© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|069450 |
| Gene name | |
| Location | scaffold_4:1051148..1055678 |
| Strand | + |
| Gene length (bp) | 4530 |
| Transcript length (bp) | 4296 |
| Coding sequence length (bp) | 4296 |
| Protein length (aa) | 1432 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF13041 | PPR_2 | PPR repeat family | 4.1E-09 | 1098 | 1146 |
| PF01535 | PPR | PPR repeat | 1.6E-01 | 473 | 496 |
| PF01535 | PPR | PPR repeat | 3.1E-04 | 522 | 547 |
| PF01535 | PPR | PPR repeat | 3.2E-04 | 1102 | 1129 |
| PF01535 | PPR | PPR repeat | 1.2E-05 | 1135 | 1163 |
| PF01535 | PPR | PPR repeat | 4.1E-03 | 1324 | 1347 |
| PF13812 | PPR_3 | Pentatricopeptide repeat domain | 4.4E-11 | 1089 | 1144 |
| PF13812 | PPR_3 | Pentatricopeptide repeat domain | 3.3E-06 | 1156 | 1217 |
| PF17177 | PPR_long | Pentacotripeptide-repeat region of PRORP | 1.2E-14 | 1077 | 1214 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10451|PPR5_SCHPO | Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 | 983 | 1426 | 7.0E-65 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 1053 | 1350 | 2.0E-19 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 1053 | 1351 | 8.0E-19 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 956 | 1346 | 1.0E-18 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 1053 | 1346 | 2.0E-18 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10451|PPR5_SCHPO | Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 | 983 | 1426 | 7.0E-65 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 1053 | 1350 | 2.0E-19 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 1053 | 1351 | 8.0E-19 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 956 | 1346 | 1.0E-18 |
| sp|Q9LQ15|PPR95_ARATH | Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 | 1053 | 1346 | 2.0E-18 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 989 | 1387 | 3.0E-18 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 1044 | 1347 | 4.0E-18 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 1053 | 1344 | 1.0E-17 |
| sp|Q9FMD3|PP389_ARATH | Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 | 1037 | 1346 | 1.0E-16 |
| sp|Q9SFV9|PP218_ARATH | Pentatricopeptide repeat-containing protein At3g07290, mitochondrial OS=Arabidopsis thaliana GN=At3g07290 PE=2 SV=1 | 1034 | 1347 | 2.0E-16 |
| sp|Q9SH60|PP103_ARATH | Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 | 982 | 1411 | 2.0E-16 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 1053 | 1350 | 4.0E-16 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 1053 | 1346 | 7.0E-16 |
| sp|Q9ZQF1|PP152_ARATH | Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 | 1010 | 1409 | 2.0E-15 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 1033 | 1415 | 2.0E-15 |
| sp|Q9FMQ1|PP376_ARATH | Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 | 1026 | 1346 | 3.0E-15 |
| sp|Q8S9D1|PP395_ARATH | Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 | 1037 | 1360 | 4.0E-15 |
| sp|Q9C8T7|PP101_ARATH | Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 | 1053 | 1346 | 5.0E-15 |
| sp|Q9LPX2|PPR39_ARATH | Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 | 1056 | 1429 | 1.0E-14 |
| sp|Q9LYT2|PP287_ARATH | Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 | 1098 | 1346 | 1.0E-14 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 1047 | 1347 | 2.0E-14 |
| sp|Q9LW84|PP236_ARATH | Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 | 943 | 1346 | 2.0E-14 |
| sp|Q3ECK2|PPR92_ARATH | Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 | 1053 | 1346 | 2.0E-14 |
| sp|O80958|PP194_ARATH | Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 | 978 | 1348 | 4.0E-14 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 991 | 1346 | 6.0E-14 |
| sp|Q5G1S8|PP241_ARATH | Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 | 979 | 1347 | 7.0E-14 |
| sp|Q9S7Q2|PP124_ARATH | Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 | 1083 | 1348 | 7.0E-14 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 1047 | 1346 | 8.0E-14 |
| sp|Q9ZU27|PPR76_ARATH | Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 | 984 | 1234 | 8.0E-14 |
| sp|Q9LQ14|PPR96_ARATH | Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 | 956 | 1408 | 8.0E-14 |
| sp|Q9CAN6|PPR97_ARATH | Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 | 1053 | 1411 | 9.0E-14 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 989 | 1347 | 1.0E-13 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 961 | 1346 | 1.0E-13 |
| sp|Q9C9U0|PP118_ARATH | Pentatricopeptide repeat-containing protein At1g73710 OS=Arabidopsis thaliana GN=At1g73710 PE=2 SV=1 | 1033 | 1407 | 1.0E-13 |
| sp|Q9FVX2|PP129_ARATH | Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 | 1090 | 1347 | 1.0E-13 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 1034 | 1347 | 2.0E-13 |
| sp|Q9CAN0|PPR99_ARATH | Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 | 957 | 1346 | 2.0E-13 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 1042 | 1346 | 2.0E-13 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 1038 | 1329 | 2.0E-13 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 1044 | 1224 | 3.0E-13 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 1034 | 1346 | 3.0E-13 |
| sp|Q8S9D1|PP395_ARATH | Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 | 967 | 1347 | 4.0E-13 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 953 | 1213 | 4.0E-13 |
| sp|Q8L844|PP413_ARATH | Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 | 1089 | 1360 | 4.0E-13 |
| sp|Q9M316|PP292_ARATH | Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 | 959 | 1295 | 4.0E-13 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 1038 | 1346 | 4.0E-13 |
| sp|Q8S8P6|PP180_ARATH | Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 | 989 | 1421 | 4.0E-13 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 1079 | 1348 | 6.0E-13 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 944 | 1391 | 9.0E-13 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 1043 | 1350 | 9.0E-13 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 981 | 1411 | 1.0E-12 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 1042 | 1347 | 1.0E-12 |
| sp|Q6NKW7|PP164_ARATH | Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 | 1048 | 1367 | 1.0E-12 |
