTTCGTGGATGAAGCACCAGTGGAAACC
CCAGAGGGACCAGAGAAGGAGGCTGTTAGGACAACCACTTGA
Transcript >AgabiH97|069770
ATGAACCGCATATTTGGCTCGTCCGCAAGCAAGAAACCCAAGCCAACACTCCAAGATGCCATTACATCGACAGAC
TCGCGTATGGCCTCTATAGAGGTGAAAGTGAGGAAGTTAGATGGTGAATTAGCGCGATACAAGGATCAAATGAGT
AAAATGCGTGGAGGACCTGGTAAAGAAGCAATTCAACAGCGTGCACTACGAACACTCAAACAGAAAAAGATGTAC
GAAGGTCAACTTGCGCAACTCACACAACAATCATTCAACATGGAGTCCGCTGCACTAACAACTGAGAACTTAAGA
AACACTATGGCAACCATGGACGCCATGCAGACTGCAAACAAAGAACTAAAGAAACAATATGGCAAGATTGATATT
GACAAGATCGAGAACATTCACTATGATATGGAAGATTTGCTTGAACAAGCGAATGAAGTTCAAGAAATGTTGGGA
CGGTCTTACGCTGTACCAGATGAACTTGACGAGGCTGACCTTGAAGCGGAGCTGGAGGCATTGGCTCTGGATGAG
GAGGAGGAAGGCCCATCTTATCTTTCGGACCTGAATAAAGTACCCGACTTCGTGGATGAAGCACCAGTGGAAACC
CCAGAGGGACCAGAGAAGGAGGCTGTTAGGACAACCACTTGA
Gene >AgabiH97|069770
ATGAACCGCATATTTGGCTCGTCCGCAAGCAAGAAACCCAAGCCAACACTCCAAGATGCCATTACATCGGTCCGT
TATTTTCCAACATAACCGAATATTACACGGATACCCATAGACATCTCTATGTTCTCTCTACTTTCTCTTTTTCCC
TAGACAGACTCGCGTATGGCCTCTATAGAGGTGAAAGTGAGGAAGTTAGATGGTGAATTAGCGCGATACAAGGAT
CAAATGAGTAAAATGCGTGGAGGACCTGGTAAAGTGCGTATATCAAGTCTTCATATCCTCTCAATTGGACTTTTT
CTGATGTTCCACCGTCTCTCCTCCCGTGGCGTCAATCATCAATCTAATCGAAACTGAATGTCCGTATATGACAAA
CAAATAACTCTAGGAAGCAATTCAACAGCGTGCACTACGAACACTCAAACAGAAAAAGATGTACGAAGGTCAACT
TGCGCAACTCACACAACAATCATTCAACATGGAGTCCGCTGCACTAACAACTGAGAACTTAAGAAACACTATGGC
AACCATGGACGCCATGCAGACTGCAAACAAAGAACTAAAGAAACAATATGGCAAGATTGATATTGACAAGATCGA
GGTGCGTTTTAGAAACTTCTCGCTTCTATAGACTCTGCCATGGCTTATTCGTATCGGTCATGGGGTTAGAACATT
CACTATGATATGGAAGATTTGCTTGAACAAGCGAATGAAGTTCAAGAAATGTTGGGACGGTCTTACGCTGTACCA
GATGAACTTGACGAGGCTGACCTTGAAGCGGGTGAGCACCTTAGTACCATTTCAATGGAGTACTGTTGCTAAAAG
GTAACAGAGCTGGAGGCATTGGCTCTGGATGAGGAGGAGGAAGGCCCATCTTATCTTTCGGACCTGAATAAAGTA
CCCGACTTCGTGGATGAAGCACCAGTGGAAACCCCAGAGGTTAGTAATGATCACTTTCACCCTCGTTCGAACATG
AACTAACCGGTTAAGCAGGGACCAGAGAAGGAGGCTGTTAGGACAACCACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail