Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069370
Gene name
Locationscaffold_4:1030854..1032008
Strand+
Gene length (bp)1154
Transcript length (bp)597
Coding sequence length (bp)597
Protein length (aa) 199

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14681 UPRTase Uracil phosphoribosyltransferase 2.9E-70 9 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5H0J4|UPP_LACKL Uracil phosphoribosyltransferase OS=Lachancea kluyveri GN=FUR1 PE=3 SV=1 9 198 2.0E-90
sp|P18562|UPP_YEAST Uracil phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR1 PE=1 SV=2 9 198 5.0E-88
sp|Q55GQ6|UPP_DICDI Uracil phosphoribosyltransferase OS=Dictyostelium discoideum GN=uprt PE=3 SV=1 9 192 2.0E-84
sp|O13867|UPP1_SCHPO Uracil phosphoribosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.01c PE=3 SV=1 9 193 1.0E-82
sp|Q26998|UPP_TOXGO Uracil phosphoribosyltransferase OS=Toxoplasma gondii GN=uprt PE=1 SV=1 9 196 7.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5H0J4|UPP_LACKL Uracil phosphoribosyltransferase OS=Lachancea kluyveri GN=FUR1 PE=3 SV=1 9 198 2.0E-90
sp|P18562|UPP_YEAST Uracil phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR1 PE=1 SV=2 9 198 5.0E-88
sp|Q55GQ6|UPP_DICDI Uracil phosphoribosyltransferase OS=Dictyostelium discoideum GN=uprt PE=3 SV=1 9 192 2.0E-84
sp|O13867|UPP1_SCHPO Uracil phosphoribosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.01c PE=3 SV=1 9 193 1.0E-82
sp|Q26998|UPP_TOXGO Uracil phosphoribosyltransferase OS=Toxoplasma gondii GN=uprt PE=1 SV=1 9 196 7.0E-77
sp|Q9FKS0|UKL1_ARATH Uridine kinase-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=UKL1 PE=1 SV=1 9 196 4.0E-69
sp|Q9LK34|UKL2_ARATH Uridine kinase-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=UKL2 PE=2 SV=1 9 196 1.0E-68
sp|Q8VYB2|UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana GN=UKL3 PE=2 SV=1 9 196 5.0E-67
sp|O65583|UKL4_ARATH Uridine kinase-like protein 4 OS=Arabidopsis thaliana GN=UKL4 PE=2 SV=2 9 196 1.0E-66
sp|Q9LTY6|UKL5_ARATH Uridine kinase-like protein 5 OS=Arabidopsis thaliana GN=UKL5 PE=2 SV=1 9 196 2.0E-65
sp|Q6NYU7|UPP_DANRE Uracil phosphoribosyltransferase homolog OS=Danio rerio GN=uprt PE=2 SV=1 9 174 2.0E-61
sp|B1AVZ0|UPP_MOUSE Uracil phosphoribosyltransferase homolog OS=Mus musculus GN=Uprt PE=1 SV=1 9 174 3.0E-59
sp|Q96BW1|UPP_HUMAN Uracil phosphoribosyltransferase homolog OS=Homo sapiens GN=UPRT PE=1 SV=1 9 174 1.0E-58
sp|Q32LA4|UPP_BOVIN Uracil phosphoribosyltransferase homolog OS=Bos taurus GN=UPRT PE=2 SV=1 9 174 1.0E-58
sp|Q95KB0|UPP_MACFA Uracil phosphoribosyltransferase homolog OS=Macaca fascicularis GN=UPRT PE=2 SV=1 9 174 1.0E-58
sp|Q5ZIJ8|UPP_CHICK Uracil phosphoribosyltransferase homolog OS=Gallus gallus GN=UPRT PE=2 SV=1 9 174 1.0E-57
sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 9 196 3.0E-52
sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 9 196 2.0E-51
sp|Q9HE15|UPP2_SCHPO Uracil phosphoribosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.04c PE=3 SV=1 9 196 5.0E-51
sp|Q55EL3|UCKA_DICDI Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 9 196 7.0E-51
sp|A7ZFB7|UPP_CAMC1 Uracil phosphoribosyltransferase OS=Campylobacter concisus (strain 13826) GN=upp PE=3 SV=1 9 196 2.0E-39
sp|Q8RG35|UPP_FUSNN Uracil phosphoribosyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=upp PE=3 SV=2 11 196 2.0E-38
sp|A7H0F9|UPP_CAMC5 Uracil phosphoribosyltransferase OS=Campylobacter curvus (strain 525.92) GN=upp PE=3 SV=1 9 196 2.0E-38
sp|Q03EK5|UPP_PEDPA Uracil phosphoribosyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=upp PE=3 SV=1 9 196 3.0E-38
sp|B5ZXI2|UPP_RHILW Uracil phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=upp PE=3 SV=1 10 196 3.0E-38
sp|Q92T49|UPP_RHIME Uracil phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=upp PE=3 SV=1 10 196 5.0E-38
sp|B3PXN0|UPP_RHIE6 Uracil phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=upp PE=3 SV=1 10 196 6.0E-38
sp|Q1MMV8|UPP_RHIL3 Uracil phosphoribosyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=upp PE=3 SV=1 10 196 1.0E-37
sp|Q9CEC9|UPP_LACLA Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=upp PE=3 SV=1 10 196 3.0E-37
sp|P50926|UPP_LACLM Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=upp PE=3 SV=1 10 196 3.0E-37
sp|B5YDB8|UPP_DICT6 Uracil phosphoribosyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=upp PE=3 SV=1 9 196 6.0E-37
sp|Q02WM7|UPP_LACLS Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=upp PE=3 SV=1 10 196 6.0E-37
sp|A0RR59|UPP_CAMFF Uracil phosphoribosyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=upp PE=3 SV=1 9 196 6.0E-37
sp|B9J6V7|UPP_AGRRK Uracil phosphoribosyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=upp PE=3 SV=1 10 196 6.0E-37
sp|A4VWM9|UPP_STRSY Uracil phosphoribosyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=upp PE=3 SV=1 12 196 7.0E-37
sp|Q8XXC7|UPP_RALSO Uracil phosphoribosyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=upp PE=3 SV=1 9 196 7.0E-37
sp|A6UET4|UPP_SINMW Uracil phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=upp PE=3 SV=1 10 196 1.0E-36
sp|B8E009|UPP_DICTD Uracil phosphoribosyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=upp PE=3 SV=1 9 196 1.0E-36
sp|A9KIB0|UPP_CLOPH Uracil phosphoribosyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=upp PE=3 SV=1 10 196 1.0E-36
sp|Q5SIQ7|UPP_THET8 Uracil phosphoribosyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=upp PE=3 SV=1 5 196 2.0E-36
sp|Q72J35|UPP_THET2 Uracil phosphoribosyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=upp PE=1 SV=1 5 196 2.0E-36
sp|Q7M8H6|UPP_WOLSU Uracil phosphoribosyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=upp PE=3 SV=1 9 196 3.0E-36
sp|B0K1G2|UPP_THEPX Uracil phosphoribosyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=upp PE=3 SV=1 9 196 5.0E-36
sp|B0K7G1|UPP_THEP3 Uracil phosphoribosyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=upp PE=3 SV=1 9 196 5.0E-36
sp|Q831G0|UPP_ENTFA Uracil phosphoribosyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=upp PE=3 SV=1 22 196 5.0E-36
sp|Q8RD94|UPP_CALS4 Uracil phosphoribosyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=upp PE=3 SV=1 9 196 7.0E-36
sp|Q8UJ06|UPP_AGRFC Uracil phosphoribosyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=upp PE=3 SV=1 10 196 3.0E-35
sp|Q97RQ3|UPP_STRPN Uracil phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=upp PE=3 SV=1 11 196 3.0E-35
sp|Q03QY1|UPP_LACBA Uracil phosphoribosyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=upp PE=3 SV=1 9 196 3.0E-35
sp|B2U8Z0|UPP_RALPJ Uracil phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=upp PE=3 SV=1 9 196 3.0E-35
sp|Q8DQI3|UPP_STRR6 Uracil phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=upp PE=3 SV=2 11 196 3.0E-35
sp|Q8FUZ2|UPP_BRUSU Uracil phosphoribosyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=upp PE=3 SV=2 10 196 4.0E-35
sp|A9WW75|UPP_BRUSI Uracil phosphoribosyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=upp PE=3 SV=1 10 196 4.0E-35
sp|A9MCZ3|UPP_BRUC2 Uracil phosphoribosyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=upp PE=3 SV=1 10 196 4.0E-35
sp|Q8XIC4|UPP_CLOPE Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=upp PE=3 SV=1 9 196 4.0E-35
sp|Q0TNB4|UPP_CLOP1 Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=upp PE=3 SV=1 9 196 4.0E-35
sp|Q576P9|UPP_BRUAB Uracil phosphoribosyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=upp PE=3 SV=1 10 196 4.0E-35
sp|B2SC51|UPP_BRUA1 Uracil phosphoribosyltransferase OS=Brucella abortus (strain S19) GN=upp PE=3 SV=1 10 196 4.0E-35
sp|Q8YDE5|UPP_BRUME Uracil phosphoribosyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=upp PE=3 SV=1 10 196 4.0E-35
sp|C0RMK4|UPP_BRUMB Uracil phosphoribosyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=upp PE=3 SV=1 10 196 4.0E-35
sp|Q8EUA1|UPP_MYCPE Uracil phosphoribosyltransferase OS=Mycoplasma penetrans (strain HF-2) GN=upp PE=3 SV=1 11 194 4.0E-35
sp|A5VVW9|UPP_BRUO2 Uracil phosphoribosyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=upp PE=3 SV=1 10 196 5.0E-35
sp|Q1WUD3|UPP_LACS1 Uracil phosphoribosyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=upp PE=3 SV=1 9 196 5.0E-35
sp|Q9WZI0|UPP_THEMA Uracil phosphoribosyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=upp PE=1 SV=1 9 196 6.0E-35
sp|Q0SQY5|UPP_CLOPS Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=upp PE=3 SV=1 9 196 6.0E-35
sp|P67399|UPP_STRA5 Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=upp PE=3 SV=1 12 196 7.0E-35
sp|P67398|UPP_STRA3 Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=upp PE=3 SV=1 12 196 7.0E-35
sp|Q3JZU9|UPP_STRA1 Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=upp PE=3 SV=1 12 196 7.0E-35
sp|C3MBH2|UPP_RHISN Uracil phosphoribosyltransferase OS=Rhizobium sp. (strain NGR234) GN=upp PE=3 SV=1 10 196 8.0E-35
sp|A6WYH9|UPP_OCHA4 Uracil phosphoribosyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=upp PE=3 SV=1 10 196 8.0E-35
sp|B2TJY9|UPP_CLOBB Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=upp PE=3 SV=1 10 196 1.0E-34
sp|B2UZI9|UPP_CLOBA Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=upp PE=3 SV=1 10 196 1.0E-34
sp|B1L7Y5|UPP_THESQ Uracil phosphoribosyltransferase OS=Thermotoga sp. (strain RQ2) GN=upp PE=3 SV=1 9 196 1.0E-34
sp|A5IJ64|UPP_THEP1 Uracil phosphoribosyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=upp PE=3 SV=1 9 196 1.0E-34
sp|B2G680|UPP_LACRJ Uracil phosphoribosyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=upp PE=3 SV=1 24 196 2.0E-34
sp|A5VIQ0|UPP_LACRD Uracil phosphoribosyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=upp PE=3 SV=1 24 196 2.0E-34
sp|B1KSR7|UPP_CLOBM Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=upp PE=3 SV=1 9 196 2.0E-34
sp|A7G9P8|UPP_CLOBL Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=upp PE=3 SV=1 9 196 2.0E-34
sp|B1IE69|UPP_CLOBK Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=upp PE=3 SV=1 9 196 2.0E-34
sp|C1FQA3|UPP_CLOBJ Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=upp PE=3 SV=1 9 196 2.0E-34
sp|A5HY41|UPP_CLOBH Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=upp PE=3 SV=1 9 196 2.0E-34
sp|C3KYI1|UPP_CLOB6 Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=upp PE=3 SV=1 9 196 2.0E-34
sp|A7FQG8|UPP_CLOB1 Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=upp PE=3 SV=1 9 196 2.0E-34
sp|B2GAT5|UPP_LACF3 Uracil phosphoribosyltransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=upp PE=3 SV=1 9 196 2.0E-34
sp|Q5WB67|UPP_BACSK Uracil phosphoribosyltransferase OS=Bacillus clausii (strain KSM-K16) GN=upp PE=3 SV=1 5 196 2.0E-34
sp|B9JYP9|UPP_AGRVS Uracil phosphoribosyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=upp PE=3 SV=1 10 196 2.0E-34
sp|Q8DST6|UPP_STRMU Uracil phosphoribosyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=upp PE=3 SV=1 10 196 2.0E-34
sp|Q9K6G5|UPP_BACHD Uracil phosphoribosyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=upp PE=3 SV=1 5 196 2.0E-34
sp|A8FIC0|UPP_BACP2 Uracil phosphoribosyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=upp PE=3 SV=1 5 196 2.0E-34
sp|C0Z818|UPP_BREBN Uracil phosphoribosyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=upp PE=3 SV=1 5 196 2.0E-34
sp|Q2ST42|UPP_MYCCT Uracil phosphoribosyltransferase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=upp PE=3 SV=1 11 196 2.0E-34
sp|B3WDL1|UPP_LACCB Uracil phosphoribosyltransferase OS=Lactobacillus casei (strain BL23) GN=upp PE=3 SV=1 9 196 3.0E-34
sp|Q03A25|UPP_LACC3 Uracil phosphoribosyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=upp PE=3 SV=1 9 196 3.0E-34
sp|Q65DW6|UPP_BACLD Uracil phosphoribosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=upp PE=3 SV=1 5 196 3.0E-34
sp|A3CPK9|UPP_STRSV Uracil phosphoribosyltransferase OS=Streptococcus sanguinis (strain SK36) GN=upp PE=3 SV=1 11 196 5.0E-34
sp|Q5WUK0|UPP_LEGPL Uracil phosphoribosyltransferase OS=Legionella pneumophila (strain Lens) GN=upp PE=3 SV=1 10 196 6.0E-34
sp|Q5X340|UPP_LEGPA Uracil phosphoribosyltransferase OS=Legionella pneumophila (strain Paris) GN=upp PE=3 SV=1 10 196 6.0E-34
sp|A8AYQ0|UPP_STRGC Uracil phosphoribosyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=upp PE=3 SV=1 11 196 6.0E-34
sp|Q180X8|UPP_PEPD6 Uracil phosphoribosyltransferase OS=Peptoclostridium difficile (strain 630) GN=upp PE=3 SV=1 3 196 1.0E-33
sp|Q38WJ8|UPP_LACSS Uracil phosphoribosyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=upp PE=3 SV=1 9 196 1.0E-33
sp|Q93CX7|UPP_LACSK Uracil phosphoribosyltransferase OS=Lactobacillus sakei GN=upp PE=3 SV=1 9 196 1.0E-33
sp|P0DH35|UPP_STRPQ Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=upp PE=3 SV=1 10 196 1.0E-33
sp|Q48V26|UPP_STRPM Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=upp PE=3 SV=1 10 196 1.0E-33
sp|A2RG73|UPP_STRPG Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=upp PE=3 SV=1 10 196 1.0E-33
sp|Q1J888|UPP_STRPF Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=upp PE=3 SV=1 10 196 1.0E-33
sp|Q1JID6|UPP_STRPD Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=upp PE=3 SV=1 10 196 1.0E-33
sp|Q1JN85|UPP_STRPC Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=upp PE=3 SV=1 10 196 1.0E-33
sp|P67402|UPP_STRP8 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=upp PE=3 SV=1 10 196 1.0E-33
sp|Q5XDM5|UPP_STRP6 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=upp PE=3 SV=1 10 196 1.0E-33
sp|P0DH34|UPP_STRP3 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=upp PE=3 SV=1 10 196 1.0E-33
sp|P67400|UPP_STRP1 Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M1 GN=upp PE=3 SV=1 10 196 1.0E-33
sp|P36399|UPP_STRSL Uracil phosphoribosyltransferase OS=Streptococcus salivarius GN=upp PE=3 SV=1 10 196 1.0E-33
sp|B0S2A9|UPP_FINM2 Uracil phosphoribosyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=upp PE=3 SV=1 9 196 2.0E-33
sp|B1JW40|UPP_BURCC Uracil phosphoribosyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=upp PE=3 SV=1 9 196 2.0E-33
sp|B1YU48|UPP_BURA4 Uracil phosphoribosyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=upp PE=3 SV=1 9 196 2.0E-33
sp|Q5ZTB9|UPP_LEGPH Uracil phosphoribosyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=upp PE=3 SV=1 10 196 2.0E-33
sp|A5IE48|UPP_LEGPC Uracil phosphoribosyltransferase OS=Legionella pneumophila (strain Corby) GN=upp PE=3 SV=1 10 196 2.0E-33
sp|B5XJZ7|UPP_STRPZ Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=upp PE=3 SV=1 10 196 3.0E-33
sp|Q0BD86|UPP_BURCM Uracil phosphoribosyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=upp PE=3 SV=1 9 196 3.0E-33
sp|Q03M79|UPP_STRTD Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=upp PE=3 SV=1 10 196 4.0E-33
sp|Q5M5U5|UPP_STRT2 Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=upp PE=3 SV=1 10 196 4.0E-33
sp|Q5M1A9|UPP_STRT1 Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=upp PE=3 SV=1 10 196 4.0E-33
sp|B4E5R5|UPP_BURCJ Uracil phosphoribosyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=upp PE=3 SV=1 9 196 4.0E-33
sp|A7Z9Q8|UPP_BACMF Uracil phosphoribosyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=upp PE=3 SV=1 5 196 4.0E-33
sp|Q6F210|UPP_MESFL Uracil phosphoribosyltransferase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=upp PE=3 SV=1 10 196 5.0E-33
sp|B9DTU7|UPP_STRU0 Uracil phosphoribosyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=upp PE=3 SV=1 10 196 6.0E-33
sp|Q5KUI3|UPP_GEOKA Uracil phosphoribosyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=upp PE=3 SV=1 5 196 6.0E-33
sp|P39149|UPP_BACSU Uracil phosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=upp PE=3 SV=1 5 196 6.0E-33
sp|B1YEG7|UPP_EXIS2 Uracil phosphoribosyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=upp PE=3 SV=1 11 196 6.0E-33
sp|C0MGT4|UPP_STRS7 Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=upp PE=3 SV=1 10 196 7.0E-33
sp|B4U4M9|UPP_STREM Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=upp PE=3 SV=1 10 196 7.0E-33
sp|C0M7M9|UPP_STRE4 Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=upp PE=3 SV=1 10 196 7.0E-33
sp|B9KAQ6|UPP_THENN Uracil phosphoribosyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=upp PE=3 SV=1 9 196 8.0E-33
sp|B2A3H5|UPP_NATTJ Uracil phosphoribosyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=upp PE=3 SV=1 9 196 8.0E-33
sp|A0Q306|UPP_CLONN Uracil phosphoribosyltransferase OS=Clostridium novyi (strain NT) GN=upp PE=3 SV=1 9 196 9.0E-33
sp|A7NRA6|UPP_ROSCS Uracil phosphoribosyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=upp PE=3 SV=1 27 196 1.0E-32
sp|C4KYT2|UPP_EXISA Uracil phosphoribosyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=upp PE=3 SV=1 11 196 2.0E-32
sp|Q6HAX0|UPP_BACHK Uracil phosphoribosyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|Q630T4|UPP_BACCZ Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|Q814V3|UPP_BACCR Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|B9IRU7|UPP_BACCQ Uracil phosphoribosyltransferase OS=Bacillus cereus (strain Q1) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|B7HY75|UPP_BACC7 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain AH187) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|B7HFL2|UPP_BACC4 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain B4264) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|C1F0N8|UPP_BACC3 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain 03BB102) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|B7IQW8|UPP_BACC2 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain G9842) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|Q72XD8|UPP_BACC1 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|B7JGP0|UPP_BACC0 Uracil phosphoribosyltransferase OS=Bacillus cereus (strain AH820) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|Q81JY5|UPP_BACAN Uracil phosphoribosyltransferase OS=Bacillus anthracis GN=upp PE=3 SV=1 5 196 2.0E-32
sp|C3LFI9|UPP_BACAC Uracil phosphoribosyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|C3P1G4|UPP_BACAA Uracil phosphoribosyltransferase OS=Bacillus anthracis (strain A0248) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|B5ZAU8|UPP_UREU1 Uracil phosphoribosyltransferase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=upp PE=3 SV=1 22 196 2.0E-32
sp|B1HM47|UPP_LYSSC Uracil phosphoribosyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|B7GMG3|UPP_ANOFW Uracil phosphoribosyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|A5UQV0|UPP_ROSS1 Uracil phosphoribosyltransferase OS=Roseiflexus sp. (strain RS-1) GN=upp PE=3 SV=1 27 196 2.0E-32
sp|Q2SZS9|UPP_BURTA Uracil phosphoribosyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=upp PE=3 SV=1 9 196 2.0E-32
sp|A9VSB3|UPP_BACWK Uracil phosphoribosyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|A0RLA2|UPP_BACAH Uracil phosphoribosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=upp PE=3 SV=1 5 196 2.0E-32
sp|B6IW12|UPP_RHOCS Uracil phosphoribosyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=upp PE=3 SV=1 9 196 2.0E-32
sp|Q39EA2|UPP_BURL3 Uracil phosphoribosyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=upp PE=3 SV=1 9 196 2.0E-32
sp|A9AJK1|UPP_BURM1 Uracil phosphoribosyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=upp PE=3 SV=1 9 196 3.0E-32
sp|C4Z9S1|UPP_EUBR3 Uracil phosphoribosyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=upp PE=3 SV=1 11 196 3.0E-32
sp|C5D9M4|UPP_GEOSW Uracil phosphoribosyltransferase OS=Geobacillus sp. (strain WCH70) GN=upp PE=3 SV=1 5 196 3.0E-32
sp|B0TI63|UPP_HELMI Uracil phosphoribosyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=upp PE=3 SV=1 10 196 3.0E-32
sp|Q9PR28|UPP_UREPA Uracil phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=upp PE=3 SV=1 22 196 4.0E-32
sp|B1AIA5|UPP_UREP2 Uracil phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=upp PE=3 SV=1 22 196 4.0E-32
sp|A3DIL9|UPP_CLOTH Uracil phosphoribosyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=upp PE=3 SV=1 3 196 5.0E-32
sp|Q63VS8|UPP_BURPS Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=upp PE=1 SV=1 9 196 5.0E-32
sp|Q3JUF6|UPP_BURP1 Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=upp PE=3 SV=1 9 196 5.0E-32
sp|A3NT50|UPP_BURP0 Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=upp PE=3 SV=1 9 196 5.0E-32
sp|A1V2G4|UPP_BURMS Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain SAVP1) GN=upp PE=3 SV=1 9 196 5.0E-32
sp|Q62IJ1|UPP_BURMA Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=upp PE=3 SV=1 9 196 5.0E-32
sp|A2S4B1|UPP_BURM9 Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=upp PE=3 SV=1 9 196 5.0E-32
sp|A3MI49|UPP_BURM7 Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=upp PE=3 SV=1 9 196 5.0E-32
sp|A4JGH4|UPP_BURVG Uracil phosphoribosyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=upp PE=3 SV=1 9 196 5.0E-32
sp|Q8EM74|UPP_OCEIH Uracil phosphoribosyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=upp PE=3 SV=1 5 196 5.0E-32
sp|Q6MS86|UPP_MYCMS Uracil phosphoribosyltransferase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=upp PE=3 SV=2 11 196 8.0E-32
sp|A3N7G1|UPP_BURP6 Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 668) GN=upp PE=3 SV=1 9 196 9.0E-32
sp|A5N3J1|UPP_CLOK5 Uracil phosphoribosyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=upp PE=3 SV=1 9 196 1.0E-31
sp|B9DX75|UPP_CLOK1 Uracil phosphoribosyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=upp PE=3 SV=1 9 196 1.0E-31
sp|P67397|UPP_STAAW Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|A8YY79|UPP_STAAT Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|Q6G7J8|UPP_STAAS Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|Q6GEW3|UPP_STAAR Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|P67396|UPP_STAAN Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=upp PE=1 SV=1 5 196 1.0E-31
sp|P67395|UPP_STAAM Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|A6QIV6|UPP_STAAE Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Newman) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|Q5HE88|UPP_STAAC Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|Q2YUJ2|UPP_STAAB Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|A5IUQ7|UPP_STAA9 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain JH9) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|Q2FWE6|UPP_STAA8 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|Q2FF16|UPP_STAA3 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|A6U3J7|UPP_STAA2 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain JH1) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|A7X4V6|UPP_STAA1 Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=upp PE=3 SV=1 5 196 1.0E-31
sp|Q9RE01|UPP_LACPL Uracil phosphoribosyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=upp PE=3 SV=1 22 196 1.0E-31
sp|B2JE33|UPP_BURP8 Uracil phosphoribosyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=upp PE=3 SV=1 9 196 1.0E-31
sp|A7GV65|UPP_BACCN Uracil phosphoribosyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=upp PE=3 SV=1 5 196 2.0E-31
sp|Q1DG16|UPP_MYXXD Uracil phosphoribosyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=upp PE=3 SV=1 11 196 2.0E-31
sp|A6LMU0|UPP_THEM4 Uracil phosphoribosyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=upp PE=3 SV=1 3 196 2.0E-31
sp|Q98GV3|UPP_RHILO Uracil phosphoribosyltransferase OS=Rhizobium loti (strain MAFF303099) GN=upp PE=3 SV=1 59 196 2.0E-31
sp|Q6FE58|UPP_ACIAD Uracil phosphoribosyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=upp PE=3 SV=2 11 196 3.0E-31
sp|Q8CRN4|UPP_STAES Uracil phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=upp PE=3 SV=1 5 196 3.0E-31
sp|Q5HMB1|UPP_STAEQ Uracil phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=upp PE=3 SV=1 5 196 3.0E-31
sp|P47276|UPP_MYCGE Uracil phosphoribosyltransferase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=upp PE=3 SV=1 9 196 4.0E-31
sp|Q04DP1|UPP_OENOB Uracil phosphoribosyltransferase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=upp PE=3 SV=1 9 196 6.0E-31
sp|Q898X9|UPP_CLOTE Uracil phosphoribosyltransferase OS=Clostridium tetani (strain Massachusetts / E88) GN=upp PE=3 SV=1 9 196 6.0E-31
sp|A6TK51|UPP_ALKMQ Uracil phosphoribosyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=upp PE=3 SV=1 9 196 7.0E-31
sp|A1B467|UPP_PARDP Uracil phosphoribosyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=upp PE=3 SV=1 3 196 8.0E-31
sp|A1W0S0|UPP_CAMJJ Uracil phosphoribosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=upp PE=3 SV=1 6 196 9.0E-31
sp|A8FMZ1|UPP_CAMJ8 Uracil phosphoribosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=upp PE=3 SV=1 6 196 9.0E-31
sp|A9NEQ2|UPP_ACHLI Uracil phosphoribosyltransferase OS=Acholeplasma laidlawii (strain PG-8A) GN=upp PE=3 SV=1 3 196 1.0E-30
sp|Q9PN13|UPP_CAMJE Uracil phosphoribosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=upp PE=3 SV=1 6 196 1.0E-30
sp|P70881|UPP_BACCL Uracil phosphoribosyltransferase OS=Bacillus caldolyticus GN=upp PE=1 SV=2 5 196 1.0E-30
sp|B9DMF2|UPP_STACT Uracil phosphoribosyltransferase OS=Staphylococcus carnosus (strain TM300) GN=upp PE=3 SV=1 5 196 1.0E-30
sp|Q97F73|UPP_CLOAB Uracil phosphoribosyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=upp PE=3 SV=1 9 196 1.0E-30
sp|Q0SK44|UPP_RHOJR Uracil phosphoribosyltransferase OS=Rhodococcus jostii (strain RHA1) GN=upp PE=3 SV=1 10 196 1.0E-30
sp|B7IDR9|UPP_THEAB Uracil phosphoribosyltransferase OS=Thermosipho africanus (strain TCF52B) GN=upp PE=3 SV=1 11 196 2.0E-30
sp|B8IZH6|UPP_DESDA Uracil phosphoribosyltransferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=upp PE=3 SV=1 10 196 2.0E-30
sp|A3M2R1|UPP_ACIBT Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=upp PE=3 SV=2 7 196 2.0E-30
sp|B0V8B1|UPP_ACIBY Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain AYE) GN=upp PE=3 SV=1 7 196 2.0E-30
sp|B0VU43|UPP_ACIBS Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain SDF) GN=upp PE=3 SV=1 7 196 2.0E-30
sp|B2HU54|UPP_ACIBC Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=upp PE=3 SV=1 7 196 2.0E-30
sp|B7I752|UPP_ACIB5 Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=upp PE=3 SV=1 7 196 2.0E-30
sp|B7GZA8|UPP_ACIB3 Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=upp PE=3 SV=1 7 196 2.0E-30
sp|B9E8F4|UPP_MACCJ Uracil phosphoribosyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=upp PE=3 SV=1 59 196 4.0E-30
sp|Q142L5|UPP_BURXL Uracil phosphoribosyltransferase OS=Burkholderia xenovorans (strain LB400) GN=upp PE=3 SV=1 9 196 4.0E-30
sp|B2T2A6|UPP_BURPP Uracil phosphoribosyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=upp PE=3 SV=1 9 196 5.0E-30
sp|Q927V5|UPP_LISIN Uracil phosphoribosyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=upp PE=3 SV=1 9 196 5.0E-30
sp|A6LQG6|UPP_CLOB8 Uracil phosphoribosyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=upp PE=3 SV=1 9 196 5.0E-30
sp|A0ALM3|UPP_LISW6 Uracil phosphoribosyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=upp PE=3 SV=1 9 196 5.0E-30
sp|Q8Y4B3|UPP_LISMO Uracil phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=upp PE=3 SV=1 9 196 5.0E-30
sp|B8DBH1|UPP_LISMH Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=upp PE=3 SV=1 9 196 5.0E-30
sp|Q71WP0|UPP_LISMF Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=upp PE=3 SV=1 9 196 5.0E-30
sp|C1KYV5|UPP_LISMC Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=upp PE=3 SV=1 9 196 5.0E-30
sp|Q9RU32|UPP_DEIRA Uracil phosphoribosyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=upp PE=3 SV=1 3 196 5.0E-30
sp|Q67TC9|UPP_SYMTH Uracil phosphoribosyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=upp PE=3 SV=1 9 196 6.0E-30
sp|A7HJR3|UPP_FERNB Uracil phosphoribosyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=upp PE=3 SV=1 10 196 6.0E-30
sp|B9MJ16|UPP_ACIET Uracil phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=upp PE=3 SV=1 3 196 7.0E-30
sp|Q04BB0|UPP_LACDB Uracil phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=upp PE=3 SV=1 10 196 9.0E-30
sp|Q1GAX2|UPP_LACDA Uracil phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=upp PE=3 SV=1 10 196 9.0E-30
sp|A1W748|UPP_ACISJ Uracil phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=upp PE=3 SV=1 10 196 9.0E-30
sp|A1R2Y2|UPP_ARTAT Uracil phosphoribosyltransferase OS=Arthrobacter aurescens (strain TC1) GN=upp PE=3 SV=1 9 196 1.0E-29
sp|Q5HTC1|UPP_CAMJR Uracil phosphoribosyltransferase OS=Campylobacter jejuni (strain RM1221) GN=upp PE=3 SV=1 6 196 2.0E-29
sp|Q24MM7|UPP_DESHY Uracil phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=upp PE=3 SV=1 9 196 2.0E-29
sp|B8FZ68|UPP_DESHD Uracil phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=upp PE=3 SV=1 9 196 2.0E-29
sp|Q9A627|UPP_CAUCR Uracil phosphoribosyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=upp PE=3 SV=1 9 196 2.0E-29
sp|B8GYP3|UPP_CAUCN Uracil phosphoribosyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=upp PE=3 SV=1 9 196 2.0E-29
sp|C1ARF7|UPP_RHOOB Uracil phosphoribosyltransferase OS=Rhodococcus opacus (strain B4) GN=upp PE=3 SV=1 10 196 2.0E-29
sp|B8I567|UPP_CLOCE Uracil phosphoribosyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=upp PE=3 SV=1 3 196 2.0E-29
sp|Q5MZF4|UPP_SYNP6 Uracil phosphoribosyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=upp PE=3 SV=1 9 196 3.0E-29
sp|Q31MH4|UPP_SYNE7 Uracil phosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=upp PE=3 SV=1 9 196 3.0E-29
sp|Q4L7Z3|UPP_STAHJ Uracil phosphoribosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=upp PE=3 SV=1 5 196 3.0E-29
sp|A8MJX1|UPP_ALKOO Uracil phosphoribosyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=upp PE=3 SV=1 3 196 3.0E-29
sp|C4XJX5|UPP_DESMR Uracil phosphoribosyltransferase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=upp PE=3 SV=1 9 196 5.0E-29
sp|B0T2R0|UPP_CAUSK Uracil phosphoribosyltransferase OS=Caulobacter sp. (strain K31) GN=upp PE=3 SV=1 9 196 6.0E-29
sp|A4WMQ7|UPP_PYRAR Uracil phosphoribosyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=upp PE=3 SV=1 9 197 7.0E-29
sp|A9BWD4|UPP_DELAS Uracil phosphoribosyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=upp PE=3 SV=1 10 196 7.0E-29
sp|C5CLM9|UPP_VARPS Uracil phosphoribosyltransferase OS=Variovorax paradoxus (strain S110) GN=upp PE=3 SV=1 10 196 7.0E-29
sp|A5CNC6|UPP_CLAM3 Uracil phosphoribosyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=upp PE=3 SV=1 9 196 1.0E-28
sp|Q49Z59|UPP_STAS1 Uracil phosphoribosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=upp PE=3 SV=1 5 196 1.0E-28
sp|C4LC66|UPP_TOLAT Uracil phosphoribosyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=upp PE=3 SV=1 59 196 1.0E-28
sp|B8HCL2|UPP_ARTCA Uracil phosphoribosyltransferase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=upp PE=3 SV=1 9 196 1.0E-28
sp|Q9PJJ6|UPP_CHLMU Uracil phosphoribosyltransferase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=upp PE=3 SV=1 59 194 2.0E-28
sp|Q7NBH2|UPP_MYCGA Uracil phosphoribosyltransferase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=upp PE=3 SV=2 43 196 2.0E-28
sp|Q9RGY8|UPP_LACAC Uracil phosphoribosyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=upp PE=3 SV=2 10 196 2.0E-28
sp|B6EJU2|UPP_ALISL Uracil phosphoribosyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=upp PE=3 SV=1 59 196 2.0E-28
sp|Q6LN74|UPP_PHOPR Uracil phosphoribosyltransferase OS=Photobacterium profundum GN=upp PE=3 SV=1 59 196 2.0E-28
sp|A0KM23|UPP_AERHH Uracil phosphoribosyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=upp PE=3 SV=1 59 196 3.0E-28
sp|Q87MH1|UPP_VIBPA Uracil phosphoribosyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=upp PE=3 SV=1 59 196 3.0E-28
sp|Q2S320|UPP_SALRD Uracil phosphoribosyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=upp PE=3 SV=1 10 194 3.0E-28
sp|A1JKZ8|UPP_YERE8 Uracil phosphoribosyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=upp PE=3 SV=1 59 196 3.0E-28
sp|A0JSM6|UPP_ARTS2 Uracil phosphoribosyltransferase OS=Arthrobacter sp. (strain FB24) GN=upp PE=3 SV=1 9 196 4.0E-28
sp|Q6AQH2|UPP_DESPS Uracil phosphoribosyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=upp PE=3 SV=1 6 196 4.0E-28
sp|Q042K8|UPP_LACGA Uracil phosphoribosyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=upp PE=3 SV=1 10 196 4.0E-28
sp|B1JSF5|UPP_YERPY Uracil phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=upp PE=3 SV=1 59 196 4.0E-28
sp|Q668E6|UPP_YERPS Uracil phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=upp PE=3 SV=1 59 196 4.0E-28
sp|A4TMP2|UPP_YERPP Uracil phosphoribosyltransferase OS=Yersinia pestis (strain Pestoides F) GN=upp PE=3 SV=1 59 196 4.0E-28
sp|Q1CK39|UPP_YERPN Uracil phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=upp PE=3 SV=1 59 196 4.0E-28
sp|A9QZW6|UPP_YERPG Uracil phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=upp PE=3 SV=1 59 196 4.0E-28
sp|Q8ZCX9|UPP_YERPE Uracil phosphoribosyltransferase OS=Yersinia pestis GN=upp PE=3 SV=1 59 196 4.0E-28
sp|B2K9J9|UPP_YERPB Uracil phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=upp PE=3 SV=1 59 196 4.0E-28
sp|Q1C5P3|UPP_YERPA Uracil phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=upp PE=3 SV=1 59 196 4.0E-28
sp|A7FG38|UPP_YERP3 Uracil phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=upp PE=3 SV=1 59 196 4.0E-28
sp|B2HDV9|UPP_MYCMM Uracil phosphoribosyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=upp PE=3 SV=1 9 196 5.0E-28
sp|A4SL29|UPP_AERS4 Uracil phosphoribosyltransferase OS=Aeromonas salmonicida (strain A449) GN=upp PE=3 SV=1 59 196 6.0E-28
sp|C3LPM9|UPP_VIBCM Uracil phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=upp PE=3 SV=1 59 196 6.0E-28
sp|A5F642|UPP_VIBC3 Uracil phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=upp PE=3 SV=1 59 196 6.0E-28
sp|Q3BS29|UPP_XANC5 Uracil phosphoribosyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=upp PE=3 SV=1 59 196 6.0E-28
sp|Q6D7S0|UPP_PECAS Uracil phosphoribosyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=upp PE=3 SV=1 59 196 6.0E-28
sp|A1WQN5|UPP_VEREI Uracil phosphoribosyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=upp PE=3 SV=1 10 196 7.0E-28
sp|O67914|UPP_AQUAE Uracil phosphoribosyltransferase OS=Aquifex aeolicus (strain VF5) GN=upp PE=1 SV=1 27 198 7.0E-28
sp|C6DBR1|UPP_PECCP Uracil phosphoribosyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=upp PE=3 SV=1 59 196 8.0E-28
sp|Q2NS69|UPP_SODGM Uracil phosphoribosyltransferase OS=Sodalis glossinidius (strain morsitans) GN=upp PE=3 SV=1 59 196 8.0E-28
sp|Q6KHA6|UPP_MYCMO Uracil phosphoribosyltransferase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=upp PE=3 SV=1 9 196 9.0E-28
sp|A8YUJ4|UPP_LACH4 Uracil phosphoribosyltransferase OS=Lactobacillus helveticus (strain DPC 4571) GN=upp PE=3 SV=1 10 196 9.0E-28
sp|A1VN11|UPP_POLNA Uracil phosphoribosyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=upp PE=3 SV=1 10 196 9.0E-28
sp|B3E677|UPP_GEOLS Uracil phosphoribosyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=upp PE=3 SV=1 7 196 9.0E-28
sp|Q82FS4|UPP_STRAW Uracil phosphoribosyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=upp PE=3 SV=1 9 196 1.0E-27
sp|C5BHQ5|UPP_EDWI9 Uracil phosphoribosyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|C6BSG3|UPP_DESAD Uracil phosphoribosyltransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=upp PE=3 SV=1 6 196 1.0E-27
sp|B5FGY4|UPP_VIBFM Uracil phosphoribosyltransferase OS=Vibrio fischeri (strain MJ11) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|B7LKE4|UPP_ESCF3 Uracil phosphoribosyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|A4WD70|UPP_ENT38 Uracil phosphoribosyltransferase OS=Enterobacter sp. (strain 638) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|P0A2M5|UPP_SALTY Uracil phosphoribosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|P0A2M6|UPP_SALTI Uracil phosphoribosyltransferase OS=Salmonella typhi GN=upp PE=3 SV=1 59 196 1.0E-27
sp|B4TR74|UPP_SALSV Uracil phosphoribosyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|B5BB06|UPP_SALPK Uracil phosphoribosyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|C0PYQ8|UPP_SALPC Uracil phosphoribosyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|A9N2Y1|UPP_SALPB Uracil phosphoribosyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|Q5PNJ7|UPP_SALPA Uracil phosphoribosyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|B4T0M7|UPP_SALNS Uracil phosphoribosyltransferase OS=Salmonella newport (strain SL254) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|B4TD73|UPP_SALHS Uracil phosphoribosyltransferase OS=Salmonella heidelberg (strain SL476) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|B5RCX0|UPP_SALG2 Uracil phosphoribosyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|B5R560|UPP_SALEP Uracil phosphoribosyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|B5FQJ0|UPP_SALDC Uracil phosphoribosyltransferase OS=Salmonella dublin (strain CT_02021853) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|Q57LL1|UPP_SALCH Uracil phosphoribosyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|A9MHP1|UPP_SALAR Uracil phosphoribosyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|B5F173|UPP_SALA4 Uracil phosphoribosyltransferase OS=Salmonella agona (strain SL483) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|Q9RBJ3|UPP_XANCP Uracil phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=upp PE=3 SV=2 59 196 1.0E-27
sp|B0RRQ3|UPP_XANCB Uracil phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|Q4UVY0|UPP_XANC8 Uracil phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=upp PE=3 SV=1 59 196 1.0E-27
sp|Q7WB58|UPP_BORPA Uracil phosphoribosyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=upp PE=3 SV=1 7 196 1.0E-27
sp|Q7WMM5|UPP_BORBR Uracil phosphoribosyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=upp PE=3 SV=1 7 196 1.0E-27
sp|P43049|UPP_MYCHO Uracil phosphoribosyltransferase OS=Mycoplasma hominis GN=upp PE=3 SV=1 10 196 2.0E-27
sp|P0A8F3|UPP_SHIFL Uracil phosphoribosyltransferase OS=Shigella flexneri GN=upp PE=3 SV=1 59 196 2.0E-27
sp|Q0T222|UPP_SHIF8 Uracil phosphoribosyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B2TXS3|UPP_SHIB3 Uracil phosphoribosyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B1LNE8|UPP_ECOSM Uracil phosphoribosyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B6I570|UPP_ECOSE Uracil phosphoribosyltransferase OS=Escherichia coli (strain SE11) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B7N680|UPP_ECOLU Uracil phosphoribosyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|P0A8F0|UPP_ECOLI Uracil phosphoribosyltransferase OS=Escherichia coli (strain K12) GN=upp PE=1 SV=1 59 196 2.0E-27
sp|B1IWG2|UPP_ECOLC Uracil phosphoribosyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|P0A8F1|UPP_ECOL6 Uracil phosphoribosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|Q0TEZ0|UPP_ECOL5 Uracil phosphoribosyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|A1ADZ1|UPP_ECOK1 Uracil phosphoribosyltransferase OS=Escherichia coli O1:K1 / APEC GN=upp PE=3 SV=1 59 196 2.0E-27
sp|A8A2Z0|UPP_ECOHS Uracil phosphoribosyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B1XAX3|UPP_ECODH Uracil phosphoribosyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|C4ZX73|UPP_ECOBW Uracil phosphoribosyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B7M7K2|UPP_ECO8A Uracil phosphoribosyltransferase OS=Escherichia coli O8 (strain IAI1) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B7MYC5|UPP_ECO81 Uracil phosphoribosyltransferase OS=Escherichia coli O81 (strain ED1a) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B7NQN7|UPP_ECO7I Uracil phosphoribosyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B5Z035|UPP_ECO5E Uracil phosphoribosyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|P0A8F2|UPP_ECO57 Uracil phosphoribosyltransferase OS=Escherichia coli O157:H7 GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B7LCN8|UPP_ECO55 Uracil phosphoribosyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B7MHX9|UPP_ECO45 Uracil phosphoribosyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B7UGN6|UPP_ECO27 Uracil phosphoribosyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|A7ZPU1|UPP_ECO24 Uracil phosphoribosyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|A8H5Q9|UPP_SHEPA Uracil phosphoribosyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B0TPW8|UPP_SHEHH Uracil phosphoribosyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|Q7N3F8|UPP_PHOLL Uracil phosphoribosyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|B1VNY5|UPP_STRGG Uracil phosphoribosyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=upp PE=3 SV=1 9 196 2.0E-27
sp|P59001|UPP_XANAC Uracil phosphoribosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|A8AD93|UPP_CITK8 Uracil phosphoribosyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|Q1QVR2|UPP_CHRSD Uracil phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=upp PE=3 SV=1 59 196 2.0E-27
sp|Q47W53|UPP_COLP3 Uracil phosphoribosyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=upp PE=3 SV=1 55 196 2.0E-27
sp|A6TCB0|UPP_KLEP7 Uracil phosphoribosyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=upp PE=3 SV=1 59 196 3.0E-27
sp|Q7VZ79|UPP_BORPE Uracil phosphoribosyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=upp PE=3 SV=1 7 196 3.0E-27
sp|B5XNQ4|UPP_KLEP3 Uracil phosphoribosyltransferase OS=Klebsiella pneumoniae (strain 342) GN=upp PE=3 SV=1 59 196 3.0E-27
sp|A1SDD5|UPP_NOCSJ Uracil phosphoribosyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=upp PE=3 SV=1 5 196 3.0E-27
sp|Q2P2V7|UPP_XANOM Uracil phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=upp PE=3 SV=1 59 196 3.0E-27
sp|Q65RC3|UPP_MANSM Uracil phosphoribosyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=upp PE=3 SV=1 59 196 3.0E-27
sp|B7GNR5|UPP_BIFLS Uracil phosphoribosyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=upp PE=3 SV=1 9 196 3.0E-27
sp|B1MFZ1|UPP_MYCA9 Uracil phosphoribosyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=upp PE=3 SV=1 27 196 4.0E-27
sp|B8DVI9|UPP_BIFA0 Uracil phosphoribosyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=upp PE=3 SV=1 9 196 4.0E-27
sp|Q7MIK2|UPP_VIBVY Uracil phosphoribosyltransferase OS=Vibrio vulnificus (strain YJ016) GN=upp PE=3 SV=2 59 196 4.0E-27
sp|Q9KPY7|UPP_VIBCH Uracil phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=upp PE=3 SV=1 59 196 4.0E-27
sp|A4XQU8|UPP_PSEMY Uracil phosphoribosyltransferase OS=Pseudomonas mendocina (strain ymp) GN=upp PE=3 SV=1 7 196 5.0E-27
sp|B2FLX2|UPP_STRMK Uracil phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=upp PE=3 SV=1 59 196 5.0E-27
sp|B4SS22|UPP_STRM5 Uracil phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=upp PE=3 SV=1 59 196 5.0E-27
sp|A1AMK6|UPP_PELPD Uracil phosphoribosyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=upp PE=3 SV=1 7 196 6.0E-27
sp|B1VF60|UPP_CORU7 Uracil phosphoribosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=upp PE=3 SV=1 13 196 6.0E-27
sp|B3PM96|UPP_MYCA5 Uracil phosphoribosyltransferase OS=Mycoplasma arthritidis (strain 158L3-1) GN=upp PE=3 SV=1 11 196 7.0E-27
sp|Q9AK76|UPP_STRCO Uracil phosphoribosyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=upp PE=3 SV=2 9 196 7.0E-27
sp|A9KY39|UPP_SHEB9 Uracil phosphoribosyltransferase OS=Shewanella baltica (strain OS195) GN=upp PE=3 SV=1 59 196 7.0E-27
sp|A6WM35|UPP_SHEB8 Uracil phosphoribosyltransferase OS=Shewanella baltica (strain OS185) GN=upp PE=3 SV=1 59 196 7.0E-27
sp|A3D3D2|UPP_SHEB5 Uracil phosphoribosyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=upp PE=3 SV=1 59 196 7.0E-27
sp|B8EAL3|UPP_SHEB2 Uracil phosphoribosyltransferase OS=Shewanella baltica (strain OS223) GN=upp PE=3 SV=1 59 196 7.0E-27
sp|Q15ZS0|UPP_PSEA6 Uracil phosphoribosyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=upp PE=3 SV=1 63 196 7.0E-27
sp|Q7VM34|UPP_HAEDU Uracil phosphoribosyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=upp PE=3 SV=1 59 196 8.0E-27
sp|C6DZH8|UPP_GEOSM Uracil phosphoribosyltransferase OS=Geobacter sp. (strain M21) GN=upp PE=3 SV=1 59 196 9.0E-27
sp|A1RKQ4|UPP_SHESW Uracil phosphoribosyltransferase OS=Shewanella sp. (strain W3-18-1) GN=upp PE=3 SV=1 59 196 1.0E-26
sp|A4Y5T9|UPP_SHEPC Uracil phosphoribosyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=upp PE=3 SV=1 59 196 1.0E-26
sp|P75081|UPP_MYCPN Uracil phosphoribosyltransferase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=upp PE=3 SV=2 9 196 1.0E-26
sp|Q5Z187|UPP_NOCFA Uracil phosphoribosyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=upp PE=3 SV=1 9 196 1.0E-26
sp|A0KYA2|UPP_SHESA Uracil phosphoribosyltransferase OS=Shewanella sp. (strain ANA-3) GN=upp PE=3 SV=1 59 196 1.0E-26
sp|B3DPH5|UPP_BIFLD Uracil phosphoribosyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=upp PE=3 SV=1 9 196 1.0E-26
sp|Q0HTW9|UPP_SHESR Uracil phosphoribosyltransferase OS=Shewanella sp. (strain MR-7) GN=upp PE=3 SV=1 59 196 1.0E-26
sp|Q0HHL7|UPP_SHESM Uracil phosphoribosyltransferase OS=Shewanella sp. (strain MR-4) GN=upp PE=3 SV=1 59 196 1.0E-26
sp|Q8EDI9|UPP_SHEON Uracil phosphoribosyltransferase OS=Shewanella oneidensis (strain MR-1) GN=upp PE=3 SV=1 59 196 1.0E-26
sp|B8DP34|UPP_DESVM Uracil phosphoribosyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=upp PE=3 SV=1 16 196 1.0E-26
sp|B5EBM3|UPP_GEOBB Uracil phosphoribosyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=upp PE=3 SV=1 59 196 2.0E-26
sp|A9HZV9|UPP_BORPD Uracil phosphoribosyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=upp PE=3 SV=1 7 196 2.0E-26
sp|Q3IC38|UPP_PSEHT Uracil phosphoribosyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=upp PE=3 SV=1 27 196 3.0E-26
sp|B4EY88|UPP_PROMH Uracil phosphoribosyltransferase OS=Proteus mirabilis (strain HI4320) GN=upp PE=3 SV=1 59 196 3.0E-26
sp|Q6AHB4|UPP_LEIXX Uracil phosphoribosyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=upp PE=3 SV=1 9 196 3.0E-26
sp|Q9CPL8|UPP_PASMU Uracil phosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=upp PE=3 SV=1 59 196 3.0E-26
sp|A6VQ76|UPP_ACTSZ Uracil phosphoribosyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=upp PE=3 SV=1 59 196 4.0E-26
sp|A3QD33|UPP_SHELP Uracil phosphoribosyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=upp PE=3 SV=1 59 196 4.0E-26
sp|Q2KWB3|UPP_BORA1 Uracil phosphoribosyltransferase OS=Bordetella avium (strain 197N) GN=upp PE=3 SV=1 59 196 4.0E-26
sp|C5BXA3|UPP_BEUC1 Uracil phosphoribosyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=upp PE=3 SV=1 63 196 4.0E-26
sp|B1KIG8|UPP_SHEWM Uracil phosphoribosyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=upp PE=3 SV=1 59 196 4.0E-26
sp|B0UW86|UPP_HISS2 Uracil phosphoribosyltransferase OS=Histophilus somni (strain 2336) GN=upp PE=3 SV=1 59 196 5.0E-26
sp|Q0I4P2|UPP_HAES1 Uracil phosphoribosyltransferase OS=Haemophilus somnus (strain 129Pt) GN=upp PE=3 SV=1 59 196 5.0E-26
sp|A1RV13|UPP_PYRIL Uracil phosphoribosyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=upp PE=3 SV=1 9 197 5.0E-26
sp|B0BTQ3|UPP_ACTPJ Uracil phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=upp PE=3 SV=1 59 196 5.0E-26
sp|B3H0R2|UPP_ACTP7 Uracil phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=upp PE=3 SV=1 59 196 5.0E-26
sp|A3MZB6|UPP_ACTP2 Uracil phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=upp PE=3 SV=1 59 196 5.0E-26
sp|P9WFF3|UPP_MYCTU Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=upp PE=1 SV=1 9 196 7.0E-26
sp|P9WFF2|UPP_MYCTO Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=upp PE=3 SV=1 9 196 7.0E-26
sp|A5U7Y3|UPP_MYCTA Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=upp PE=3 SV=1 9 196 7.0E-26
sp|A1KNZ5|UPP_MYCBP Uracil phosphoribosyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=upp PE=3 SV=1 9 196 7.0E-26
sp|P0A659|UPP_MYCBO Uracil phosphoribosyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=upp PE=3 SV=1 9 196 7.0E-26
sp|P72753|UPP_SYNY3 Uracil phosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=upp PE=3 SV=1 36 194 7.0E-26
sp|Q9M336|UPP_ARATH Uracil phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana GN=UPP PE=1 SV=1 27 196 7.0E-26
sp|A9WLN5|UPP_RENSM Uracil phosphoribosyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=upp PE=3 SV=1 9 196 8.0E-26
sp|A8FUD4|UPP_SHESH Uracil phosphoribosyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=upp PE=3 SV=1 59 196 8.0E-26
sp|B8CN81|UPP_SHEPW Uracil phosphoribosyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=upp PE=3 SV=1 59 196 9.0E-26
sp|A1S7E5|UPP_SHEAM Uracil phosphoribosyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=upp PE=3 SV=1 59 196 9.0E-26
sp|A1VEW8|UPP_DESVV Uracil phosphoribosyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=upp PE=3 SV=1 59 196 9.0E-26
sp|Q72DA4|UPP_DESVH Uracil phosphoribosyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=upp PE=3 SV=1 59 196 9.0E-26
sp|Q084L0|UPP_SHEFN Uracil phosphoribosyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=upp PE=3 SV=1 59 196 1.0E-25
sp|B0TYR5|UPP_FRAP2 Uracil phosphoribosyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=upp PE=3 SV=1 59 196 1.0E-25
sp|A6VC42|UPP_PSEA7 Uracil phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=upp PE=3 SV=1 59 196 1.0E-25
sp|Q88PV2|UPP_PSEPK Uracil phosphoribosyltransferase OS=Pseudomonas putida (strain KT2440) GN=upp PE=3 SV=1 7 196 1.0E-25
sp|B0KNF7|UPP_PSEPG Uracil phosphoribosyltransferase OS=Pseudomonas putida (strain GB-1) GN=upp PE=3 SV=1 7 196 1.0E-25
sp|A5VYH8|UPP_PSEP1 Uracil phosphoribosyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=upp PE=3 SV=1 7 196 1.0E-25
sp|B8F5N2|UPP_HAEPS Uracil phosphoribosyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=upp PE=3 SV=1 59 196 2.0E-25
sp|Q9HVE6|UPP_PSEAE Uracil phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=upp PE=3 SV=1 59 196 2.0E-25
sp|Q02G28|UPP_PSEAB Uracil phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=upp PE=3 SV=1 59 196 2.0E-25
sp|B7V0J2|UPP_PSEA8 Uracil phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=upp PE=3 SV=1 59 196 2.0E-25
sp|A1SVA9|UPP_PSYIN Uracil phosphoribosyltransferase OS=Psychromonas ingrahamii (strain 37) GN=upp PE=3 SV=1 59 196 2.0E-25
sp|Q2A285|UPP_FRATH Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=upp PE=3 SV=1 59 196 2.0E-25
sp|B1JEN1|UPP_PSEPW Uracil phosphoribosyltransferase OS=Pseudomonas putida (strain W619) GN=upp PE=3 SV=1 7 196 3.0E-25
sp|Q12MF1|UPP_SHEDO Uracil phosphoribosyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=upp PE=3 SV=1 59 196 3.0E-25
sp|Q1IEV9|UPP_PSEE4 Uracil phosphoribosyltransferase OS=Pseudomonas entomophila (strain L48) GN=upp PE=3 SV=1 7 196 3.0E-25
sp|A6W572|UPP_KINRD Uracil phosphoribosyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=upp PE=3 SV=1 63 196 3.0E-25
sp|C3KAJ8|UPP_PSEFS Uracil phosphoribosyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=upp PE=3 SV=1 7 196 3.0E-25
sp|A4IZ90|UPP_FRATW Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=upp PE=3 SV=1 59 196 3.0E-25
sp|Q5NGW1|UPP_FRATT Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=upp PE=3 SV=2 59 196 3.0E-25
sp|A0Q5K6|UPP_FRATN Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=upp PE=3 SV=1 59 196 3.0E-25
sp|B2SDI9|UPP_FRATM Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=upp PE=3 SV=1 59 196 4.0E-25
sp|Q73UD7|UPP_MYCPA Uracil phosphoribosyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=upp PE=3 SV=1 9 196 4.0E-25
sp|P93394|UPP_TOBAC Uracil phosphoribosyltransferase OS=Nicotiana tabacum GN=UPP PE=2 SV=1 27 196 5.0E-25
sp|Q2SN06|UPP_HAHCH Uracil phosphoribosyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=upp PE=3 SV=1 59 196 6.0E-25
sp|Q4QJV5|UPP_HAEI8 Uracil phosphoribosyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=upp PE=3 SV=1 59 196 6.0E-25
sp|Q311Z9|UPP_DESAG Uracil phosphoribosyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=upp PE=3 SV=1 15 196 7.0E-25
sp|P43857|UPP_HAEIN Uracil phosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=upp PE=3 SV=1 59 196 1.0E-24
sp|A5UF76|UPP_HAEIG Uracil phosphoribosyltransferase OS=Haemophilus influenzae (strain PittGG) GN=upp PE=3 SV=1 59 196 1.0E-24
sp|A5UBP1|UPP_HAEIE Uracil phosphoribosyltransferase OS=Haemophilus influenzae (strain PittEE) GN=upp PE=3 SV=1 59 196 1.0E-24
sp|Q7VRS9|UPP_BLOFL Uracil phosphoribosyltransferase OS=Blochmannia floridanus GN=upp PE=3 SV=1 59 196 1.0E-24
sp|B4RK50|UPP_NEIG2 Uracil phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=upp PE=3 SV=1 63 196 1.0E-24
sp|Q5F9P0|UPP_NEIG1 Uracil phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=upp PE=3 SV=1 63 196 1.0E-24
sp|C1DC78|UPP_LARHH Uracil phosphoribosyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=upp PE=3 SV=1 59 196 2.0E-24
sp|A1KT34|UPP_NEIMF Uracil phosphoribosyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=upp PE=3 SV=1 63 196 2.0E-24
sp|A9M3K6|UPP_NEIM0 Uracil phosphoribosyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=upp PE=3 SV=1 63 196 2.0E-24
sp|Q9JV58|UPP_NEIMA Uracil phosphoribosyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=upp PE=3 SV=1 63 196 2.0E-24
sp|Q8ZWV9|UPP_PYRAE Uracil phosphoribosyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=upp PE=3 SV=1 9 197 2.0E-24
sp|Q9K048|UPP_NEIMB Uracil phosphoribosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=upp PE=3 SV=1 63 196 3.0E-24
sp|C0QHT9|UPP_DESAH Uracil phosphoribosyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=upp PE=3 SV=1 59 196 3.0E-24
sp|Q6A5S3|UPP_PROAC Uracil phosphoribosyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=upp PE=3 SV=1 63 198 3.0E-24
sp|A0ZZM2|UPP_BIFAA Uracil phosphoribosyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=upp PE=3 SV=1 9 196 3.0E-24
sp|Q3K6Y9|UPP_PSEPF Uracil phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=upp PE=3 SV=1 7 196 4.0E-24
sp|A4VPB2|UPP_PSEU5 Uracil phosphoribosyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=upp PE=3 SV=1 59 196 4.0E-24
sp|A1U241|UPP_MARHV Uracil phosphoribosyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=upp PE=3 SV=1 59 196 5.0E-24
sp|Q98QP6|UPP_MYCPU Uracil phosphoribosyltransferase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=upp PE=3 SV=1 43 196 5.0E-24
sp|Q89E48|UPP_BRADU Uracil phosphoribosyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=upp PE=3 SV=1 3 196 6.0E-24
sp|C3PLD0|UPP_CORA7 Uracil phosphoribosyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=upp PE=3 SV=1 27 196 7.0E-24
sp|C1DEU0|UPP_AZOVD Uracil phosphoribosyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=upp PE=3 SV=1 7 196 7.0E-24
sp|Q4ZXU7|UPP_PSEU2 Uracil phosphoribosyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=upp PE=3 SV=1 59 196 8.0E-24
sp|Q48MT3|UPP_PSE14 Uracil phosphoribosyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=upp PE=3 SV=1 59 196 8.0E-24
sp|Q74EM9|UPP_GEOSL Uracil phosphoribosyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=upp PE=3 SV=1 59 196 8.0E-24
sp|B2GFU4|UPP_KOCRD Uracil phosphoribosyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=upp PE=3 SV=1 9 196 9.0E-24
sp|Q6NIX4|UPP_CORDI Uracil phosphoribosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=upp PE=3 SV=1 9 196 1.0E-23
sp|Q4K6B5|UPP_PSEF5 Uracil phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=upp PE=3 SV=1 7 196 1.0E-23
sp|Q888A0|UPP_PSESM Uracil phosphoribosyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=upp PE=3 SV=1 59 196 1.0E-23
sp|C4LKC1|UPP_CORK4 Uracil phosphoribosyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=upp PE=3 SV=1 9 196 1.0E-23
sp|A2SGT8|UPP_METPP Uracil phosphoribosyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=upp PE=3 SV=1 6 196 2.0E-23
sp|Q7NS06|UPP_CHRVO Uracil phosphoribosyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=upp PE=3 SV=1 59 196 3.0E-23
sp|Q492F3|UPP_BLOPB Uracil phosphoribosyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=upp PE=3 SV=1 59 196 3.0E-23
sp|Q8FRQ5|UPP_COREF Uracil phosphoribosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=upp PE=3 SV=2 2 196 6.0E-23
sp|Q8YVB5|UPP_NOSS1 Uracil phosphoribosyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=upp PE=3 SV=1 1 196 7.0E-23
sp|P58998|UPP_CORGL Uracil phosphoribosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=upp PE=3 SV=1 2 196 8.0E-23
sp|A4QC29|UPP_CORGB Uracil phosphoribosyltransferase OS=Corynebacterium glutamicum (strain R) GN=upp PE=3 SV=1 2 196 8.0E-23
sp|C6A3U9|UPP_THESM Uracil phosphoribosyltransferase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=upp PE=3 SV=1 43 196 3.0E-21
sp|Q975Z7|UPP_SULTO Uracil phosphoribosyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=upp PE=3 SV=1 10 196 4.0E-21
sp|A5IYF5|UPP_MYCAP Uracil phosphoribosyltransferase OS=Mycoplasma agalactiae (strain PG2) GN=upp PE=3 SV=1 9 194 2.0E-20
sp|Q4JTK4|UPP_CORJK Uracil phosphoribosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=upp PE=3 SV=1 9 196 7.0E-20
sp|Q9US43|UPP3_SCHPO Putative uracil phosphoribosyltransferase urg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urg2 PE=3 SV=2 63 196 7.0E-20
sp|Q3ISU0|UPP_NATPD Uracil phosphoribosyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=upp PE=3 SV=1 63 196 1.0E-19
sp|Q8U1G7|UPP_PYRFU Uracil phosphoribosyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=upp PE=3 SV=1 43 196 2.0E-19
sp|B6YTB2|UPP_THEON Uracil phosphoribosyltransferase OS=Thermococcus onnurineus (strain NA1) GN=upp PE=3 SV=1 63 196 3.0E-19
sp|C5A6P6|UPP_THEGJ Uracil phosphoribosyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=upp PE=3 SV=1 43 196 3.0E-19
sp|O74427|URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urk1 PE=3 SV=1 9 175 4.0E-19
sp|C3N7P3|UPP_SULIY Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=upp PE=3 SV=1 9 196 4.0E-18
sp|C3NFT0|UPP_SULIN Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=upp PE=3 SV=1 9 196 4.0E-18
sp|C3MY92|UPP_SULIM Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=upp PE=3 SV=1 9 196 4.0E-18
sp|C3MRJ6|UPP_SULIL Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=upp PE=3 SV=1 9 196 4.0E-18
sp|C3MZM1|UPP_SULIA Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=upp PE=3 SV=1 9 196 4.0E-18
sp|C4KIV1|UPP_SULIK Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=upp PE=3 SV=1 9 196 5.0E-18
sp|Q980Q4|UPP_SULSO Uracil phosphoribosyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=upp PE=1 SV=1 9 196 1.0E-17
sp|Q9V0K1|UPP_PYRAB Uracil phosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=upp PE=3 SV=1 43 196 2.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069370
MTKKYLRADKETSRGDFLFYSDRIIRLLVEEGLNHLPVISRVVETPTGATYHGVGFEGKICGVSILRAGEAMEAG
LREVCRSVRIGKILIQRDEETAQAKLFYSKFPSDIAKRYVLLLDPMLATGGSAMKAVEVLMEHGVPAERIIFINL
IAAPEGLSNFCSRYPTTKIITGWIDEGLNEKSYIIPGLGDFGERRYCL*
Coding >AgabiH97|069370
ATGACCAAAAAATACCTCCGAGCAGATAAAGAGACCTCCAGGGGCGATTTTTTGTTTTATTCGGATAGGATTATA
AGGTTACTGGTTGAAGAGGGATTGAATCATTTGCCGGTTATTAGTAGAGTTGTTGAGACACCGACGGGTGCTACG
TATCATGGTGTGGGATTTGAGGGAAAGATCTGTGGTGTGTCAATTTTACGTGCCGGAGAGGCCATGGAGGCCGGT
CTTCGTGAAGTTTGTCGAAGTGTTCGAATTGGGAAGATCTTGATTCAACGAGATGAAGAAACCGCCCAAGCAAAG
CTATTCTACTCGAAGTTTCCTTCAGATATTGCGAAACGATATGTCTTGTTGCTTGATCCGATGTTAGCGACAGGC
GGTTCCGCAATGAAAGCTGTCGAAGTTCTCATGGAGCATGGTGTTCCTGCAGAACGAATCATTTTCATCAACCTC
ATCGCCGCACCGGAAGGTTTATCAAACTTTTGTTCACGTTATCCCACTACCAAAATTATTACCGGATGGATTGAT
GAAGGATTGAACGAGAAGTCGTACATTATTCCGGGCCTCGGAGATTTTGGGGAAAGAAGGTATTGCCTTTAA
Transcript >AgabiH97|069370
ATGACCAAAAAATACCTCCGAGCAGATAAAGAGACCTCCAGGGGCGATTTTTTGTTTTATTCGGATAGGATTATA
AGGTTACTGGTTGAAGAGGGATTGAATCATTTGCCGGTTATTAGTAGAGTTGTTGAGACACCGACGGGTGCTACG
TATCATGGTGTGGGATTTGAGGGAAAGATCTGTGGTGTGTCAATTTTACGTGCCGGAGAGGCCATGGAGGCCGGT
CTTCGTGAAGTTTGTCGAAGTGTTCGAATTGGGAAGATCTTGATTCAACGAGATGAAGAAACCGCCCAAGCAAAG
CTATTCTACTCGAAGTTTCCTTCAGATATTGCGAAACGATATGTCTTGTTGCTTGATCCGATGTTAGCGACAGGC
GGTTCCGCAATGAAAGCTGTCGAAGTTCTCATGGAGCATGGTGTTCCTGCAGAACGAATCATTTTCATCAACCTC
ATCGCCGCACCGGAAGGTTTATCAAACTTTTGTTCACGTTATCCCACTACCAAAATTATTACCGGATGGATTGAT
GAAGGATTGAACGAGAAGTCGTACATTATTCCGGGCCTCGGAGATTTTGGGGAAAGAAGGTATTGCCTTTAA
Gene >AgabiH97|069370
ATGACCAAAAAATACCTCCGAGCGTGTTCAAGCTACCACAGACGGCACAATTAGAGGCGTTATACACAATTATAA
GAGATAAAGAGACCTCCAGGGGCGATTTTTTGTTTTATTCGGATAGGATTATAAGGTTACTGGTTGAAGAGGGAT
TGAATCATTTGCCGGTTATTAGTAGAGTTGTTGAGACACCGACGGTGAGTGGACTATTGGCTACGAGATGGACAG
AGTTTTACTTCGTGTGGAATAGGGTGCTACGTATCATGGTGTGGGATTTGAGGGAAAGATCTGTGGTGTGTCAAT
TTTACGTGCCGGAGAGGTACGTGGCGAAGTTGTTTTCTTTCTGAAGAATCTTTGTTGACGGGTTTGATATTGTAA
CCCGCCGTCGCGTGCAGGCCATGGAGGCCGGTCTTCGTGAAGTTTGTCGAAGTGTTCGAATTGGGAAGATCTTGA
TTCAACGAGTGAGATGGCAGGCGAGAGCATACTCATCTCATGGATAACTTACAGAGTCTTCCAGGATGAAGAAAC
CGCCCAAGCAAAGCTATTCTACTCGAAGTTTCCTTCAGATATTGCGAAACGATATGTCTTGTTGCTTGATCCGAT
GTTAGGTGCGTTCTATTCACCACGTGCCCAAATTCTCGCTTCGCTGACTCGATTGTGCTGATATCTAATTTCCTT
CGAAAATTAGCGACAGGCGGTTCCGCAATGAAAGCTGTCGAAGTTCTCATGGAGCATGGTGTTCCTGCAGAACGA
ATCATTTTCATCAACCTCGTATGTCTAATTATTCCCATTTCTTATCTTATCGTCGATCTTTCCGCTTTCTTGCTC
CCCAATCATTATGCATTATGCGCGTGAATGATTCATTGTCATCAACGCGAGCACAAAATGGTTTTGAACTGACAC
GTTTCTTTTGCCGGTCTAGATCGCCGCACCGGAAGGTTTATCAAACTTTTGTTCACGTTATCCCACTACCAAAAT
TGTACGTCCATTTTCCTTCATATCCTAAAAGAGACCTTTTGTGTCTTGTGAAAGAAAACTAATGTTTAATATTAA
TGCTTATCTATTAGATTACCGGATGGATTGATGAAGGATTGAACGAGAAGTCGTACATTATTCCGGGCCTCGGAG
ATTTTGGGGAAAGAAGGTATTGCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail