Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069450
Gene name
Locationscaffold_4:1051148..1055678
Strand+
Gene length (bp)4530
Transcript length (bp)4296
Coding sequence length (bp)4296
Protein length (aa) 1432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13041 PPR_2 PPR repeat family 4.1E-09 1098 1146
PF01535 PPR PPR repeat 1.6E-01 473 496
PF01535 PPR PPR repeat 3.1E-04 522 547
PF01535 PPR PPR repeat 3.2E-04 1102 1129
PF01535 PPR PPR repeat 1.2E-05 1135 1163
PF01535 PPR PPR repeat 4.1E-03 1324 1347
PF13812 PPR_3 Pentatricopeptide repeat domain 4.4E-11 1089 1144
PF13812 PPR_3 Pentatricopeptide repeat domain 3.3E-06 1156 1217
PF17177 PPR_long Pentacotripeptide-repeat region of PRORP 1.2E-14 1077 1214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10451|PPR5_SCHPO Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 983 1426 7.0E-65
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 1053 1350 2.0E-19
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 1053 1351 8.0E-19
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 956 1346 1.0E-18
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 1053 1346 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10451|PPR5_SCHPO Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 983 1426 7.0E-65
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 1053 1350 2.0E-19
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 1053 1351 8.0E-19
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 956 1346 1.0E-18
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 1053 1346 2.0E-18
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 989 1387 3.0E-18
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 1044 1347 4.0E-18
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 1053 1344 1.0E-17
sp|Q9FMD3|PP389_ARATH Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 1037 1346 1.0E-16
sp|Q9SFV9|PP218_ARATH Pentatricopeptide repeat-containing protein At3g07290, mitochondrial OS=Arabidopsis thaliana GN=At3g07290 PE=2 SV=1 1034 1347 2.0E-16
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 982 1411 2.0E-16
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 1053 1350 4.0E-16
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 1053 1346 7.0E-16
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 1010 1409 2.0E-15
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 1033 1415 2.0E-15
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 1026 1346 3.0E-15
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 1037 1360 4.0E-15
sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 1053 1346 5.0E-15
sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 1056 1429 1.0E-14
sp|Q9LYT2|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 1098 1346 1.0E-14
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 1047 1347 2.0E-14
sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 943 1346 2.0E-14
sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 1053 1346 2.0E-14
sp|O80958|PP194_ARATH Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 978 1348 4.0E-14
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 991 1346 6.0E-14
sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 979 1347 7.0E-14
sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 1083 1348 7.0E-14
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 1047 1346 8.0E-14
sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 984 1234 8.0E-14
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 956 1408 8.0E-14
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 1053 1411 9.0E-14
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 989 1347 1.0E-13
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 961 1346 1.0E-13
sp|Q9C9U0|PP118_ARATH Pentatricopeptide repeat-containing protein At1g73710 OS=Arabidopsis thaliana GN=At1g73710 PE=2 SV=1 1033 1407 1.0E-13
sp|Q9FVX2|PP129_ARATH Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 1090 1347 1.0E-13
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 1034 1347 2.0E-13
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 957 1346 2.0E-13
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 1042 1346 2.0E-13
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 1038 1329 2.0E-13
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 1044 1224 3.0E-13
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 1034 1346 3.0E-13
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 967 1347 4.0E-13
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 953 1213 4.0E-13
sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 1089 1360 4.0E-13
sp|Q9M316|PP292_ARATH Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 959 1295 4.0E-13
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 1038 1346 4.0E-13
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 989 1421 4.0E-13
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 1079 1348 6.0E-13
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 944 1391 9.0E-13
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 1043 1350 9.0E-13
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 981 1411 1.0E-12
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 1042 1347 1.0E-12
sp|Q6NKW7|PP164_ARATH Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 1048 1367 1.0E-12
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 1082 1407 1.0E-12
sp|Q9FLL3|PP412_ARATH Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 1047 1357 2.0E-12
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 1037 1412 2.0E-12
sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 1054 1316 2.0E-12
sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 986 1348 2.0E-12
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 981 1411 3.0E-12
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 1006 1214 3.0E-12
sp|Q9CAM8|PP100_ARATH Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 1053 1347 3.0E-12
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 1083 1339 3.0E-12
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 1050 1415 4.0E-12
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 1052 1415 4.0E-12
sp|Q9FRS4|PPR22_ARATH Pentatricopeptide repeat-containing protein At1g08610 OS=Arabidopsis thaliana GN=At1g08610 PE=2 SV=1 1103 1348 5.0E-12
sp|O82178|PP186_ARATH Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 1066 1348 6.0E-12
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 1034 1425 7.0E-12
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 981 1255 7.0E-12
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 1082 1407 7.0E-12
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 1098 1412 7.0E-12
sp|Q9FLL3|PP412_ARATH Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 1041 1346 8.0E-12
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 1105 1349 9.0E-12
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 1029 1357 1.0E-11
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 972 1354 1.0E-11
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 1033 1347 1.0E-11
sp|Q9SZ20|PP339_ARATH Pentatricopeptide repeat-containing protein At4g26800 OS=Arabidopsis thaliana GN=At4g26800 PE=2 SV=2 1046 1346 1.0E-11
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 1000 1348 1.0E-11
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 1044 1215 1.0E-11
sp|O81908|PPR2_ARATH Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 1095 1348 1.0E-11
sp|P0C8A0|PP275_ARATH Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 981 1218 1.0E-11
sp|Q9LFQ4|PP383_ARATH Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 1086 1276 1.0E-11
sp|Q9LUR2|PP238_ARATH Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 1047 1346 1.0E-11
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 951 1347 1.0E-11
sp|Q9FKC3|PP424_ARATH Pentatricopeptide repeat-containing protein At5g48730, chloroplastic OS=Arabidopsis thaliana GN=At5g48730 PE=2 SV=2 1091 1346 1.0E-11
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 981 1411 2.0E-11
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 1034 1346 2.0E-11
sp|Q9LEQ7|PP382_ARATH Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 1082 1358 2.0E-11
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 959 1354 2.0E-11
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 979 1212 2.0E-11
sp|Q3EAF8|PP294_ARATH Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 1082 1358 2.0E-11
sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 912 1276 3.0E-11
sp|Q9LZP3|PP293_ARATH Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 1082 1421 3.0E-11
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 1047 1348 3.0E-11
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 1083 1343 3.0E-11
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 968 1254 5.0E-11
sp|Q9FGR7|PP426_ARATH Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 890 1216 5.0E-11
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 960 1361 6.0E-11
sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 1073 1409 7.0E-11
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 1055 1346 8.0E-11
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 1103 1409 8.0E-11
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 1053 1425 9.0E-11
sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 981 1255 1.0E-10
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 1056 1347 1.0E-10
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 1034 1346 1.0E-10
sp|Q9ZVX5|PP156_ARATH Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 937 1344 1.0E-10
sp|Q9LMH5|PPR42_ARATH Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 1070 1347 1.0E-10
sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 1033 1414 1.0E-10
sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 1054 1317 1.0E-10
sp|Q9SSR6|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 980 1224 1.0E-10
sp|Q8GZ63|PP397_ARATH Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 1054 1360 1.0E-10
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 980 1298 2.0E-10
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 1034 1348 2.0E-10
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 1034 1215 2.0E-10
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 1036 1347 2.0E-10
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 1006 1214 2.0E-10
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 1099 1346 2.0E-10
sp|Q9FLD8|PP408_ARATH Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 1056 1346 2.0E-10
sp|Q9SAA6|PPR34_ARATH Pentatricopeptide repeat-containing protein At1g11710, mitochondrial OS=Arabidopsis thaliana GN=At1g11710 PE=2 SV=1 1032 1426 2.0E-10
sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 981 1411 3.0E-10
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 1058 1357 3.0E-10
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 1039 1344 3.0E-10
sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 1083 1356 4.0E-10
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 1042 1207 4.0E-10
sp|P0C7R3|PP106_ARATH Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 1059 1347 5.0E-10
sp|Q5BIV3|PPR35_ARATH Pentatricopeptide repeat-containing protein At1g11900 OS=Arabidopsis thaliana GN=At1g11900 PE=2 SV=1 1033 1276 5.0E-10
sp|P0C896|PP209_ARATH Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 983 1212 5.0E-10
sp|Q0WKZ3|PP105_ARATH Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 1098 1348 5.0E-10
sp|Q9LS88|PP250_ARATH Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana GN=At3g23020 PE=2 SV=1 1089 1347 5.0E-10
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 951 1227 5.0E-10
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 981 1348 5.0E-10
sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 1033 1215 6.0E-10
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 965 1293 6.0E-10
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 1049 1347 6.0E-10
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 1006 1214 7.0E-10
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 1042 1223 7.0E-10
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 953 1216 7.0E-10
sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 1032 1254 7.0E-10
sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 1079 1346 8.0E-10
sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 948 1271 1.0E-09
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 958 1268 1.0E-09
sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 970 1216 1.0E-09
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 967 1214 2.0E-09
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 1033 1347 2.0E-09
sp|O80958|PP194_ARATH Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 1034 1406 2.0E-09
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 935 1344 2.0E-09
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 1111 1346 2.0E-09
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 1030 1428 2.0E-09
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 976 1346 2.0E-09
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 940 1214 2.0E-09
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 1056 1348 2.0E-09
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 970 1302 2.0E-09
sp|Q9MAG8|PPR79_ARATH Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 1058 1215 2.0E-09
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein At3g09040, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E88 PE=2 SV=1 1098 1348 2.0E-09
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 989 1276 2.0E-09
sp|O65567|PP342_ARATH Pentatricopeptide repeat-containing protein At4g30825, chloroplastic OS=Arabidopsis thaliana GN=At4g30825 PE=2 SV=2 1091 1346 2.0E-09
sp|Q9FXH1|PPR52_ARATH Pentatricopeptide repeat-containing protein At1g19720 OS=Arabidopsis thaliana GN=DYW7 PE=2 SV=1 956 1415 2.0E-09
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 1033 1346 3.0E-09
sp|Q9SZ10|PP338_ARATH Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 1030 1347 3.0E-09
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 1036 1346 4.0E-09
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 980 1216 4.0E-09
sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 1044 1347 4.0E-09
sp|Q9FGR7|PP426_ARATH Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 1026 1347 4.0E-09
sp|Q8RWS8|PP199_ARATH Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 1070 1412 4.0E-09
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 1054 1237 5.0E-09
sp|Q9LN69|PPR50_ARATH Putative pentatricopeptide repeat-containing protein At1g19290 OS=Arabidopsis thaliana GN=At1g19290 PE=3 SV=2 1102 1215 5.0E-09
sp|P0C8Q3|PP326_ARATH Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 1033 1388 5.0E-09
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 1058 1346 6.0E-09
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 977 1351 6.0E-09
sp|Q8LK93|PP145_ARATH Pentatricopeptide repeat-containing protein At2g02980, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H26 PE=2 SV=2 1102 1255 7.0E-09
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 1033 1425 8.0E-09
sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 1078 1346 8.0E-09
sp|Q8RWS8|PP199_ARATH Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 1050 1346 1.0E-08
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 1105 1431 1.0E-08
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 1068 1346 1.0E-08
sp|Q9CA54|PP122_ARATH Pentatricopeptide repeat-containing protein At1g74630 OS=Arabidopsis thaliana GN=PCMP-H71 PE=2 SV=1 1086 1220 1.0E-08
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 1037 1346 2.0E-08
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 989 1419 2.0E-08
sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 1033 1346 2.0E-08
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 1058 1235 2.0E-08
sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 1054 1410 2.0E-08
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 937 1347 2.0E-08
sp|Q9LS88|PP250_ARATH Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana GN=At3g23020 PE=2 SV=1 1032 1348 2.0E-08
sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 1042 1346 2.0E-08
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 1035 1350 2.0E-08
sp|Q9LQQ1|PPR20_ARATH Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 986 1223 2.0E-08
sp|Q0WLC6|PP349_ARATH Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana GN=MRL1 PE=2 SV=2 926 1215 2.0E-08
sp|Q8GYM2|PP393_ARATH Pentatricopeptide repeat-containing protein At5g18950 OS=Arabidopsis thaliana GN=At5g18950 PE=2 SV=2 963 1162 2.0E-08