| sp|Q0WKV3|PPR36_ARATH | Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 | 1082 | 1407 | 1.0E-12 |
| sp|Q9FLL3|PP412_ARATH | Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 | 1047 | 1357 | 2.0E-12 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 1037 | 1412 | 2.0E-12 |
| sp|Q8GYP6|PPR49_ARATH | Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 | 1054 | 1316 | 2.0E-12 |
| sp|Q9T0D6|PP306_ARATH | Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 | 986 | 1348 | 2.0E-12 |
| sp|Q9LQ16|PPR94_ARATH | Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 | 981 | 1411 | 3.0E-12 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 1006 | 1214 | 3.0E-12 |
| sp|Q9CAM8|PP100_ARATH | Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 | 1053 | 1347 | 3.0E-12 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 1083 | 1339 | 3.0E-12 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 1050 | 1415 | 4.0E-12 |
| sp|Q9SR00|PP213_ARATH | Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 | 1052 | 1415 | 4.0E-12 |
| sp|Q9FRS4|PPR22_ARATH | Pentatricopeptide repeat-containing protein At1g08610 OS=Arabidopsis thaliana GN=At1g08610 PE=2 SV=1 | 1103 | 1348 | 5.0E-12 |
| sp|O82178|PP186_ARATH | Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 | 1066 | 1348 | 6.0E-12 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 1034 | 1425 | 7.0E-12 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 981 | 1255 | 7.0E-12 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 1082 | 1407 | 7.0E-12 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 1098 | 1412 | 7.0E-12 |
| sp|Q9FLL3|PP412_ARATH | Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 | 1041 | 1346 | 8.0E-12 |
| sp|Q9FKR3|PP404_ARATH | Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 | 1105 | 1349 | 9.0E-12 |
| sp|Q9FIT7|PP442_ARATH | Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 | 1029 | 1357 | 1.0E-11 |
| sp|Q9LFF1|PP281_ARATH | Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 | 972 | 1354 | 1.0E-11 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 1033 | 1347 | 1.0E-11 |
| sp|Q9SZ20|PP339_ARATH | Pentatricopeptide repeat-containing protein At4g26800 OS=Arabidopsis thaliana GN=At4g26800 PE=2 SV=2 | 1046 | 1346 | 1.0E-11 |
| sp|Q9LN22|PPR54_ARATH | Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 | 1000 | 1348 | 1.0E-11 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 1044 | 1215 | 1.0E-11 |
| sp|O81908|PPR2_ARATH | Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 | 1095 | 1348 | 1.0E-11 |
| sp|P0C8A0|PP275_ARATH | Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 | 981 | 1218 | 1.0E-11 |
| sp|Q9LFQ4|PP383_ARATH | Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 | 1086 | 1276 | 1.0E-11 |
| sp|Q9LUR2|PP238_ARATH | Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 | 1047 | 1346 | 1.0E-11 |
| sp|Q9C6S6|PPR67_ARATH | Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 | 951 | 1347 | 1.0E-11 |
| sp|Q9FKC3|PP424_ARATH | Pentatricopeptide repeat-containing protein At5g48730, chloroplastic OS=Arabidopsis thaliana GN=At5g48730 PE=2 SV=2 | 1091 | 1346 | 1.0E-11 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 981 | 1411 | 2.0E-11 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 1034 | 1346 | 2.0E-11 |
| sp|Q9LEQ7|PP382_ARATH | Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 | 1082 | 1358 | 2.0E-11 |
| sp|Q9LMY5|PPR41_ARATH | Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 | 959 | 1354 | 2.0E-11 |
| sp|Q9LR67|PPR9_ARATH | Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 | 979 | 1212 | 2.0E-11 |
| sp|Q3EAF8|PP294_ARATH | Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 | 1082 | 1358 | 2.0E-11 |
| sp|Q9FNL2|PP418_ARATH | Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 | 912 | 1276 | 3.0E-11 |
| sp|Q9LZP3|PP293_ARATH | Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 | 1082 | 1421 | 3.0E-11 |
| sp|Q9FIX3|PP407_ARATH | Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 | 1047 | 1348 | 3.0E-11 |
| sp|Q9S7R4|PP125_ARATH | Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 | 1083 | 1343 | 3.0E-11 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 968 | 1254 | 5.0E-11 |
| sp|Q9FGR7|PP426_ARATH | Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 | 890 | 1216 | 5.0E-11 |
| sp|Q9FIX3|PP407_ARATH | Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 | 960 | 1361 | 6.0E-11 |
| sp|Q9C9A2|PP112_ARATH | Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 | 1073 | 1409 | 7.0E-11 |
| sp|Q0WMY5|PP365_ARATH | Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 | 1055 | 1346 | 8.0E-11 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 1103 | 1409 | 8.0E-11 |
| sp|Q9CAN5|PPR98_ARATH | Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 | 1053 | 1425 | 9.0E-11 |
| sp|Q9S7Q2|PP124_ARATH | Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 | 981 | 1255 | 1.0E-10 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 1056 | 1347 | 1.0E-10 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 1034 | 1346 | 1.0E-10 |
| sp|Q9ZVX5|PP156_ARATH | Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 | 937 | 1344 | 1.0E-10 |
| sp|Q9LMH5|PPR42_ARATH | Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 | 1070 | 1347 | 1.0E-10 |
| sp|O49436|PP327_ARATH | Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 | 1033 | 1414 | 1.0E-10 |
| sp|Q9SSF9|PP123_ARATH | Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 | 1054 | 1317 | 1.0E-10 |
| sp|Q9SSR6|PPR78_ARATH | Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 | 980 | 1224 | 1.0E-10 |
| sp|Q8GZ63|PP397_ARATH | Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 | 1054 | 1360 | 1.0E-10 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 980 | 1298 | 2.0E-10 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 1034 | 1348 | 2.0E-10 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 1034 | 1215 | 2.0E-10 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 1036 | 1347 | 2.0E-10 |
| sp|Q0WKV3|PPR36_ARATH | Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 | 1006 | 1214 | 2.0E-10 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 1099 | 1346 | 2.0E-10 |
| sp|Q9FLD8|PP408_ARATH | Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 | 1056 | 1346 | 2.0E-10 |
| sp|Q9SAA6|PPR34_ARATH | Pentatricopeptide repeat-containing protein At1g11710, mitochondrial OS=Arabidopsis thaliana GN=At1g11710 PE=2 SV=1 | 1032 | 1426 | 2.0E-10 |
| sp|Q9C8T7|PP101_ARATH | Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 | 981 | 1411 | 3.0E-10 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 1058 | 1357 | 3.0E-10 |
| sp|Q9LMY5|PPR41_ARATH | Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 | 1039 | 1344 | 3.0E-10 |
| sp|Q9C9A2|PP112_ARATH | Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 | 1083 | 1356 | 4.0E-10 |
| sp|Q9SUD8|PP340_ARATH | Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 | 1042 | 1207 | 4.0E-10 |
| sp|P0C7R3|PP106_ARATH | Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 | 1059 | 1347 | 5.0E-10 |
| sp|Q5BIV3|PPR35_ARATH | Pentatricopeptide repeat-containing protein At1g11900 OS=Arabidopsis thaliana GN=At1g11900 PE=2 SV=1 | 1033 | 1276 | 5.0E-10 |
| sp|P0C896|PP209_ARATH | Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 | 983 | 1212 | 5.0E-10 |
| sp|Q0WKZ3|PP105_ARATH | Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 | 1098 | 1348 | 5.0E-10 |
| sp|Q9LS88|PP250_ARATH | Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana GN=At3g23020 PE=2 SV=1 | 1089 | 1347 | 5.0E-10 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 951 | 1227 | 5.0E-10 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 981 | 1348 | 5.0E-10 |
| sp|Q9ZU27|PPR76_ARATH | Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 | 1033 | 1215 | 6.0E-10 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 965 | 1293 | 6.0E-10 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 1049 | 1347 | 6.0E-10 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 1006 | 1214 | 7.0E-10 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 1042 | 1223 | 7.0E-10 |
| sp|Q9FLJ4|PP440_ARATH | Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 | 953 | 1216 | 7.0E-10 |
| sp|O04504|PPR27_ARATH | Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 | 1032 | 1254 | 7.0E-10 |
| sp|Q9ZU27|PPR76_ARATH | Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 | 1079 | 1346 | 8.0E-10 |
| sp|O49436|PP327_ARATH | Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 | 948 | 1271 | 1.0E-09 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 958 | 1268 | 1.0E-09 |
| sp|O04491|PPR26_ARATH | Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 | 970 | 1216 | 1.0E-09 |
| sp|P0C7Q7|PPR38_ARATH | Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 | 967 | 1214 | 2.0E-09 |
| sp|Q9LFC5|PP360_ARATH | Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 | 1033 | 1347 | 2.0E-09 |
| sp|O80958|PP194_ARATH | Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 | 1034 | 1406 | 2.0E-09 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 935 | 1344 | 2.0E-09 |
| sp|Q8S8P6|PP180_ARATH | Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 | 1111 | 1346 | 2.0E-09 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 1030 | 1428 | 2.0E-09 |
| sp|Q9M9X9|PPR18_ARATH | Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 | 976 | 1346 | 2.0E-09 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 940 | 1214 | 2.0E-09 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 1056 | 1348 | 2.0E-09 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 970 | 1302 | 2.0E-09 |
| sp|Q9MAG8|PPR79_ARATH | Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 | 1058 | 1215 | 2.0E-09 |
| sp|Q9SS83|PP220_ARATH | Pentatricopeptide repeat-containing protein At3g09040, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E88 PE=2 SV=1 | 1098 | 1348 | 2.0E-09 |
| sp|Q9SSR4|PPR77_ARATH | Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 | 989 | 1276 | 2.0E-09 |
| sp|O65567|PP342_ARATH | Pentatricopeptide repeat-containing protein At4g30825, chloroplastic OS=Arabidopsis thaliana GN=At4g30825 PE=2 SV=2 | 1091 | 1346 | 2.0E-09 |
| sp|Q9FXH1|PPR52_ARATH | Pentatricopeptide repeat-containing protein At1g19720 OS=Arabidopsis thaliana GN=DYW7 PE=2 SV=1 | 956 | 1415 | 2.0E-09 |
| sp|Q0WPZ6|PP158_ARATH | Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 | 1033 | 1346 | 3.0E-09 |
| sp|Q9SZ10|PP338_ARATH | Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 | 1030 | 1347 | 3.0E-09 |
| sp|Q9CAN6|PPR97_ARATH | Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 | 1036 | 1346 | 4.0E-09 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 980 | 1216 | 4.0E-09 |
| sp|Q9FNL2|PP418_ARATH | Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 | 1044 | 1347 | 4.0E-09 |
| sp|Q9FGR7|PP426_ARATH | Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 | 1026 | 1347 | 4.0E-09 |
| sp|Q8RWS8|PP199_ARATH | Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 | 1070 | 1412 | 4.0E-09 |
| sp|Q9S7R4|PP125_ARATH | Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 | 1054 | 1237 | 5.0E-09 |
| sp|Q9LN69|PPR50_ARATH | Putative pentatricopeptide repeat-containing protein At1g19290 OS=Arabidopsis thaliana GN=At1g19290 PE=3 SV=2 | 1102 | 1215 | 5.0E-09 |
| sp|P0C8Q3|PP326_ARATH | Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 | 1033 | 1388 | 5.0E-09 |
| sp|Q9SS81|PP221_ARATH | Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 | 1058 | 1346 | 6.0E-09 |
| sp|Q9CAN5|PPR98_ARATH | Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 | 977 | 1351 | 6.0E-09 |
| sp|Q8LK93|PP145_ARATH | Pentatricopeptide repeat-containing protein At2g02980, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H26 PE=2 SV=2 | 1102 | 1255 | 7.0E-09 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 1033 | 1425 | 8.0E-09 |
| sp|Q9ZUE9|PP149_ARATH | Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 | 1078 | 1346 | 8.0E-09 |
| sp|Q8RWS8|PP199_ARATH | Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 | 1050 | 1346 | 1.0E-08 |
| sp|Q9SAD9|PPR40_ARATH | Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 | 1105 | 1431 | 1.0E-08 |
| sp|Q9LYZ9|PP362_ARATH | Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 | 1068 | 1346 | 1.0E-08 |
| sp|Q9CA54|PP122_ARATH | Pentatricopeptide repeat-containing protein At1g74630 OS=Arabidopsis thaliana GN=PCMP-H71 PE=2 SV=1 | 1086 | 1220 | 1.0E-08 |
| sp|Q0WVK7|PPR12_ARATH | Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 | 1037 | 1346 | 2.0E-08 |
| sp|Q9FMQ1|PP376_ARATH | Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 | 989 | 1419 | 2.0E-08 |
| sp|Q8L844|PP413_ARATH | Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 | 1033 | 1346 | 2.0E-08 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 1058 | 1235 | 2.0E-08 |
| sp|Q9T0D6|PP306_ARATH | Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 | 1054 | 1410 | 2.0E-08 |
| sp|Q9FIX3|PP407_ARATH | Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 | 937 | 1347 | 2.0E-08 |
| sp|Q9LS88|PP250_ARATH | Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana GN=At3g23020 PE=2 SV=1 | 1032 | 1348 | 2.0E-08 |
| sp|O04504|PPR27_ARATH | Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 | 1042 | 1346 | 2.0E-08 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 1035 | 1350 | 2.0E-08 |
| sp|Q9LQQ1|PPR20_ARATH | Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 | 986 | 1223 | 2.0E-08 |
| sp|Q0WLC6|PP349_ARATH | Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana GN=MRL1 PE=2 SV=2 | 926 | 1215 | 2.0E-08 |
| sp|Q8GYM2|PP393_ARATH | Pentatricopeptide repeat-containing protein At5g18950 OS=Arabidopsis thaliana GN=At5g18950 PE=2 SV=2 | 963 | 1162 | 2.0E-08 |
| sp|Q9SHK2|PPR17_ARATH | Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 | 1036 | 1339 | 2.0E-08 |
| sp|Q9FH87|PP447_ARATH | Putative pentatricopeptide repeat-containing protein At5g65820 OS=Arabidopsis thaliana GN=At5g65820 PE=3 SV=1 | 1033 | 1218 | 2.0E-08 |
| sp|Q9LPX2|PPR39_ARATH | Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 | 1042 | 1223 | 3.0E-08 |
| sp|Q5G1S8|PP241_ARATH | Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 | 915 | 1254 | 3.0E-08 |
| sp|Q9FIX3|PP407_ARATH | Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 | 1058 | 1346 | 3.0E-08 |
| sp|Q9SV96|PP358_ARATH | Pentatricopeptide repeat-containing protein At4g39620, chloroplastic OS=Arabidopsis thaliana GN=EMB2453 PE=2 SV=1 | 1024 | 1346 | 3.0E-08 |
| sp|Q9ZUA2|PP141_ARATH | Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 | 1098 | 1339 | 3.0E-08 |
| sp|Q9SAK0|PP132_ARATH | Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana GN=EMB2217 PE=2 SV=1 | 1034 | 1224 | 3.0E-08 |
| sp|Q3E9F0|PP392_ARATH | Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 | 1061 | 1346 | 3.0E-08 |
| sp|Q9SXD8|PPR90_ARATH | Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 | 949 | 1178 | 4.0E-08 |
| sp|Q9CA58|PP120_ARATH | Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 | 989 | 1348 | 4.0E-08 |
| sp|Q9C9A2|PP112_ARATH | Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 | 1098 | 1327 | 4.0E-08 |
| sp|Q9LKU8|PP401_ARATH | Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 | 970 | 1236 | 4.0E-08 |
| sp|Q9C9A2|PP112_ARATH | Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 | 1056 | 1311 | 5.0E-08 |
| sp|Q66GP4|PP379_ARATH | Pentatricopeptide repeat-containing protein At5g13770, chloroplastic OS=Arabidopsis thaliana GN=At5g13770 PE=2 SV=1 | 888 | 1164 | 5.0E-08 |
| sp|Q9LS25|PP420_ARATH | Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 | 1042 | 1223 | 5.0E-08 |
| sp|Q9SSR6|PPR78_ARATH | Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 | 1032 | 1350 | 6.0E-08 |
| sp|Q9ZUA2|PP141_ARATH | Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 | 1102 | 1346 | 6.0E-08 |
| sp|P0C043|PP318_ARATH | Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1 | 1095 | 1347 | 7.0E-08 |
| sp|Q9LUJ4|PP248_ARATH | Pentatricopeptide repeat-containing protein At3g22670, mitochondrial OS=Arabidopsis thaliana GN=At3g22670 PE=2 SV=1 | 1102 | 1351 | 7.0E-08 |
| sp|Q56X05|PPR15_ARATH | Pentatricopeptide repeat-containing protein At1g06145 OS=Arabidopsis thaliana GN=EMB1444 PE=2 SV=2 | 1034 | 1181 | 7.0E-08 |
| sp|Q0WPZ6|PP158_ARATH | Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 | 1102 | 1352 | 8.0E-08 |
| sp|O04590|PPR88_ARATH | Pentatricopeptide repeat-containing protein At1g62260, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E10 PE=2 SV=1 | 1034 | 1415 | 8.0E-08 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 1059 | 1347 | 9.0E-08 |
| sp|Q9FNN7|PP371_ARATH | Pentatricopeptide repeat-containing protein At5g08510 OS=Arabidopsis thaliana GN=PCMP-E20 PE=2 SV=1 | 1016 | 1232 | 9.0E-08 |
| sp|O82380|PP175_ARATH | Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 | 1070 | 1346 | 9.0E-08 |
| sp|Q9C8T7|PP101_ARATH | Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 | 1036 | 1347 | 1.0E-07 |
| sp|Q9SIC9|PP178_ARATH | Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 | 1034 | 1223 | 1.0E-07 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 1030 | 1351 | 1.0E-07 |
| sp|Q9LR67|PPR9_ARATH | Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 | 1034 | 1346 | 1.0E-07 |
| sp|Q9FLJ4|PP440_ARATH | Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 | 1095 | 1359 | 1.0E-07 |
| sp|O64624|PP163_ARATH | Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 | 981 | 1215 | 1.0E-07 |
| sp|Q9LSQ2|PP239_ARATH | Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 | 1009 | 1346 | 1.0E-07 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 989 | 1212 | 2.0E-07 |
| sp|Q9ZQF1|PP152_ARATH | Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 | 970 | 1215 | 2.0E-07 |
| sp|Q9M316|PP292_ARATH | Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 | 970 | 1236 | 2.0E-07 |
| sp|Q9SZ52|PP344_ARATH | Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 | 1032 | 1346 | 2.0E-07 |
| sp|Q9FMF6|PP444_ARATH | Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 | 1102 | 1346 | 2.0E-07 |
| sp|Q3EDF8|PPR28_ARATH | Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 | 1107 | 1417 | 2.0E-07 |
| sp|Q9C6S6|PPR67_ARATH | Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 | 1037 | 1346 | 2.0E-07 |
| sp|Q9SI78|PPR93_ARATH | Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 | 1054 | 1409 | 2.0E-07 |
| sp|P0C043|PP318_ARATH | Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1 | 1102 | 1346 | 2.0E-07 |
| sp|O64624|PP163_ARATH | Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 | 984 | 1217 | 2.0E-07 |
| sp|Q9FM64|PP431_ARATH | Pentatricopeptide repeat-containing protein At5g55740, chloroplastic OS=Arabidopsis thaliana GN=CRR21 PE=2 SV=1 | 1095 | 1347 | 2.0E-07 |
| sp|Q9FNG8|PP366_ARATH | Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 | 1058 | 1346 | 2.0E-07 |
| sp|Q9LVD3|PP434_ARATH | Pentatricopeptide repeat-containing protein At5g57250, mitochondrial OS=Arabidopsis thaliana GN=At5g57250 PE=2 SV=2 | 1034 | 1358 | 2.0E-07 |
| sp|Q9SH60|PP103_ARATH | Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 | 1004 | 1214 | 3.0E-07 |
| sp|P0C7R3|PP106_ARATH | Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 | 970 | 1274 | 3.0E-07 |
| sp|Q9M907|PP217_ARATH | Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 | 967 | 1344 | 3.0E-07 |
| sp|Q9SSR4|PPR77_ARATH | Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 | 966 | 1216 | 3.0E-07 |
| sp|Q9SSR4|PPR77_ARATH | Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 | 989 | 1346 | 3.0E-07 |
| sp|Q9ZUE9|PP149_ARATH | Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 | 1094 | 1347 | 3.0E-07 |
| sp|Q9SHK2|PPR17_ARATH | Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 | 1083 | 1347 | 3.0E-07 |
| sp|Q9M8M3|PP136_ARATH | Pentatricopeptide repeat-containing protein At1g80550, mitochondrial OS=Arabidopsis thaliana GN=At1g80550 PE=2 SV=1 | 856 | 1222 | 3.0E-07 |
| sp|Q9SXD1|PPR91_ARATH | Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 | 346 | 639 | 4.0E-07 |
| sp|Q9SH26|PP102_ARATH | Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 | 1089 | 1347 | 4.0E-07 |
| sp|Q9CAM8|PP100_ARATH | Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 | 967 | 1178 | 4.0E-07 |
| sp|Q9S7R4|PP125_ARATH | Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 | 1051 | 1346 | 4.0E-07 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 1058 | 1346 | 4.0E-07 |
| sp|O04504|PPR27_ARATH | Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 | 986 | 1415 | 4.0E-07 |
| sp|Q8L6Y3|PP396_ARATH | Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 | 1101 | 1357 | 4.0E-07 |
| sp|Q9M302|PP270_ARATH | Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 | 1032 | 1271 | 4.0E-07 |
| sp|Q9LVA2|PP443_ARATH | Pentatricopeptide repeat-containing protein At5g62370 OS=Arabidopsis thaliana GN=At5g62370 PE=2 SV=1 | 1054 | 1346 | 4.0E-07 |
| sp|Q0WVV0|PPR31_ARATH | Pentatricopeptide repeat-containing protein At1g10910, chloroplastic OS=Arabidopsis thaliana GN=At1g10910 PE=2 SV=1 | 1088 | 1346 | 4.0E-07 |
| sp|Q9FLZ9|PP405_ARATH | Pentatricopeptide repeat-containing protein At5g39350 OS=Arabidopsis thaliana GN=PCMP-E16 PE=2 SV=1 | 1032 | 1282 | 4.0E-07 |
| sp|O04491|PPR26_ARATH | Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 | 1033 | 1346 | 5.0E-07 |
| sp|Q9FX24|PPR71_ARATH | Pentatricopeptide repeat-containing protein At1g34160 OS=Arabidopsis thaliana GN=PCMP-H68 PE=2 SV=2 | 1102 | 1215 | 5.0E-07 |
| sp|Q9ZUU3|PP190_ARATH | Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana GN=At2g37230 PE=2 SV=1 | 1105 | 1347 | 5.0E-07 |
| sp|Q9SUD8|PP340_ARATH | Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 | 1054 | 1417 | 6.0E-07 |
| sp|Q9M302|PP270_ARATH | Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 | 946 | 1347 | 6.0E-07 |
| sp|P93011|PP182_ARATH | Pentatricopeptide repeat-containing protein At2g33760 OS=Arabidopsis thaliana GN=PCMP-H6 PE=3 SV=1 | 1100 | 1406 | 6.0E-07 |
| sp|Q6NQ83|PP247_ARATH | Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 | 1042 | 1223 | 7.0E-07 |
| sp|Q9ASZ8|PPR37_ARATH | Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 | 1084 | 1419 | 7.0E-07 |
| sp|Q9LMH5|PPR42_ARATH | Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 | 1006 | 1348 | 7.0E-07 |
| sp|Q9SF38|PP222_ARATH | Pentatricopeptide repeat-containing protein At3g09650, chloroplastic OS=Arabidopsis thaliana GN=HCF152 PE=2 SV=1 | 979 | 1238 | 7.0E-07 |
| sp|Q9FIX3|PP407_ARATH | Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 | 980 | 1274 | 8.0E-07 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 1034 | 1392 | 8.0E-07 |
| sp|Q9C6S6|PPR67_ARATH | Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 | 981 | 1358 | 9.0E-07 |
| sp|Q9LSL9|PP445_ARATH | Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 | 1054 | 1410 | 1.0E-06 |
| sp|Q76C99|RF1_ORYSI | Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 | 956 | 1213 | 1.0E-06 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 1105 | 1346 | 1.0E-06 |
| sp|Q9FKR3|PP404_ARATH | Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 | 1045 | 1346 | 1.0E-06 |
| sp|Q9LR67|PPR9_ARATH | Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 | 1037 | 1213 | 1.0E-06 |
| sp|Q9S7R4|PP125_ARATH | Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 | 1042 | 1215 | 1.0E-06 |
| sp|P0C8Q3|PP326_ARATH | Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 | 1034 | 1216 | 1.0E-06 |
| sp|Q9LYZ9|PP362_ARATH | Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 | 1052 | 1220 | 1.0E-06 |
| sp|P0C7Q9|PPR56_ARATH | Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 | 1103 | 1415 | 1.0E-06 |
| sp|O23337|PP311_ARATH | Pentatricopeptide repeat-containing protein At4g14820 OS=Arabidopsis thaliana GN=PCMP-H3 PE=2 SV=1 | 1033 | 1188 | 1.0E-06 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 1118 | 1347 | 2.0E-06 |
| sp|Q9LS88|PP250_ARATH | Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana GN=At3g23020 PE=2 SV=1 | 842 | 1363 | 2.0E-06 |
| sp|Q9SV46|PP282_ARATH | Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 | 956 | 1215 | 2.0E-06 |
| sp|Q9FXH1|PPR52_ARATH | Pentatricopeptide repeat-containing protein At1g19720 OS=Arabidopsis thaliana GN=DYW7 PE=2 SV=1 | 1088 | 1348 | 2.0E-06 |
| sp|Q9LVD3|PP434_ARATH | Pentatricopeptide repeat-containing protein At5g57250, mitochondrial OS=Arabidopsis thaliana GN=At5g57250 PE=2 SV=2 | 1083 | 1264 | 2.0E-06 |
| sp|Q9FMA1|PP433_ARATH | Pentatricopeptide repeat-containing protein At5g56310 OS=Arabidopsis thaliana GN=PCMP-E13 PE=2 SV=1 | 1098 | 1188 | 2.0E-06 |
| sp|Q9FI80|PP425_ARATH | Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 | 1099 | 1347 | 2.0E-06 |
| sp|Q3ECH5|PP107_ARATH | Pentatricopeptide repeat-containing protein At1g66345, mitochondrial OS=Arabidopsis thaliana GN=At1g66345 PE=3 SV=1 | 1032 | 1164 | 2.0E-06 |
| sp|Q9LVA2|PP443_ARATH | Pentatricopeptide repeat-containing protein At5g62370 OS=Arabidopsis thaliana GN=At5g62370 PE=2 SV=1 | 981 | 1347 | 3.0E-06 |
| sp|O81028|PP171_ARATH | Pentatricopeptide repeat-containing protein At2g26790, mitochondrial OS=Arabidopsis thaliana GN=At2g26790 PE=3 SV=1 | 1116 | 1221 | 3.0E-06 |
| sp|P0C8Q7|PP369_ARATH | Pentatricopeptide repeat-containing protein At5g08305 OS=Arabidopsis thaliana GN=PCMP-E105 PE=2 SV=1 | 934 | 1314 | 3.0E-06 |
| sp|P0C894|PP143_ARATH | Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 | 1032 | 1403 | 4.0E-06 |
| sp|Q940A6|PP325_ARATH | Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 | 1088 | 1343 | 4.0E-06 |
| sp|P0C8Q3|PP326_ARATH | Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 | 1083 | 1389 | 4.0E-06 |
| sp|Q9FNG8|PP366_ARATH | Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 | 1102 | 1344 | 4.0E-06 |
| sp|P0C7Q9|PPR56_ARATH | Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 | 1042 | 1339 | 4.0E-06 |
| sp|Q8LPS6|PPR3_ARATH | Pentatricopeptide repeat-containing protein At1g02150 OS=Arabidopsis thaliana GN=At1g02150 PE=2 SV=2 | 1056 | 1276 | 4.0E-06 |
| sp|Q9FI49|PP428_ARATH | Pentatricopeptide repeat-containing protein At5g50990 OS=Arabidopsis thaliana GN=PCMP-H59 PE=2 SV=2 | 1037 | 1179 | 4.0E-06 |
| sp|Q9SX45|PPR75_ARATH | Pentatricopeptide repeat-containing protein At1g50270 OS=Arabidopsis thaliana GN=PCMP-E42 PE=2 SV=1 | 1086 | 1180 | 4.0E-06 |
| sp|A3KPF8|PP131_ARATH | Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 | 951 | 1346 | 4.0E-06 |
| sp|Q9FRS4|PPR22_ARATH | Pentatricopeptide repeat-containing protein At1g08610 OS=Arabidopsis thaliana GN=At1g08610 PE=2 SV=1 | 1042 | 1287 | 5.0E-06 |
| sp|Q9FLD8|PP408_ARATH | Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 | 958 | 1357 | 5.0E-06 |
| sp|Q9FJE6|PP437_ARATH | Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 | 1103 | 1348 | 5.0E-06 |
| sp|O04491|PPR26_ARATH | Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 | 1021 | 1339 | 5.0E-06 |
| sp|Q9LYZ9|PP362_ARATH | Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 | 1115 | 1348 | 5.0E-06 |
| sp|Q9FZ24|PPR4_ARATH | Pentatricopeptide repeat-containing protein At1g02370, mitochondrial OS=Arabidopsis thaliana GN=At1g02370 PE=2 SV=1 | 1136 | 1278 | 5.0E-06 |
| sp|Q1PFA6|PP144_ARATH | Pentatricopeptide repeat-containing protein At2g02750 OS=Arabidopsis thaliana GN=PCMP-E22 PE=2 SV=2 | 1101 | 1188 | 5.0E-06 |
| sp|Q9SJZ3|PP169_ARATH | Pentatricopeptide repeat-containing protein At2g22410, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E28 PE=2 SV=1 | 1037 | 1179 | 5.0E-06 |
| sp|Q9LVQ5|PP432_ARATH | Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 | 1118 | 1346 | 6.0E-06 |
| sp|Q1PFQ9|PPR62_ARATH | Pentatricopeptide repeat-containing protein At1g28690, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E34 PE=2 SV=2 | 1088 | 1179 | 6.0E-06 |
| sp|Q9LXF2|PP385_ARATH | Pentatricopeptide repeat-containing protein At5g15300 OS=Arabidopsis thaliana GN=PCMP-E40 PE=2 SV=2 | 1033 | 1220 | 6.0E-06 |
| sp|Q9FMU2|PP380_ARATH | Pentatricopeptide repeat-containing protein At5g14080 OS=Arabidopsis thaliana GN=At5g14080 PE=2 SV=2 | 1043 | 1239 | 6.0E-06 |
| sp|Q9FVX2|PP129_ARATH | Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 | 945 | 1215 | 7.0E-06 |
| sp|Q56XR6|PP421_ARATH | Pentatricopeptide repeat-containing protein At5g46680 OS=Arabidopsis thaliana GN=At5g46680 PE=2 SV=2 | 1098 | 1347 | 7.0E-06 |
| sp|Q9LER0|PP381_ARATH | Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 | 1082 | 1295 | 7.0E-06 |
| sp|Q9SAH2|PP137_ARATH | Pentatricopeptide repeat-containing protein At1g80880, mitochondrial OS=Arabidopsis thaliana GN=At1g80880 PE=2 SV=1 | 978 | 1213 | 7.0E-06 |
| sp|P0C8R0|PP416_ARATH | Putative pentatricopeptide repeat-containing protein At5g43820 OS=Arabidopsis thaliana GN=At5g43820 PE=3 SV=1 | 1034 | 1213 | 7.0E-06 |
| sp|A3KPF8|PP131_ARATH | Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 | 1096 | 1428 | 8.0E-06 |
| sp|Q7X6A5|PPR81_ARATH | Pentatricopeptide repeat-containing protein At1g55630 OS=Arabidopsis thaliana GN=At1g55630 PE=2 SV=1 | 1041 | 1252 | 9.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 19 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|069450 MLPKVATHLFHTTSRVAAQAVHRNVLQQTGHSTGSNLGTWNGPSSSNWGGQGTGTGNSKHNTGSSRYYSFSTAGR AVSQANAVSANVDGSFASDENDEPTSRRVVVISSSSQSKRARIRSSSATLTNAESLGVLKALQLRRRSRFLHTSI EAVALSQPALIQSSPSRPRRNSTSSSDGLDRPSSPVRTFTTATAVAPEAQDKEQLLRPRRNSTSSIDDRDKLAFD SFQSVLDEELSIQSGNSASSIDDHELNDVSSIETKLTTPSGSPEAPLSDSPPSRSSASTYPFEYLIEARLSSDPH RVAEAVARFRSTAQSPQTVDFNNALDAMYATRRSEPLHAILEVYQDMISRSIQPDERTFSILIQSAVDRDHELGH GIRGMTQLMHRQGITGGGIDNRVHMGLQYKLESYSSEYRENFATVLSLYYAARVNSFFFSPELYLELIRTTSRHS NIELAEEIFRLAQERCGHLQPYCYRYMIQGYGRAGDAVAAERVFEQYNVAAREGRLSVDDHTLGYQRSHILVWNA MIESYFLCGLPDKAVGILDKMMNSPADLGFGIEDVPYPASSTYTEILKGFVEAGDITTAWRWYERLSEQGVKTEN HFWPATQPIKPDGRADILMIAALAERGYISELNKIFSSIDHTYKDLQTAPLLTYKANMAALKNIESEVHAKRILN FLTMEVFPRTLKLVVRKVMIIRIVMEYVDRNMFEDALASYKHFHELMLQDIKVNEESQYSPLSLTMTLQEAFSRI QGPMWKLLVERKRLNWDFAMQLMACGRDLGIEVPTAMQKHVLHVYALARANNELPVEMMTTKVWEQLLMIAVDVE SASFASPTLSAREYKDVLGYAFEGVQSLVEDMAKLQVHIEELPSSLMNKTIRHLISVYGGDNVVRTLQKLGPAFE RALEDSEEIRTLVVEQKLENVPENVINNEFTQRLLQSYGNLVVDPAQCKALDDLLRQNNIRSNVLAAYNMLKNGF DNRHVPSPKVIGKLIQGLGRQGEVEMLNEVYAIAQTILDGLMLDAEESRRGQYFIEDNMVIALAHLGDMDSAHNF RMRILEKGYAPSADAYGALILHLKDTTDDASNALGLYFEAQQHKVKMNIYFYNNIISKLAKARKADHALELFQRM KAERILPSSITYGALIGACARVGDVQSAETLFEEMESRRNFRPRVPPYNTMMQLYTMTKPNRERVLHYFDKMYQA GVNPTAHTYKLLLDAYGSIEPVDIPSMEAIFEQLQGDRDVDVQGTHYASLINAYGCIQRDLEKALSIFDSVPSSS TPNQHSVLDAVVFESLVNVFVSHRRTDLIPEYINKMIGLGIHMTAYIANFLIKGYAITGELEKAREIFESMVDPP MGVAAPNNHAPHTPNAGNAIGSMEPVYREPSTWEAMVRAELGAGHRDLALDLLERLKSRQYPEAVYNRISGVLVD HSTLPA* |
| Coding | >AgabiH97|069450 ATGCTCCCAAAAGTCGCGACACATCTCTTCCACACAACCTCTAGGGTAGCCGCTCAGGCTGTCCATCGCAACGTC CTCCAACAGACCGGCCACTCGACCGGCTCAAATCTCGGGACCTGGAACGGTCCCTCGAGCTCGAATTGGGGCGGC CAAGGCACTGGCACAGGAAACTCTAAGCATAACACTGGTAGCAGTCGCTACTACTCTTTCAGCACTGCAGGAAGA GCGGTCTCGCAGGCCAACGCAGTCTCTGCCAATGTCGACGGTTCGTTCGCCTCGGACGAAAATGACGAGCCCACG TCACGTCGCGTCGTCGTAATTTCATCATCATCTCAATCAAAGCGAGCTCGGATACGCAGCTCGAGTGCAACATTA ACAAATGCGGAATCGTTAGGCGTTCTCAAGGCTCTGCAGCTTCGTAGGCGTTCGCGGTTCTTACATACGTCGATA GAAGCTGTAGCGCTGTCTCAACCTGCACTCATACAGTCATCACCTTCACGACCTCGACGCAATTCTACTTCTTCT TCTGATGGCTTGGATCGACCGTCTTCGCCTGTGCGAACTTTCACCACTGCTACAGCTGTTGCACCAGAGGCACAG GATAAGGAGCAGCTCCTTCGTCCCCGCCGGAATTCCACATCTTCCATTGATGACCGAGACAAATTAGCGTTCGAC TCTTTCCAATCTGTCCTCGACGAGGAGCTTTCGATTCAATCAGGAAACTCAGCGTCGTCCATCGACGACCACGAG CTCAACGATGTTTCTTCTATCGAAACAAAACTTACAACACCATCCGGATCCCCCGAGGCCCCTCTGTCCGATTCC CCACCCTCTCGTTCTTCTGCTTCAACTTATCCGTTCGAGTATCTCATCGAAGCTAGACTGTCTAGTGATCCCCAT CGTGTTGCCGAAGCCGTCGCTCGCTTCCGTTCGACTGCTCAGTCCCCCCAAACTGTGGATTTTAACAATGCCCTC GATGCTATGTATGCTACTCGTAGATCAGAACCCCTGCACGCCATTCTTGAGGTCTACCAGGATATGATCAGTCGC TCCATCCAGCCCGATGAAAGAACCTTTTCCATCCTCATCCAAAGTGCGGTGGACCGCGATCATGAGTTGGGCCAT GGGATCAGAGGCATGACTCAGCTTATGCACCGCCAAGGTATCACTGGGGGTGGCATTGACAACAGAGTGCACATG GGTTTACAGTACAAACTCGAATCGTACTCTTCTGAATACAGGGAAAATTTTGCAACGGTTTTGTCGCTGTACTAT GCTGCTCGCGTCAATAGTTTCTTCTTCTCACCCGAGCTCTACCTCGAGTTGATCCGTACAACCTCCCGTCACTCC AACATTGAACTTGCAGAGGAGATATTTCGGCTCGCCCAAGAGAGATGTGGGCATTTACAACCGTATTGCTACCGG TATATGATTCAGGGCTATGGTCGCGCGGGTGACGCGGTTGCTGCGGAAAGGGTTTTCGAACAGTACAATGTTGCT GCGCGAGAAGGAAGGCTCTCAGTTGATGATCATACTCTCGGTTATCAAAGGAGCCATATCCTCGTTTGGAATGCC ATGATCGAGTCGTATTTCCTTTGCGGTCTACCGGACAAGGCGGTTGGTATTTTGGACAAGATGATGAATTCACCC GCGGATCTTGGCTTCGGAATCGAGGATGTCCCATATCCTGCATCATCTACCTACACCGAAATATTGAAGGGTTTC GTCGAAGCCGGTGATATCACTACTGCGTGGAGGTGGTACGAGAGGTTATCGGAACAAGGTGTCAAGACAGAAAAT CATTTTTGGCCGGCAACGCAACCTATCAAACCGGATGGAAGAGCCGATATTCTTATGATTGCAGCTTTGGCCGAG CGCGGATACATATCCGAACTCAACAAGATCTTTTCCTCCATCGATCACACTTACAAAGACTTGCAAACCGCTCCA CTGCTCACTTATAAAGCCAACATGGCGGCTCTGAAGAACATCGAATCCGAAGTACATGCAAAGAGGATCTTGAAC TTTTTGACCATGGAAGTTTTTCCGCGTACCCTGAAGTTGGTTGTAAGGAAGGTTATGATCATCCGGATTGTTATG GAATATGTGGACAGGAATATGTTCGAAGATGCTCTGGCTTCGTATAAGCATTTTCACGAGTTGATGTTGCAAGAT ATCAAGGTTAACGAGGAGAGCCAATATTCGCCGCTGTCCTTGACAATGACTTTGCAAGAAGCGTTTAGCAGGATC CAAGGACCTATGTGGAAGCTACTGGTGGAGAGGAAAAGGTTGAATTGGGATTTCGCTATGCAGTTGATGGCGTGC GGTAGGGATTTGGGTATCGAGGTGCCGACGGCTATGCAGAAACATGTGTTACATGTGTATGCTCTCGCTAGGGCT AACAATGAGTTGCCGGTTGAGATGATGACGACGAAGGTTTGGGAACAGCTGTTGATGATCGCCGTAGATGTGGAA AGTGCCTCCTTTGCTTCGCCGACGTTGTCCGCTCGAGAATACAAAGACGTCCTTGGATACGCTTTTGAGGGCGTA CAGAGTCTCGTCGAGGATATGGCCAAGCTTCAAGTTCATATCGAGGAACTTCCATCGAGTTTGATGAACAAGACC ATCCGTCATCTCATATCGGTTTACGGTGGCGATAACGTCGTTCGTACTCTCCAGAAACTCGGTCCCGCTTTTGAA CGCGCATTGGAAGACAGTGAAGAGATTAGAACCCTGGTTGTCGAGCAGAAATTGGAAAACGTTCCCGAAAACGTT ATCAATAATGAATTCACGCAAAGGTTGCTGCAGTCTTACGGTAATCTCGTCGTCGACCCGGCTCAATGCAAAGCT CTTGACGACTTGTTGAGACAAAACAATATTCGCAGCAATGTTCTAGCTGCTTATAATATGTTGAAGAACGGCTTT GATAATCGCCATGTTCCTTCTCCGAAAGTTATTGGGAAGTTGATCCAGGGTTTGGGAAGGCAAGGGGAGGTCGAA ATGTTGAACGAGGTCTATGCGATTGCGCAGACGATTCTGGATGGATTGATGTTGGATGCGGAGGAGTCGAGAAGG GGTCAATATTTCATCGAGGATAATATGGTTATCGCTCTGGCTCATCTTGGAGATATGGACAGTGCGCATAATTTC AGGATGAGGATACTAGAAAAAGGATATGCTCCTTCGGCCGACGCTTATGGCGCTCTTATCCTTCATCTCAAAGAC ACTACCGACGATGCTTCAAACGCTCTGGGTTTATACTTTGAAGCTCAGCAGCATAAAGTCAAAATGAACATCTAT TTCTACAACAACATCATTTCGAAGCTCGCTAAAGCGCGTAAAGCTGATCATGCTTTGGAACTATTTCAAAGAATG AAAGCGGAGCGTATTTTACCTAGCTCGATTACTTATGGTGCCTTAATCGGTGCTTGTGCTAGAGTTGGAGATGTT CAAAGTGCGGAGACTTTGTTCGAGGAGATGGAGTCGCGCAGGAATTTCAGACCGAGGGTTCCGCCGTATAATACG ATGATGCAACTCTATACGATGACGAAACCGAATAGGGAGAGAGTACTCCATTACTTCGATAAGATGTATCAAGCT GGAGTCAACCCTACGGCCCATACTTACAAGTTGTTGCTTGATGCTTATGGATCTATCGAGCCGGTCGACATTCCT TCGATGGAAGCCATCTTTGAACAACTCCAAGGAGATCGCGATGTCGACGTTCAGGGAACCCATTATGCTTCCCTT ATCAATGCCTACGGTTGTATTCAACGCGATTTAGAAAAAGCCCTCTCAATATTCGATTCCGTCCCATCCTCTTCG ACACCAAACCAACATTCTGTTCTAGACGCTGTTGTGTTCGAATCTCTCGTCAACGTCTTTGTATCTCATCGTCGT ACGGATCTCATACCCGAGTATATCAACAAGATGATTGGTTTGGGTATTCATATGACCGCATATATTGCCAATTTT TTGATCAAAGGTTATGCGATTACCGGAGAATTGGAGAAGGCGAGGGAGATCTTTGAGAGCATGGTTGATCCTCCC ATGGGAGTTGCTGCTCCGAATAATCATGCTCCTCATACTCCTAATGCTGGGAATGCCATCGGGTCTATGGAACCG GTTTATCGTGAGCCCTCGACTTGGGAAGCTATGGTTAGAGCTGAACTTGGTGCTGGTCATCGTGATCTTGCATTG GATTTATTAGAGAGGTTGAAATCTCGACAATACCCTGAAGCGGTGTATAACCGTATTAGTGGTGTCTTGGTTGAT CACTCAACGTTACCCGCATAG |
| Transcript | >AgabiH97|069450 ATGCTCCCAAAAGTCGCGACACATCTCTTCCACACAACCTCTAGGGTAGCCGCTCAGGCTGTCCATCGCAACGTC CTCCAACAGACCGGCCACTCGACCGGCTCAAATCTCGGGACCTGGAACGGTCCCTCGAGCTCGAATTGGGGCGGC CAAGGCACTGGCACAGGAAACTCTAAGCATAACACTGGTAGCAGTCGCTACTACTCTTTCAGCACTGCAGGAAGA GCGGTCTCGCAGGCCAACGCAGTCTCTGCCAATGTCGACGGTTCGTTCGCCTCGGACGAAAATGACGAGCCCACG TCACGTCGCGTCGTCGTAATTTCATCATCATCTCAATCAAAGCGAGCTCGGATACGCAGCTCGAGTGCAACATTA ACAAATGCGGAATCGTTAGGCGTTCTCAAGGCTCTGCAGCTTCGTAGGCGTTCGCGGTTCTTACATACGTCGATA GAAGCTGTAGCGCTGTCTCAACCTGCACTCATACAGTCATCACCTTCACGACCTCGACGCAATTCTACTTCTTCT TCTGATGGCTTGGATCGACCGTCTTCGCCTGTGCGAACTTTCACCACTGCTACAGCTGTTGCACCAGAGGCACAG GATAAGGAGCAGCTCCTTCGTCCCCGCCGGAATTCCACATCTTCCATTGATGACCGAGACAAATTAGCGTTCGAC TCTTTCCAATCTGTCCTCGACGAGGAGCTTTCGATTCAATCAGGAAACTCAGCGTCGTCCATCGACGACCACGAG CTCAACGATGTTTCTTCTATCGAAACAAAACTTACAACACCATCCGGATCCCCCGAGGCCCCTCTGTCCGATTCC CCACCCTCTCGTTCTTCTGCTTCAACTTATCCGTTCGAGTATCTCATCGAAGCTAGACTGTCTAGTGATCCCCAT CGTGTTGCCGAAGCCGTCGCTCGCTTCCGTTCGACTGCTCAGTCCCCCCAAACTGTGGATTTTAACAATGCCCTC GATGCTATGTATGCTACTCGTAGATCAGAACCCCTGCACGCCATTCTTGAGGTCTACCAGGATATGATCAGTCGC TCCATCCAGCCCGATGAAAGAACCTTTTCCATCCTCATCCAAAGTGCGGTGGACCGCGATCATGAGTTGGGCCAT GGGATCAGAGGCATGACTCAGCTTATGCACCGCCAAGGTATCACTGGGGGTGGCATTGACAACAGAGTGCACATG GGTTTACAGTACAAACTCGAATCGTACTCTTCTGAATACAGGGAAAATTTTGCAACGGTTTTGTCGCTGTACTAT GCTGCTCGCGTCAATAGTTTCTTCTTCTCACCCGAGCTCTACCTCGAGTTGATCCGTACAACCTCCCGTCACTCC AACATTGAACTTGCAGAGGAGATATTTCGGCTCGCCCAAGAGAGATGTGGGCATTTACAACCGTATTGCTACCGG TATATGATTCAGGGCTATGGTCGCGCGGGTGACGCGGTTGCTGCGGAAAGGGTTTTCGAACAGTACAATGTTGCT GCGCGAGAAGGAAGGCTCTCAGTTGATGATCATACTCTCGGTTATCAAAGGAGCCATATCCTCGTTTGGAATGCC ATGATCGAGTCGTATTTCCTTTGCGGTCTACCGGACAAGGCGGTTGGTATTTTGGACAAGATGATGAATTCACCC GCGGATCTTGGCTTCGGAATCGAGGATGTCCCATATCCTGCATCATCTACCTACACCGAAATATTGAAGGGTTTC GTCGAAGCCGGTGATATCACTACTGCGTGGAGGTGGTACGAGAGGTTATCGGAACAAGGTGTCAAGACAGAAAAT CATTTTTGGCCGGCAACGCAACCTATCAAACCGGATGGAAGAGCCGATATTCTTATGATTGCAGCTTTGGCCGAG CGCGGATACATATCCGAACTCAACAAGATCTTTTCCTCCATCGATCACACTTACAAAGACTTGCAAACCGCTCCA CTGCTCACTTATAAAGCCAACATGGCGGCTCTGAAGAACATCGAATCCGAAGTACATGCAAAGAGGATCTTGAAC TTTTTGACCATGGAAGTTTTTCCGCGTACCCTGAAGTTGGTTGTAAGGAAGGTTATGATCATCCGGATTGTTATG GAATATGTGGACAGGAATATGTTCGAAGATGCTCTGGCTTCGTATAAGCATTTTCACGAGTTGATGTTGCAAGAT ATCAAGGTTAACGAGGAGAGCCAATATTCGCCGCTGTCCTTGACAATGACTTTGCAAGAAGCGTTTAGCAGGATC CAAGGACCTATGTGGAAGCTACTGGTGGAGAGGAAAAGGTTGAATTGGGATTTCGCTATGCAGTTGATGGCGTGC GGTAGGGATTTGGGTATCGAGGTGCCGACGGCTATGCAGAAACATGTGTTACATGTGTATGCTCTCGCTAGGGCT AACAATGAGTTGCCGGTTGAGATGATGACGACGAAGGTTTGGGAACAGCTGTTGATGATCGCCGTAGATGTGGAA AGTGCCTCCTTTGCTTCGCCGACGTTGTCCGCTCGAGAATACAAAGACGTCCTTGGATACGCTTTTGAGGGCGTA CAGAGTCTCGTCGAGGATATGGCCAAGCTTCAAGTTCATATCGAGGAACTTCCATCGAGTTTGATGAACAAGACC ATCCGTCATCTCATATCGGTTTACGGTGGCGATAACGTCGTTCGTACTCTCCAGAAACTCGGTCCCGCTTTTGAA CGCGCATTGGAAGACAGTGAAGAGATTAGAACCCTGGTTGTCGAGCAGAAATTGGAAAACGTTCCCGAAAACGTT ATCAATAATGAATTCACGCAAAGGTTGCTGCAGTCTTACGGTAATCTCGTCGTCGACCCGGCTCAATGCAAAGCT CTTGACGACTTGTTGAGACAAAACAATATTCGCAGCAATGTTCTAGCTGCTTATAATATGTTGAAGAACGGCTTT GATAATCGCCATGTTCCTTCTCCGAAAGTTATTGGGAAGTTGATCCAGGGTTTGGGAAGGCAAGGGGAGGTCGAA ATGTTGAACGAGGTCTATGCGATTGCGCAGACGATTCTGGATGGATTGATGTTGGATGCGGAGGAGTCGAGAAGG GGTCAATATTTCATCGAGGATAATATGGTTATCGCTCTGGCTCATCTTGGAGATATGGACAGTGCGCATAATTTC AGGATGAGGATACTAGAAAAAGGATATGCTCCTTCGGCCGACGCTTATGGCGCTCTTATCCTTCATCTCAAAGAC ACTACCGACGATGCTTCAAACGCTCTGGGTTTATACTTTGAAGCTCAGCAGCATAAAGTCAAAATGAACATCTAT TTCTACAACAACATCATTTCGAAGCTCGCTAAAGCGCGTAAAGCTGATCATGCTTTGGAACTATTTCAAAGAATG AAAGCGGAGCGTATTTTACCTAGCTCGATTACTTATGGTGCCTTAATCGGTGCTTGTGCTAGAGTTGGAGATGTT CAAAGTGCGGAGACTTTGTTCGAGGAGATGGAGTCGCGCAGGAATTTCAGACCGAGGGTTCCGCCGTATAATACG ATGATGCAACTCTATACGATGACGAAACCGAATAGGGAGAGAGTACTCCATTACTTCGATAAGATGTATCAAGCT GGAGTCAACCCTACGGCCCATACTTACAAGTTGTTGCTTGATGCTTATGGATCTATCGAGCCGGTCGACATTCCT TCGATGGAAGCCATCTTTGAACAACTCCAAGGAGATCGCGATGTCGACGTTCAGGGAACCCATTATGCTTCCCTT ATCAATGCCTACGGTTGTATTCAACGCGATTTAGAAAAAGCCCTCTCAATATTCGATTCCGTCCCATCCTCTTCG ACACCAAACCAACATTCTGTTCTAGACGCTGTTGTGTTCGAATCTCTCGTCAACGTCTTTGTATCTCATCGTCGT ACGGATCTCATACCCGAGTATATCAACAAGATGATTGGTTTGGGTATTCATATGACCGCATATATTGCCAATTTT TTGATCAAAGGTTATGCGATTACCGGAGAATTGGAGAAGGCGAGGGAGATCTTTGAGAGCATGGTTGATCCTCCC ATGGGAGTTGCTGCTCCGAATAATCATGCTCCTCATACTCCTAATGCTGGGAATGCCATCGGGTCTATGGAACCG GTTTATCGTGAGCCCTCGACTTGGGAAGCTATGGTTAGAGCTGAACTTGGTGCTGGTCATCGTGATCTTGCATTG GATTTATTAGAGAGGTTGAAATCTCGACAATACCCTGAAGCGGTGTATAACCGTATTAGTGGTGTCTTGGTTGAT CACTCAACGTTACCCGCATAG |
| Gene | >AgabiH97|069450 ATGCTCCCAAAAGTCGCGACACATCTCTTCCACACAACCTCTAGGGTAGCCGCTCAGGCTGTCCATCGCAACGTC CTCCAACAGACCGGCCACTCGACCGGCTCAAATCTCGGGACCTGGAACGGTCCCTCGAGCTCGAATTGGGGCGGC CAAGGCACTGGCACAGGAAACTCTAAGCATAACACTGGTAGCAGTCGCTACTACTCTTTCAGCGTATGTTCGTTT CATTTTTTGTTGGTGTCTTTTTTCTCAAAGAACAACTTTGTCAGACTGCAGGAAGAGCGGTCTCGCAGGCCAACG CAGTCTCTGCCAATGTCGACGGTTCGTTCGCCTCGGACGAAAATGACGAGCCCACGTCACGTCGCGTCGTCGTAA TTTCATCATCATCTCAATCAAAGCGAGCTCGGATACGCAGCTCGAGTGCAACATTAACAAATGCGGAATCGTTAG GCGTTCTCAAGGCTCTGCAGCTTCGTAGGCGTTCGCGGTTCTTACATACGTCGATAGAAGCTGTAGCGCTGTCTC AACCTGCACTCATACAGTCATCACCTTCACGACCTCGACGCAATTCTACTTCTTCTTCTGATGGCTTGGATCGAC CGTCTTCGCCTGTGCGAACTTTCACCACTGCTACAGCTGTTGCACCAGAGGCACAGGATAAGGAGCAGCTCCTTC GTCCCCGCCGGAATTCCACATCTTCCATTGATGACCGAGACAAATTAGCGTTCGACTCTTTCCAATCTGTCCTCG ACGAGGAGCTTTCGATTCAATCAGGAAACTCAGCGTCGTCCATCGACGACCACGAGCTCAACGATGTTTCTTCTA TCGAAACAAAACTTACAACACCATCCGGATCCCCCGAGGCCCCTCTGTCCGATTCCCCACCCTCTCGTTCTTCTG CTTCAACTTATCCGTTCGAGTATCTCATCGAAGCTAGACTGTCTAGTGATCCCCATCGTGTTGCCGAAGCCGTCG CTCGCTTCCGTTCGACTGCTCAGTCCCCCCAAACTGTGGATTTTAACAATGCCCTCGATGCTATGTATGCTACTC GTAGATCAGAACCCCTGCACGCCATTCTTGAGGTCTACCAGGATATGATCAGTCGCTCCATCCAGCCCGATGAAA GAACCTTTTCCATCCTCATCCAAAGTGCGGTGGACCGCGATCATGAGTTGGGCCATGGGATCAGAGGCATGACTC AGCTTATGCACCGCCAAGGTATCACTGGGGGTGGCATTGACAACAGAGTGCACATGGGTTTACAGTACAAACTCG AATCGTACTCTTCTGAATACAGGGAAAATTTTGCAACGGTTTTGTCGCTGTACTATGCTGCTCGCGTCAATAGTT TCTTCTTCTCACCCGAGCTCTACCTCGAGTTGATCCGTACAACCTCCCGTCACTCCAACATTGAACTTGCAGAGG AGATATTTCGGCTCGCCCAAGAGAGATGTGGGCATTTACAACCGTATTGCTACCGGTATATGATTCAGGGCTATG GTCGCGCGGGTGACGCGGTTGCTGCGGAAAGGGTTTTCGAACAGTACAATGTTGCTGCGCGAGAAGGAAGGCTCT CAGTTGATGATCATACTCTCGGTTATCAAAGGAGCCATATCCTCGTTTGGAATGCCATGATCGAGTCGTATTTCC TTTGCGGTCTACCGGACAAGGCGGTTGGTATTTTGGACAAGATGATGAATTCACCCGCGGATCTTGGCTTCGGAA TCGAGGATGTCCCATATCCTGCATCATCTACCTACACCGAAATATTGAAGGGTTTCGTCGAAGCCGGTGATATCA CTACTGCGTGGAGGTGGTACGAGAGGTTATCGGAACAAGGTGTCAAGACAGAAAATCATTTTTGGCCGGCAACGC AACCTATCAAACCGGATGGAAGAGCCGATATTCTTATGATTGCAGCTTTGGCCGAGCGCGGATACATATCCGAAC TCAACAAGATCTTTTCCTCCATCGATCACACTTACAAAGACTTGCAAACCGCTCCACTGCTCACTTATAAAGCCA ACATGGCGGCTCTGAAGAACATCGAATCCGAAGTACATGCAAAGAGGATCTTGAACTTTTTGACCATGGAAGTTT TTCCGCGTACCCTGAAGTTGGTTGTAAGGAAGGTTATGATCATCCGGATTGTTATGGAATATGTGGACAGGAATA TGTTCGAAGATGCTCTGGCTTCGTATAAGCATTTTCACGAGTTGATGTTGCAAGATATCAAGGTTAACGAGGAGA GCCAATATTCGCCGCTGTCCTTGACAATGACTTTGCAAGAAGCGTTTAGCAGGATCCAAGGACCTATGTGGAAGC TACTGGTGGAGAGGAAAAGGTTGAATTGGGATTTCGCTATGCAGTTGATGGCGTGCGGTAGGGATTTGGGTATCG AGGTGCCGACGGCTATGCAGAAACATGTGTTACATGTGTATGCTCTCGCTAGGGCTAACAATGAGTTGCCGGTTG AGATGATGACGACGAAGGTTTGGGAACAGCTGTTGATGATCGCCGTAGATGTGGAAAGTGCCTCCTTTGCTTCGC CGACGTTGTCCGCTCGAGAATACAAAGACGTCCTTGGATACGCTTTTGAGGGCGTACAGAGTCTCGTCGAGGATA TGGCCAAGCTTCAAGTTCATATCGAGGAACTTCCATCGAGTTTGATGAACAAGACCATCCGTCATCTCATATCGG TTTACGGTGGCGATAACGTCGTTCGTACTCTCCAGAAACTCGGTCCCGCTTTTGAACGCGCATTGGAAGACAGTG AAGAGATTAGAACCCTGGTTGTCGAGCAGAAATTGGAAAACGTTCCCGAAAACGTTATCAATAATGAATTCACGC AAAGGTTGCTGCAGTCTTACGGTAATCTCGTCGTCGACCCGGCTCAATGCAAAGCTCTTGACGACTTGTTGAGAC AAAACAATATTCGCAGCAATGTTCTAGCTGCTTATAATATGTTGAAGAACGGCTTTGATAATCGCCATGTTCCTT CTCCGAAAGTTATTGGGAAGTTGATCCAGGGTTTGGGAAGGCAAGGGGAGGTCGAAATGTTGAACGAGGTCTATG CGATTGCGCAGACGATTCTGGATGGATTGATGTTGGATGCGGAGGAGTCGAGAAGGGGTCAATATTTCATCGAGG ATAATATGGTTATCGCTCTGGCTCATCTTGGAGATATGGACAGTGCGCATAATTTCAGGATGAGGATACTAGAAA AAGGATATGCTCCTTCGGCCGACGCTTATGGCGCTCTTATCCTTCATCTCAAAGACACTACCGACGATGCTTCAA ACGCTCTGGGTTTATACTTTGAAGCTCAGCAGCATAAAGTCAAAATGAACATCTATTTCTACAACAACATCATTT CGAAGCTCGCTAAAGCGCGTAAAGCTGATCATGCTTTGGAACTATTTCAAAGAATGAAAGCGGAGCGTATTTTAC CTAGCTCGATTACTTATGGTGCCTTAATCGGTGCTTGTGCTAGAGTTGGAGATGTTCAAAGTGCGGAGACTTTGT TCGAGGAGATGGAGTCGCGCAGGAATTTCAGACCGAGGGTTCCGCCGTATAATACGATGATGCAACTCTATACGA TGACGAAACCGAATAGGGAGAGAGTACTCCATTACTTCGATAAGATGTATCAAGCTGGAGTCAACCCTACGGCCC ATACTTACAAGGTAACGTGTTTTCGCAAGGAGGTTTAGAAATTTGGAAAGACTGACCTTTTACGCCTGTAGTTGT TGCTTGATGCTTATGGATCTATCGAGCCGGTCGACATTCCTTCGATGGAAGCCATCTTTGAACAACTCCAAGGAG ATCGCGATGTCGACGTTCAGGGAACCCATTATGCTTCCCTTATCAATGCCTACGGTTGTATTCAACGCGATTTAG AAAAAGCCCTCTCAATATTCGATTCCGTCCCATCCTCTTCGACACCAAACCAACATTCTGTTCTAGACGCTGTTG TGTTCGAATCTCTCGTCAACGTCTTTGTATCTCATCGTCGTACGGATCTCATACCCGAGTATATCAACAAGATGA TTGGTTTGGGTATTCATATGACCGCATATATTGCCAATTTTTTGATCAAAGGTTATGCGATTACCGGAGAATTGG AGAAGGCGAGGGAGATCTTTGAGAGCATGGTTGATCCTCCCATGGGAGTTGCTGCTCCGAATAATCATGCTCCTC ATACTCCTAATGCTGGGAATGCCATCGGGTCTATGGAACCGGTTTATCGTGAGGTATGTGTTGCGACGATATGAT TTGGACTTTTGTTGATGTGTACGTGGTTTTTTTCTTTAGCCCTCGACTTGGGAAGCTATGGTTAGAGCTGAACTT GGTGCTGGTCATCGTGATCTTGCATTGGATTTATTAGAGAGGTTGAAATCTCGGTTCGTCCTATATTTACTCTCT TTAGTCGTCAGAAAGCCTGACTTTTGATTGTATAGACAATACCCTGAAGCGGTGTATAACCGTATTAGTGGTGTC TTGGTTGATCACTCAACGTTACCCGCATAG |