sp|Q9SHK2|PPR17_ARATH Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 1036 1339 2.0E-08
sp|Q9FH87|PP447_ARATH Putative pentatricopeptide repeat-containing protein At5g65820 OS=Arabidopsis thaliana GN=At5g65820 PE=3 SV=1 1033 1218 2.0E-08
sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 1042 1223 3.0E-08
sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 915 1254 3.0E-08
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 1058 1346 3.0E-08
sp|Q9SV96|PP358_ARATH Pentatricopeptide repeat-containing protein At4g39620, chloroplastic OS=Arabidopsis thaliana GN=EMB2453 PE=2 SV=1 1024 1346 3.0E-08
sp|Q9ZUA2|PP141_ARATH Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 1098 1339 3.0E-08
sp|Q9SAK0|PP132_ARATH Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana GN=EMB2217 PE=2 SV=1 1034 1224 3.0E-08
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 1061 1346 3.0E-08
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 949 1178 4.0E-08
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 989 1348 4.0E-08
sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 1098 1327 4.0E-08
sp|Q9LKU8|PP401_ARATH Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 970 1236 4.0E-08
sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 1056 1311 5.0E-08
sp|Q66GP4|PP379_ARATH Pentatricopeptide repeat-containing protein At5g13770, chloroplastic OS=Arabidopsis thaliana GN=At5g13770 PE=2 SV=1 888 1164 5.0E-08
sp|Q9LS25|PP420_ARATH Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 1042 1223 5.0E-08
sp|Q9SSR6|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 1032 1350 6.0E-08
sp|Q9ZUA2|PP141_ARATH Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 1102 1346 6.0E-08
sp|P0C043|PP318_ARATH Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1 1095 1347 7.0E-08
sp|Q9LUJ4|PP248_ARATH Pentatricopeptide repeat-containing protein At3g22670, mitochondrial OS=Arabidopsis thaliana GN=At3g22670 PE=2 SV=1 1102 1351 7.0E-08
sp|Q56X05|PPR15_ARATH Pentatricopeptide repeat-containing protein At1g06145 OS=Arabidopsis thaliana GN=EMB1444 PE=2 SV=2 1034 1181 7.0E-08
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 1102 1352 8.0E-08
sp|O04590|PPR88_ARATH Pentatricopeptide repeat-containing protein At1g62260, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E10 PE=2 SV=1 1034 1415 8.0E-08
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 1059 1347 9.0E-08
sp|Q9FNN7|PP371_ARATH Pentatricopeptide repeat-containing protein At5g08510 OS=Arabidopsis thaliana GN=PCMP-E20 PE=2 SV=1 1016 1232 9.0E-08
sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 1070 1346 9.0E-08
sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 1036 1347 1.0E-07
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 1034 1223 1.0E-07
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 1030 1351 1.0E-07
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 1034 1346 1.0E-07
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 1095 1359 1.0E-07
sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 981 1215 1.0E-07
sp|Q9LSQ2|PP239_ARATH Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 1009 1346 1.0E-07
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 989 1212 2.0E-07
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 970 1215 2.0E-07
sp|Q9M316|PP292_ARATH Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 970 1236 2.0E-07
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 1032 1346 2.0E-07
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 1102 1346 2.0E-07
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 1107 1417 2.0E-07
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 1037 1346 2.0E-07
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 1054 1409 2.0E-07
sp|P0C043|PP318_ARATH Putative pentatricopeptide repeat-containing protein At4g17915 OS=Arabidopsis thaliana GN=At4g17915 PE=3 SV=1 1102 1346 2.0E-07
sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 984 1217 2.0E-07
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protein At5g55740, chloroplastic OS=Arabidopsis thaliana GN=CRR21 PE=2 SV=1 1095 1347 2.0E-07
sp|Q9FNG8|PP366_ARATH Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 1058 1346 2.0E-07
sp|Q9LVD3|PP434_ARATH Pentatricopeptide repeat-containing protein At5g57250, mitochondrial OS=Arabidopsis thaliana GN=At5g57250 PE=2 SV=2 1034 1358 2.0E-07
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 1004 1214 3.0E-07
sp|P0C7R3|PP106_ARATH Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 970 1274 3.0E-07
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 967 1344 3.0E-07
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 966 1216 3.0E-07
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 989 1346 3.0E-07
sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 1094 1347 3.0E-07
sp|Q9SHK2|PPR17_ARATH Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 1083 1347 3.0E-07
sp|Q9M8M3|PP136_ARATH Pentatricopeptide repeat-containing protein At1g80550, mitochondrial OS=Arabidopsis thaliana GN=At1g80550 PE=2 SV=1 856 1222 3.0E-07
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 346 639 4.0E-07
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 1089 1347 4.0E-07
sp|Q9CAM8|PP100_ARATH Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 967 1178 4.0E-07
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 1051 1346 4.0E-07
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 1058 1346 4.0E-07
sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 986 1415 4.0E-07
sp|Q8L6Y3|PP396_ARATH Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 1101 1357 4.0E-07
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 1032 1271 4.0E-07
sp|Q9LVA2|PP443_ARATH Pentatricopeptide repeat-containing protein At5g62370 OS=Arabidopsis thaliana GN=At5g62370 PE=2 SV=1 1054 1346 4.0E-07
sp|Q0WVV0|PPR31_ARATH Pentatricopeptide repeat-containing protein At1g10910, chloroplastic OS=Arabidopsis thaliana GN=At1g10910 PE=2 SV=1 1088 1346 4.0E-07
sp|Q9FLZ9|PP405_ARATH Pentatricopeptide repeat-containing protein At5g39350 OS=Arabidopsis thaliana GN=PCMP-E16 PE=2 SV=1 1032 1282 4.0E-07
sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 1033 1346 5.0E-07
sp|Q9FX24|PPR71_ARATH Pentatricopeptide repeat-containing protein At1g34160 OS=Arabidopsis thaliana GN=PCMP-H68 PE=2 SV=2 1102 1215 5.0E-07
sp|Q9ZUU3|PP190_ARATH Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana GN=At2g37230 PE=2 SV=1 1105 1347 5.0E-07
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 1054 1417 6.0E-07
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 946 1347 6.0E-07
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protein At2g33760 OS=Arabidopsis thaliana GN=PCMP-H6 PE=3 SV=1 1100 1406 6.0E-07
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 1042 1223 7.0E-07
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 1084 1419 7.0E-07
sp|Q9LMH5|PPR42_ARATH Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 1006 1348 7.0E-07
sp|Q9SF38|PP222_ARATH Pentatricopeptide repeat-containing protein At3g09650, chloroplastic OS=Arabidopsis thaliana GN=HCF152 PE=2 SV=1 979 1238 7.0E-07
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 980 1274 8.0E-07
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 1034 1392 8.0E-07
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 981 1358 9.0E-07
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 1054 1410 1.0E-06
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 956 1213 1.0E-06
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 1105 1346 1.0E-06
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 1045 1346 1.0E-06
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 1037 1213 1.0E-06
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 1042 1215 1.0E-06
sp|P0C8Q3|PP326_ARATH Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 1034 1216 1.0E-06
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 1052 1220 1.0E-06
sp|P0C7Q9|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 1103 1415 1.0E-06
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protein At4g14820 OS=Arabidopsis thaliana GN=PCMP-H3 PE=2 SV=1 1033 1188 1.0E-06
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 1118 1347 2.0E-06
sp|Q9LS88|PP250_ARATH Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana GN=At3g23020 PE=2 SV=1 842 1363 2.0E-06
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 956 1215 2.0E-06
sp|Q9FXH1|PPR52_ARATH Pentatricopeptide repeat-containing protein At1g19720 OS=Arabidopsis thaliana GN=DYW7 PE=2 SV=1 1088 1348 2.0E-06
sp|Q9LVD3|PP434_ARATH Pentatricopeptide repeat-containing protein At5g57250, mitochondrial OS=Arabidopsis thaliana GN=At5g57250 PE=2 SV=2 1083 1264 2.0E-06
sp|Q9FMA1|PP433_ARATH Pentatricopeptide repeat-containing protein At5g56310 OS=Arabidopsis thaliana GN=PCMP-E13 PE=2 SV=1 1098 1188 2.0E-06
sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 1099 1347 2.0E-06
sp|Q3ECH5|PP107_ARATH Pentatricopeptide repeat-containing protein At1g66345, mitochondrial OS=Arabidopsis thaliana GN=At1g66345 PE=3 SV=1 1032 1164 2.0E-06
sp|Q9LVA2|PP443_ARATH Pentatricopeptide repeat-containing protein At5g62370 OS=Arabidopsis thaliana GN=At5g62370 PE=2 SV=1 981 1347 3.0E-06
sp|O81028|PP171_ARATH Pentatricopeptide repeat-containing protein At2g26790, mitochondrial OS=Arabidopsis thaliana GN=At2g26790 PE=3 SV=1 1116 1221 3.0E-06
sp|P0C8Q7|PP369_ARATH Pentatricopeptide repeat-containing protein At5g08305 OS=Arabidopsis thaliana GN=PCMP-E105 PE=2 SV=1 934 1314 3.0E-06
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 1032 1403 4.0E-06
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 1088 1343 4.0E-06
sp|P0C8Q3|PP326_ARATH Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 1083 1389 4.0E-06
sp|Q9FNG8|PP366_ARATH Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 1102 1344 4.0E-06
sp|P0C7Q9|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 1042 1339 4.0E-06
sp|Q8LPS6|PPR3_ARATH Pentatricopeptide repeat-containing protein At1g02150 OS=Arabidopsis thaliana GN=At1g02150 PE=2 SV=2 1056 1276 4.0E-06
sp|Q9FI49|PP428_ARATH Pentatricopeptide repeat-containing protein At5g50990 OS=Arabidopsis thaliana GN=PCMP-H59 PE=2 SV=2 1037 1179 4.0E-06
sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protein At1g50270 OS=Arabidopsis thaliana GN=PCMP-E42 PE=2 SV=1 1086 1180 4.0E-06
sp|A3KPF8|PP131_ARATH Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 951 1346 4.0E-06
sp|Q9FRS4|PPR22_ARATH Pentatricopeptide repeat-containing protein At1g08610 OS=Arabidopsis thaliana GN=At1g08610 PE=2 SV=1 1042 1287 5.0E-06
sp|Q9FLD8|PP408_ARATH Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 958 1357 5.0E-06
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 1103 1348 5.0E-06
sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 1021 1339 5.0E-06
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 1115 1348 5.0E-06
sp|Q9FZ24|PPR4_ARATH Pentatricopeptide repeat-containing protein At1g02370, mitochondrial OS=Arabidopsis thaliana GN=At1g02370 PE=2 SV=1 1136 1278 5.0E-06
sp|Q1PFA6|PP144_ARATH Pentatricopeptide repeat-containing protein At2g02750 OS=Arabidopsis thaliana GN=PCMP-E22 PE=2 SV=2 1101 1188 5.0E-06
sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protein At2g22410, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E28 PE=2 SV=1 1037 1179 5.0E-06
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 1118 1346 6.0E-06
sp|Q1PFQ9|PPR62_ARATH Pentatricopeptide repeat-containing protein At1g28690, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E34 PE=2 SV=2 1088 1179 6.0E-06
sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protein At5g15300 OS=Arabidopsis thaliana GN=PCMP-E40 PE=2 SV=2 1033 1220 6.0E-06
sp|Q9FMU2|PP380_ARATH Pentatricopeptide repeat-containing protein At5g14080 OS=Arabidopsis thaliana GN=At5g14080 PE=2 SV=2 1043 1239 6.0E-06
sp|Q9FVX2|PP129_ARATH Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 945 1215 7.0E-06
sp|Q56XR6|PP421_ARATH Pentatricopeptide repeat-containing protein At5g46680 OS=Arabidopsis thaliana GN=At5g46680 PE=2 SV=2 1098 1347 7.0E-06
sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 1082 1295 7.0E-06
sp|Q9SAH2|PP137_ARATH Pentatricopeptide repeat-containing protein At1g80880, mitochondrial OS=Arabidopsis thaliana GN=At1g80880 PE=2 SV=1 978 1213 7.0E-06
sp|P0C8R0|PP416_ARATH Putative pentatricopeptide repeat-containing protein At5g43820 OS=Arabidopsis thaliana GN=At5g43820 PE=3 SV=1 1034 1213 7.0E-06
sp|A3KPF8|PP131_ARATH Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 1096 1428 8.0E-06
sp|Q7X6A5|PPR81_ARATH Pentatricopeptide repeat-containing protein At1g55630 OS=Arabidopsis thaliana GN=At1g55630 PE=2 SV=1 1041 1252 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069450
MLPKVATHLFHTTSRVAAQAVHRNVLQQTGHSTGSNLGTWNGPSSSNWGGQGTGTGNSKHNTGSSRYYSFSTAGR
AVSQANAVSANVDGSFASDENDEPTSRRVVVISSSSQSKRARIRSSSATLTNAESLGVLKALQLRRRSRFLHTSI
EAVALSQPALIQSSPSRPRRNSTSSSDGLDRPSSPVRTFTTATAVAPEAQDKEQLLRPRRNSTSSIDDRDKLAFD
SFQSVLDEELSIQSGNSASSIDDHELNDVSSIETKLTTPSGSPEAPLSDSPPSRSSASTYPFEYLIEARLSSDPH
RVAEAVARFRSTAQSPQTVDFNNALDAMYATRRSEPLHAILEVYQDMISRSIQPDERTFSILIQSAVDRDHELGH
GIRGMTQLMHRQGITGGGIDNRVHMGLQYKLESYSSEYRENFATVLSLYYAARVNSFFFSPELYLELIRTTSRHS
NIELAEEIFRLAQERCGHLQPYCYRYMIQGYGRAGDAVAAERVFEQYNVAAREGRLSVDDHTLGYQRSHILVWNA
MIESYFLCGLPDKAVGILDKMMNSPADLGFGIEDVPYPASSTYTEILKGFVEAGDITTAWRWYERLSEQGVKTEN
HFWPATQPIKPDGRADILMIAALAERGYISELNKIFSSIDHTYKDLQTAPLLTYKANMAALKNIESEVHAKRILN
FLTMEVFPRTLKLVVRKVMIIRIVMEYVDRNMFEDALASYKHFHELMLQDIKVNEESQYSPLSLTMTLQEAFSRI
QGPMWKLLVERKRLNWDFAMQLMACGRDLGIEVPTAMQKHVLHVYALARANNELPVEMMTTKVWEQLLMIAVDVE
SASFASPTLSAREYKDVLGYAFEGVQSLVEDMAKLQVHIEELPSSLMNKTIRHLISVYGGDNVVRTLQKLGPAFE
RALEDSEEIRTLVVEQKLENVPENVINNEFTQRLLQSYGNLVVDPAQCKALDDLLRQNNIRSNVLAAYNMLKNGF
DNRHVPSPKVIGKLIQGLGRQGEVEMLNEVYAIAQTILDGLMLDAEESRRGQYFIEDNMVIALAHLGDMDSAHNF
RMRILEKGYAPSADAYGALILHLKDTTDDASNALGLYFEAQQHKVKMNIYFYNNIISKLAKARKADHALELFQRM
KAERILPSSITYGALIGACARVGDVQSAETLFEEMESRRNFRPRVPPYNTMMQLYTMTKPNRERVLHYFDKMYQA
GVNPTAHTYKLLLDAYGSIEPVDIPSMEAIFEQLQGDRDVDVQGTHYASLINAYGCIQRDLEKALSIFDSVPSSS
TPNQHSVLDAVVFESLVNVFVSHRRTDLIPEYINKMIGLGIHMTAYIANFLIKGYAITGELEKAREIFESMVDPP
MGVAAPNNHAPHTPNAGNAIGSMEPVYREPSTWEAMVRAELGAGHRDLALDLLERLKSRQYPEAVYNRISGVLVD
HSTLPA*
Coding >AgabiH97|069450
ATGCTCCCAAAAGTCGCGACACATCTCTTCCACACAACCTCTAGGGTAGCCGCTCAGGCTGTCCATCGCAACGTC
CTCCAACAGACCGGCCACTCGACCGGCTCAAATCTCGGGACCTGGAACGGTCCCTCGAGCTCGAATTGGGGCGGC
CAAGGCACTGGCACAGGAAACTCTAAGCATAACACTGGTAGCAGTCGCTACTACTCTTTCAGCACTGCAGGAAGA
GCGGTCTCGCAGGCCAACGCAGTCTCTGCCAATGTCGACGGTTCGTTCGCCTCGGACGAAAATGACGAGCCCACG
TCACGTCGCGTCGTCGTAATTTCATCATCATCTCAATCAAAGCGAGCTCGGATACGCAGCTCGAGTGCAACATTA
ACAAATGCGGAATCGTTAGGCGTTCTCAAGGCTCTGCAGCTTCGTAGGCGTTCGCGGTTCTTACATACGTCGATA
GAAGCTGTAGCGCTGTCTCAACCTGCACTCATACAGTCATCACCTTCACGACCTCGACGCAATTCTACTTCTTCT
TCTGATGGCTTGGATCGACCGTCTTCGCCTGTGCGAACTTTCACCACTGCTACAGCTGTTGCACCAGAGGCACAG
GATAAGGAGCAGCTCCTTCGTCCCCGCCGGAATTCCACATCTTCCATTGATGACCGAGACAAATTAGCGTTCGAC
TCTTTCCAATCTGTCCTCGACGAGGAGCTTTCGATTCAATCAGGAAACTCAGCGTCGTCCATCGACGACCACGAG
CTCAACGATGTTTCTTCTATCGAAACAAAACTTACAACACCATCCGGATCCCCCGAGGCCCCTCTGTCCGATTCC
CCACCCTCTCGTTCTTCTGCTTCAACTTATCCGTTCGAGTATCTCATCGAAGCTAGACTGTCTAGTGATCCCCAT
CGTGTTGCCGAAGCCGTCGCTCGCTTCCGTTCGACTGCTCAGTCCCCCCAAACTGTGGATTTTAACAATGCCCTC
GATGCTATGTATGCTACTCGTAGATCAGAACCCCTGCACGCCATTCTTGAGGTCTACCAGGATATGATCAGTCGC
TCCATCCAGCCCGATGAAAGAACCTTTTCCATCCTCATCCAAAGTGCGGTGGACCGCGATCATGAGTTGGGCCAT
GGGATCAGAGGCATGACTCAGCTTATGCACCGCCAAGGTATCACTGGGGGTGGCATTGACAACAGAGTGCACATG
GGTTTACAGTACAAACTCGAATCGTACTCTTCTGAATACAGGGAAAATTTTGCAACGGTTTTGTCGCTGTACTAT
GCTGCTCGCGTCAATAGTTTCTTCTTCTCACCCGAGCTCTACCTCGAGTTGATCCGTACAACCTCCCGTCACTCC
AACATTGAACTTGCAGAGGAGATATTTCGGCTCGCCCAAGAGAGATGTGGGCATTTACAACCGTATTGCTACCGG
TATATGATTCAGGGCTATGGTCGCGCGGGTGACGCGGTTGCTGCGGAAAGGGTTTTCGAACAGTACAATGTTGCT
GCGCGAGAAGGAAGGCTCTCAGTTGATGATCATACTCTCGGTTATCAAAGGAGCCATATCCTCGTTTGGAATGCC
ATGATCGAGTCGTATTTCCTTTGCGGTCTACCGGACAAGGCGGTTGGTATTTTGGACAAGATGATGAATTCACCC
GCGGATCTTGGCTTCGGAATCGAGGATGTCCCATATCCTGCATCATCTACCTACACCGAAATATTGAAGGGTTTC
GTCGAAGCCGGTGATATCACTACTGCGTGGAGGTGGTACGAGAGGTTATCGGAACAAGGTGTCAAGACAGAAAAT
CATTTTTGGCCGGCAACGCAACCTATCAAACCGGATGGAAGAGCCGATATTCTTATGATTGCAGCTTTGGCCGAG
CGCGGATACATATCCGAACTCAACAAGATCTTTTCCTCCATCGATCACACTTACAAAGACTTGCAAACCGCTCCA
CTGCTCACTTATAAAGCCAACATGGCGGCTCTGAAGAACATCGAATCCGAAGTACATGCAAAGAGGATCTTGAAC
TTTTTGACCATGGAAGTTTTTCCGCGTACCCTGAAGTTGGTTGTAAGGAAGGTTATGATCATCCGGATTGTTATG
GAATATGTGGACAGGAATATGTTCGAAGATGCTCTGGCTTCGTATAAGCATTTTCACGAGTTGATGTTGCAAGAT
ATCAAGGTTAACGAGGAGAGCCAATATTCGCCGCTGTCCTTGACAATGACTTTGCAAGAAGCGTTTAGCAGGATC
CAAGGACCTATGTGGAAGCTACTGGTGGAGAGGAAAAGGTTGAATTGGGATTTCGCTATGCAGTTGATGGCGTGC
GGTAGGGATTTGGGTATCGAGGTGCCGACGGCTATGCAGAAACATGTGTTACATGTGTATGCTCTCGCTAGGGCT
AACAATGAGTTGCCGGTTGAGATGATGACGACGAAGGTTTGGGAACAGCTGTTGATGATCGCCGTAGATGTGGAA
AGTGCCTCCTTTGCTTCGCCGACGTTGTCCGCTCGAGAATACAAAGACGTCCTTGGATACGCTTTTGAGGGCGTA
CAGAGTCTCGTCGAGGATATGGCCAAGCTTCAAGTTCATATCGAGGAACTTCCATCGAGTTTGATGAACAAGACC
ATCCGTCATCTCATATCGGTTTACGGTGGCGATAACGTCGTTCGTACTCTCCAGAAACTCGGTCCCGCTTTTGAA
CGCGCATTGGAAGACAGTGAAGAGATTAGAACCCTGGTTGTCGAGCAGAAATTGGAAAACGTTCCCGAAAACGTT
ATCAATAATGAATTCACGCAAAGGTTGCTGCAGTCTTACGGTAATCTCGTCGTCGACCCGGCTCAATGCAAAGCT
CTTGACGACTTGTTGAGACAAAACAATATTCGCAGCAATGTTCTAGCTGCTTATAATATGTTGAAGAACGGCTTT
GATAATCGCCATGTTCCTTCTCCGAAAGTTATTGGGAAGTTGATCCAGGGTTTGGGAAGGCAAGGGGAGGTCGAA
ATGTTGAACGAGGTCTATGCGATTGCGCAGACGATTCTGGATGGATTGATGTTGGATGCGGAGGAGTCGAGAAGG
GGTCAATATTTCATCGAGGATAATATGGTTATCGCTCTGGCTCATCTTGGAGATATGGACAGTGCGCATAATTTC
AGGATGAGGATACTAGAAAAAGGATATGCTCCTTCGGCCGACGCTTATGGCGCTCTTATCCTTCATCTCAAAGAC
ACTACCGACGATGCTTCAAACGCTCTGGGTTTATACTTTGAAGCTCAGCAGCATAAAGTCAAAATGAACATCTAT
TTCTACAACAACATCATTTCGAAGCTCGCTAAAGCGCGTAAAGCTGATCATGCTTTGGAACTATTTCAAAGAATG
AAAGCGGAGCGTATTTTACCTAGCTCGATTACTTATGGTGCCTTAATCGGTGCTTGTGCTAGAGTTGGAGATGTT
CAAAGTGCGGAGACTTTGTTCGAGGAGATGGAGTCGCGCAGGAATTTCAGACCGAGGGTTCCGCCGTATAATACG
ATGATGCAACTCTATACGATGACGAAACCGAATAGGGAGAGAGTACTCCATTACTTCGATAAGATGTATCAAGCT
GGAGTCAACCCTACGGCCCATACTTACAAGTTGTTGCTTGATGCTTATGGATCTATCGAGCCGGTCGACATTCCT
TCGATGGAAGCCATCTTTGAACAACTCCAAGGAGATCGCGATGTCGACGTTCAGGGAACCCATTATGCTTCCCTT
ATCAATGCCTACGGTTGTATTCAACGCGATTTAGAAAAAGCCCTCTCAATATTCGATTCCGTCCCATCCTCTTCG
ACACCAAACCAACATTCTGTTCTAGACGCTGTTGTGTTCGAATCTCTCGTCAACGTCTTTGTATCTCATCGTCGT
ACGGATCTCATACCCGAGTATATCAACAAGATGATTGGTTTGGGTATTCATATGACCGCATATATTGCCAATTTT
TTGATCAAAGGTTATGCGATTACCGGAGAATTGGAGAAGGCGAGGGAGATCTTTGAGAGCATGGTTGATCCTCCC
ATGGGAGTTGCTGCTCCGAATAATCATGCTCCTCATACTCCTAATGCTGGGAATGCCATCGGGTCTATGGAACCG
GTTTATCGTGAGCCCTCGACTTGGGAAGCTATGGTTAGAGCTGAACTTGGTGCTGGTCATCGTGATCTTGCATTG
GATTTATTAGAGAGGTTGAAATCTCGACAATACCCTGAAGCGGTGTATAACCGTATTAGTGGTGTCTTGGTTGAT
CACTCAACGTTACCCGCATAG
Transcript >AgabiH97|069450
ATGCTCCCAAAAGTCGCGACACATCTCTTCCACACAACCTCTAGGGTAGCCGCTCAGGCTGTCCATCGCAACGTC
CTCCAACAGACCGGCCACTCGACCGGCTCAAATCTCGGGACCTGGAACGGTCCCTCGAGCTCGAATTGGGGCGGC
CAAGGCACTGGCACAGGAAACTCTAAGCATAACACTGGTAGCAGTCGCTACTACTCTTTCAGCACTGCAGGAAGA
GCGGTCTCGCAGGCCAACGCAGTCTCTGCCAATGTCGACGGTTCGTTCGCCTCGGACGAAAATGACGAGCCCACG
TCACGTCGCGTCGTCGTAATTTCATCATCATCTCAATCAAAGCGAGCTCGGATACGCAGCTCGAGTGCAACATTA
ACAAATGCGGAATCGTTAGGCGTTCTCAAGGCTCTGCAGCTTCGTAGGCGTTCGCGGTTCTTACATACGTCGATA
GAAGCTGTAGCGCTGTCTCAACCTGCACTCATACAGTCATCACCTTCACGACCTCGACGCAATTCTACTTCTTCT
TCTGATGGCTTGGATCGACCGTCTTCGCCTGTGCGAACTTTCACCACTGCTACAGCTGTTGCACCAGAGGCACAG
GATAAGGAGCAGCTCCTTCGTCCCCGCCGGAATTCCACATCTTCCATTGATGACCGAGACAAATTAGCGTTCGAC
TCTTTCCAATCTGTCCTCGACGAGGAGCTTTCGATTCAATCAGGAAACTCAGCGTCGTCCATCGACGACCACGAG
CTCAACGATGTTTCTTCTATCGAAACAAAACTTACAACACCATCCGGATCCCCCGAGGCCCCTCTGTCCGATTCC
CCACCCTCTCGTTCTTCTGCTTCAACTTATCCGTTCGAGTATCTCATCGAAGCTAGACTGTCTAGTGATCCCCAT
CGTGTTGCCGAAGCCGTCGCTCGCTTCCGTTCGACTGCTCAGTCCCCCCAAACTGTGGATTTTAACAATGCCCTC
GATGCTATGTATGCTACTCGTAGATCAGAACCCCTGCACGCCATTCTTGAGGTCTACCAGGATATGATCAGTCGC
TCCATCCAGCCCGATGAAAGAACCTTTTCCATCCTCATCCAAAGTGCGGTGGACCGCGATCATGAGTTGGGCCAT
GGGATCAGAGGCATGACTCAGCTTATGCACCGCCAAGGTATCACTGGGGGTGGCATTGACAACAGAGTGCACATG
GGTTTACAGTACAAACTCGAATCGTACTCTTCTGAATACAGGGAAAATTTTGCAACGGTTTTGTCGCTGTACTAT
GCTGCTCGCGTCAATAGTTTCTTCTTCTCACCCGAGCTCTACCTCGAGTTGATCCGTACAACCTCCCGTCACTCC
AACATTGAACTTGCAGAGGAGATATTTCGGCTCGCCCAAGAGAGATGTGGGCATTTACAACCGTATTGCTACCGG
TATATGATTCAGGGCTATGGTCGCGCGGGTGACGCGGTTGCTGCGGAAAGGGTTTTCGAACAGTACAATGTTGCT
GCGCGAGAAGGAAGGCTCTCAGTTGATGATCATACTCTCGGTTATCAAAGGAGCCATATCCTCGTTTGGAATGCC
ATGATCGAGTCGTATTTCCTTTGCGGTCTACCGGACAAGGCGGTTGGTATTTTGGACAAGATGATGAATTCACCC
GCGGATCTTGGCTTCGGAATCGAGGATGTCCCATATCCTGCATCATCTACCTACACCGAAATATTGAAGGGTTTC
GTCGAAGCCGGTGATATCACTACTGCGTGGAGGTGGTACGAGAGGTTATCGGAACAAGGTGTCAAGACAGAAAAT
CATTTTTGGCCGGCAACGCAACCTATCAAACCGGATGGAAGAGCCGATATTCTTATGATTGCAGCTTTGGCCGAG
CGCGGATACATATCCGAACTCAACAAGATCTTTTCCTCCATCGATCACACTTACAAAGACTTGCAAACCGCTCCA
CTGCTCACTTATAAAGCCAACATGGCGGCTCTGAAGAACATCGAATCCGAAGTACATGCAAAGAGGATCTTGAAC
TTTTTGACCATGGAAGTTTTTCCGCGTACCCTGAAGTTGGTTGTAAGGAAGGTTATGATCATCCGGATTGTTATG
GAATATGTGGACAGGAATATGTTCGAAGATGCTCTGGCTTCGTATAAGCATTTTCACGAGTTGATGTTGCAAGAT
ATCAAGGTTAACGAGGAGAGCCAATATTCGCCGCTGTCCTTGACAATGACTTTGCAAGAAGCGTTTAGCAGGATC
CAAGGACCTATGTGGAAGCTACTGGTGGAGAGGAAAAGGTTGAATTGGGATTTCGCTATGCAGTTGATGGCGTGC
GGTAGGGATTTGGGTATCGAGGTGCCGACGGCTATGCAGAAACATGTGTTACATGTGTATGCTCTCGCTAGGGCT
AACAATGAGTTGCCGGTTGAGATGATGACGACGAAGGTTTGGGAACAGCTGTTGATGATCGCCGTAGATGTGGAA
AGTGCCTCCTTTGCTTCGCCGACGTTGTCCGCTCGAGAATACAAAGACGTCCTTGGATACGCTTTTGAGGGCGTA
CAGAGTCTCGTCGAGGATATGGCCAAGCTTCAAGTTCATATCGAGGAACTTCCATCGAGTTTGATGAACAAGACC
ATCCGTCATCTCATATCGGTTTACGGTGGCGATAACGTCGTTCGTACTCTCCAGAAACTCGGTCCCGCTTTTGAA
CGCGCATTGGAAGACAGTGAAGAGATTAGAACCCTGGTTGTCGAGCAGAAATTGGAAAACGTTCCCGAAAACGTT
ATCAATAATGAATTCACGCAAAGGTTGCTGCAGTCTTACGGTAATCTCGTCGTCGACCCGGCTCAATGCAAAGCT
CTTGACGACTTGTTGAGACAAAACAATATTCGCAGCAATGTTCTAGCTGCTTATAATATGTTGAAGAACGGCTTT
GATAATCGCCATGTTCCTTCTCCGAAAGTTATTGGGAAGTTGATCCAGGGTTTGGGAAGGCAAGGGGAGGTCGAA
ATGTTGAACGAGGTCTATGCGATTGCGCAGACGATTCTGGATGGATTGATGTTGGATGCGGAGGAGTCGAGAAGG
GGTCAATATTTCATCGAGGATAATATGGTTATCGCTCTGGCTCATCTTGGAGATATGGACAGTGCGCATAATTTC
AGGATGAGGATACTAGAAAAAGGATATGCTCCTTCGGCCGACGCTTATGGCGCTCTTATCCTTCATCTCAAAGAC
ACTACCGACGATGCTTCAAACGCTCTGGGTTTATACTTTGAAGCTCAGCAGCATAAAGTCAAAATGAACATCTAT
TTCTACAACAACATCATTTCGAAGCTCGCTAAAGCGCGTAAAGCTGATCATGCTTTGGAACTATTTCAAAGAATG
AAAGCGGAGCGTATTTTACCTAGCTCGATTACTTATGGTGCCTTAATCGGTGCTTGTGCTAGAGTTGGAGATGTT
CAAAGTGCGGAGACTTTGTTCGAGGAGATGGAGTCGCGCAGGAATTTCAGACCGAGGGTTCCGCCGTATAATACG
ATGATGCAACTCTATACGATGACGAAACCGAATAGGGAGAGAGTACTCCATTACTTCGATAAGATGTATCAAGCT
GGAGTCAACCCTACGGCCCATACTTACAAGTTGTTGCTTGATGCTTATGGATCTATCGAGCCGGTCGACATTCCT
TCGATGGAAGCCATCTTTGAACAACTCCAAGGAGATCGCGATGTCGACGTTCAGGGAACCCATTATGCTTCCCTT
ATCAATGCCTACGGTTGTATTCAACGCGATTTAGAAAAAGCCCTCTCAATATTCGATTCCGTCCCATCCTCTTCG
ACACCAAACCAACATTCTGTTCTAGACGCTGTTGTGTTCGAATCTCTCGTCAACGTCTTTGTATCTCATCGTCGT
ACGGATCTCATACCCGAGTATATCAACAAGATGATTGGTTTGGGTATTCATATGACCGCATATATTGCCAATTTT
TTGATCAAAGGTTATGCGATTACCGGAGAATTGGAGAAGGCGAGGGAGATCTTTGAGAGCATGGTTGATCCTCCC
ATGGGAGTTGCTGCTCCGAATAATCATGCTCCTCATACTCCTAATGCTGGGAATGCCATCGGGTCTATGGAACCG
GTTTATCGTGAGCCCTCGACTTGGGAAGCTATGGTTAGAGCTGAACTTGGTGCTGGTCATCGTGATCTTGCATTG
GATTTATTAGAGAGGTTGAAATCTCGACAATACCCTGAAGCGGTGTATAACCGTATTAGTGGTGTCTTGGTTGAT
CACTCAACGTTACCCGCATAG
Gene >AgabiH97|069450
ATGCTCCCAAAAGTCGCGACACATCTCTTCCACACAACCTCTAGGGTAGCCGCTCAGGCTGTCCATCGCAACGTC
CTCCAACAGACCGGCCACTCGACCGGCTCAAATCTCGGGACCTGGAACGGTCCCTCGAGCTCGAATTGGGGCGGC
CAAGGCACTGGCACAGGAAACTCTAAGCATAACACTGGTAGCAGTCGCTACTACTCTTTCAGCGTATGTTCGTTT
CATTTTTTGTTGGTGTCTTTTTTCTCAAAGAACAACTTTGTCAGACTGCAGGAAGAGCGGTCTCGCAGGCCAACG
CAGTCTCTGCCAATGTCGACGGTTCGTTCGCCTCGGACGAAAATGACGAGCCCACGTCACGTCGCGTCGTCGTAA
TTTCATCATCATCTCAATCAAAGCGAGCTCGGATACGCAGCTCGAGTGCAACATTAACAAATGCGGAATCGTTAG
GCGTTCTCAAGGCTCTGCAGCTTCGTAGGCGTTCGCGGTTCTTACATACGTCGATAGAAGCTGTAGCGCTGTCTC
AACCTGCACTCATACAGTCATCACCTTCACGACCTCGACGCAATTCTACTTCTTCTTCTGATGGCTTGGATCGAC
CGTCTTCGCCTGTGCGAACTTTCACCACTGCTACAGCTGTTGCACCAGAGGCACAGGATAAGGAGCAGCTCCTTC
GTCCCCGCCGGAATTCCACATCTTCCATTGATGACCGAGACAAATTAGCGTTCGACTCTTTCCAATCTGTCCTCG
ACGAGGAGCTTTCGATTCAATCAGGAAACTCAGCGTCGTCCATCGACGACCACGAGCTCAACGATGTTTCTTCTA
TCGAAACAAAACTTACAACACCATCCGGATCCCCCGAGGCCCCTCTGTCCGATTCCCCACCCTCTCGTTCTTCTG
CTTCAACTTATCCGTTCGAGTATCTCATCGAAGCTAGACTGTCTAGTGATCCCCATCGTGTTGCCGAAGCCGTCG
CTCGCTTCCGTTCGACTGCTCAGTCCCCCCAAACTGTGGATTTTAACAATGCCCTCGATGCTATGTATGCTACTC
GTAGATCAGAACCCCTGCACGCCATTCTTGAGGTCTACCAGGATATGATCAGTCGCTCCATCCAGCCCGATGAAA
GAACCTTTTCCATCCTCATCCAAAGTGCGGTGGACCGCGATCATGAGTTGGGCCATGGGATCAGAGGCATGACTC
AGCTTATGCACCGCCAAGGTATCACTGGGGGTGGCATTGACAACAGAGTGCACATGGGTTTACAGTACAAACTCG
AATCGTACTCTTCTGAATACAGGGAAAATTTTGCAACGGTTTTGTCGCTGTACTATGCTGCTCGCGTCAATAGTT
TCTTCTTCTCACCCGAGCTCTACCTCGAGTTGATCCGTACAACCTCCCGTCACTCCAACATTGAACTTGCAGAGG
AGATATTTCGGCTCGCCCAAGAGAGATGTGGGCATTTACAACCGTATTGCTACCGGTATATGATTCAGGGCTATG
GTCGCGCGGGTGACGCGGTTGCTGCGGAAAGGGTTTTCGAACAGTACAATGTTGCTGCGCGAGAAGGAAGGCTCT
CAGTTGATGATCATACTCTCGGTTATCAAAGGAGCCATATCCTCGTTTGGAATGCCATGATCGAGTCGTATTTCC
TTTGCGGTCTACCGGACAAGGCGGTTGGTATTTTGGACAAGATGATGAATTCACCCGCGGATCTTGGCTTCGGAA
TCGAGGATGTCCCATATCCTGCATCATCTACCTACACCGAAATATTGAAGGGTTTCGTCGAAGCCGGTGATATCA
CTACTGCGTGGAGGTGGTACGAGAGGTTATCGGAACAAGGTGTCAAGACAGAAAATCATTTTTGGCCGGCAACGC
AACCTATCAAACCGGATGGAAGAGCCGATATTCTTATGATTGCAGCTTTGGCCGAGCGCGGATACATATCCGAAC
TCAACAAGATCTTTTCCTCCATCGATCACACTTACAAAGACTTGCAAACCGCTCCACTGCTCACTTATAAAGCCA
ACATGGCGGCTCTGAAGAACATCGAATCCGAAGTACATGCAAAGAGGATCTTGAACTTTTTGACCATGGAAGTTT
TTCCGCGTACCCTGAAGTTGGTTGTAAGGAAGGTTATGATCATCCGGATTGTTATGGAATATGTGGACAGGAATA
TGTTCGAAGATGCTCTGGCTTCGTATAAGCATTTTCACGAGTTGATGTTGCAAGATATCAAGGTTAACGAGGAGA
GCCAATATTCGCCGCTGTCCTTGACAATGACTTTGCAAGAAGCGTTTAGCAGGATCCAAGGACCTATGTGGAAGC
TACTGGTGGAGAGGAAAAGGTTGAATTGGGATTTCGCTATGCAGTTGATGGCGTGCGGTAGGGATTTGGGTATCG
AGGTGCCGACGGCTATGCAGAAACATGTGTTACATGTGTATGCTCTCGCTAGGGCTAACAATGAGTTGCCGGTTG
AGATGATGACGACGAAGGTTTGGGAACAGCTGTTGATGATCGCCGTAGATGTGGAAAGTGCCTCCTTTGCTTCGC
CGACGTTGTCCGCTCGAGAATACAAAGACGTCCTTGGATACGCTTTTGAGGGCGTACAGAGTCTCGTCGAGGATA
TGGCCAAGCTTCAAGTTCATATCGAGGAACTTCCATCGAGTTTGATGAACAAGACCATCCGTCATCTCATATCGG
TTTACGGTGGCGATAACGTCGTTCGTACTCTCCAGAAACTCGGTCCCGCTTTTGAACGCGCATTGGAAGACAGTG
AAGAGATTAGAACCCTGGTTGTCGAGCAGAAATTGGAAAACGTTCCCGAAAACGTTATCAATAATGAATTCACGC
AAAGGTTGCTGCAGTCTTACGGTAATCTCGTCGTCGACCCGGCTCAATGCAAAGCTCTTGACGACTTGTTGAGAC
AAAACAATATTCGCAGCAATGTTCTAGCTGCTTATAATATGTTGAAGAACGGCTTTGATAATCGCCATGTTCCTT
CTCCGAAAGTTATTGGGAAGTTGATCCAGGGTTTGGGAAGGCAAGGGGAGGTCGAAATGTTGAACGAGGTCTATG
CGATTGCGCAGACGATTCTGGATGGATTGATGTTGGATGCGGAGGAGTCGAGAAGGGGTCAATATTTCATCGAGG
ATAATATGGTTATCGCTCTGGCTCATCTTGGAGATATGGACAGTGCGCATAATTTCAGGATGAGGATACTAGAAA
AAGGATATGCTCCTTCGGCCGACGCTTATGGCGCTCTTATCCTTCATCTCAAAGACACTACCGACGATGCTTCAA
ACGCTCTGGGTTTATACTTTGAAGCTCAGCAGCATAAAGTCAAAATGAACATCTATTTCTACAACAACATCATTT
CGAAGCTCGCTAAAGCGCGTAAAGCTGATCATGCTTTGGAACTATTTCAAAGAATGAAAGCGGAGCGTATTTTAC
CTAGCTCGATTACTTATGGTGCCTTAATCGGTGCTTGTGCTAGAGTTGGAGATGTTCAAAGTGCGGAGACTTTGT
TCGAGGAGATGGAGTCGCGCAGGAATTTCAGACCGAGGGTTCCGCCGTATAATACGATGATGCAACTCTATACGA
TGACGAAACCGAATAGGGAGAGAGTACTCCATTACTTCGATAAGATGTATCAAGCTGGAGTCAACCCTACGGCCC
ATACTTACAAGGTAACGTGTTTTCGCAAGGAGGTTTAGAAATTTGGAAAGACTGACCTTTTACGCCTGTAGTTGT
TGCTTGATGCTTATGGATCTATCGAGCCGGTCGACATTCCTTCGATGGAAGCCATCTTTGAACAACTCCAAGGAG
ATCGCGATGTCGACGTTCAGGGAACCCATTATGCTTCCCTTATCAATGCCTACGGTTGTATTCAACGCGATTTAG
AAAAAGCCCTCTCAATATTCGATTCCGTCCCATCCTCTTCGACACCAAACCAACATTCTGTTCTAGACGCTGTTG
TGTTCGAATCTCTCGTCAACGTCTTTGTATCTCATCGTCGTACGGATCTCATACCCGAGTATATCAACAAGATGA
TTGGTTTGGGTATTCATATGACCGCATATATTGCCAATTTTTTGATCAAAGGTTATGCGATTACCGGAGAATTGG
AGAAGGCGAGGGAGATCTTTGAGAGCATGGTTGATCCTCCCATGGGAGTTGCTGCTCCGAATAATCATGCTCCTC
ATACTCCTAATGCTGGGAATGCCATCGGGTCTATGGAACCGGTTTATCGTGAGGTATGTGTTGCGACGATATGAT
TTGGACTTTTGTTGATGTGTACGTGGTTTTTTTCTTTAGCCCTCGACTTGGGAAGCTATGGTTAGAGCTGAACTT
GGTGCTGGTCATCGTGATCTTGCATTGGATTTATTAGAGAGGTTGAAATCTCGGTTCGTCCTATATTTACTCTCT
TTAGTCGTCAGAAAGCCTGACTTTTGATTGTATAGACAATACCCTGAAGCGGTGTATAACCGTATTAGTGGTGTC
TTGGTTGATCACTCAACGTTACCCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail