Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069350
Gene name
Locationscaffold_4:1025754..1028195
Strand-
Gene length (bp)2441
Transcript length (bp)1992
Coding sequence length (bp)1992
Protein length (aa) 664

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 6.9E-15 102 168
PF02889 Sec63 Sec63 Brl domain 7.1E-13 231 593

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGN7|SEC63_SCHPO Translocation protein sec63 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec63 PE=1 SV=1 2 662 4.0E-90
sp|P14906|SEC63_YEAST Protein translocation protein SEC63 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC63 PE=1 SV=2 2 652 3.0E-52
sp|Q8VHE0|SEC63_MOUSE Translocation protein SEC63 homolog OS=Mus musculus GN=Sec63 PE=1 SV=4 3 423 3.0E-48
sp|Q9UGP8|SEC63_HUMAN Translocation protein SEC63 homolog OS=Homo sapiens GN=SEC63 PE=1 SV=2 4 423 6.0E-48
sp|Q5R660|SEC63_PONAB Translocation protein SEC63 homolog OS=Pongo abelii GN=SEC63 PE=2 SV=1 4 423 7.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGN7|SEC63_SCHPO Translocation protein sec63 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec63 PE=1 SV=1 2 662 4.0E-90
sp|P14906|SEC63_YEAST Protein translocation protein SEC63 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC63 PE=1 SV=2 2 652 3.0E-52
sp|Q8VHE0|SEC63_MOUSE Translocation protein SEC63 homolog OS=Mus musculus GN=Sec63 PE=1 SV=4 3 423 3.0E-48
sp|Q9UGP8|SEC63_HUMAN Translocation protein SEC63 homolog OS=Homo sapiens GN=SEC63 PE=1 SV=2 4 423 6.0E-48
sp|Q5R660|SEC63_PONAB Translocation protein SEC63 homolog OS=Pongo abelii GN=SEC63 PE=2 SV=1 4 423 7.0E-48
sp|Q0WT48|DNJ21_ARATH DnaJ protein ERDJ2A OS=Arabidopsis thaliana GN=ERDJ2A PE=1 SV=1 7 537 4.0E-34
sp|F4JIN3|DNJ29_ARATH DnaJ protein ERDJ2B OS=Arabidopsis thaliana GN=ERDJ2B PE=1 SV=1 7 375 6.0E-34
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 293 603 3.0E-11
sp|Q80TN4|DJC16_MOUSE DnaJ homolog subfamily C member 16 OS=Mus musculus GN=Dnajc16 PE=1 SV=2 101 178 4.0E-10
sp|P40358|JEM1_YEAST DnaJ-like chaperone JEM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEM1 PE=1 SV=3 101 216 4.0E-10
sp|Q5RCM7|DJC16_PONAB DnaJ homolog subfamily C member 16 OS=Pongo abelii GN=DNAJC16 PE=2 SV=1 101 173 1.0E-09
sp|Q9Y2G8|DJC16_HUMAN DnaJ homolog subfamily C member 16 OS=Homo sapiens GN=DNAJC16 PE=2 SV=3 101 173 1.0E-09
sp|Q5FVM7|DJC16_RAT DnaJ homolog subfamily C member 16 OS=Rattus norvegicus GN=Dnajc16 PE=2 SV=1 101 178 1.0E-09
sp|Q5ZKZ4|DJC16_CHICK DnaJ homolog subfamily C member 16 OS=Gallus gallus GN=DNAJC16 PE=2 SV=1 102 181 3.0E-09
sp|Q99M87|DNJA3_MOUSE DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus GN=Dnaja3 PE=1 SV=1 78 173 9.0E-09
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 104 173 1.0E-08
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 104 173 1.0E-08
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 104 173 4.0E-08
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 104 173 5.0E-08
sp|O52065|DNAJ_MANHA Chaperone protein DnaJ OS=Mannheimia haemolytica GN=dnaJ PE=3 SV=1 104 173 6.0E-08
sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 90 213 6.0E-08
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 104 210 7.0E-08
sp|Q49Y21|DNAJ_STAS1 Chaperone protein DnaJ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaJ PE=3 SV=1 104 173 7.0E-08
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 104 173 7.0E-08
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 104 173 7.0E-08
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 90 213 1.0E-07
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 90 213 1.0E-07
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 104 213 1.0E-07
sp|P87239|MDJ1_SCHPO DnaJ homolog 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdj1 PE=3 SV=1 88 172 1.0E-07
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 104 173 2.0E-07
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 104 173 2.0E-07
sp|B2VGS0|DNAJ_ERWT9 Chaperone protein DnaJ OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaJ PE=3 SV=1 104 210 2.0E-07
sp|B8DE39|DNAJ_LISMH Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaJ PE=3 SV=1 104 178 2.0E-07
sp|Q92BN9|DNAJ_LISIN Chaperone protein DnaJ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaJ PE=3 SV=1 104 178 2.0E-07
sp|P0DJM1|DNAJ_LISMO Chaperone protein DnaJ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaJ PE=3 SV=1 104 178 2.0E-07
sp|G2K045|DNAJ_LISM4 Chaperone protein DnaJ OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaJ PE=3 SV=1 104 178 2.0E-07
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 104 240 3.0E-07
sp|Q71ZJ8|DNAJ_LISMF Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaJ PE=3 SV=1 104 178 3.0E-07
sp|C1KVB9|DNAJ_LISMC Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaJ PE=3 SV=1 104 178 3.0E-07
sp|Q9SR96|DNJ63_ARATH DnaJ protein ERDJ3A OS=Arabidopsis thaliana GN=ERDJ3A PE=1 SV=1 99 184 3.0E-07
sp|O94625|SPJ1_SCHPO DnaJ-related protein spj1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spj1 PE=2 SV=2 105 172 3.0E-07
sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 82 178 4.0E-07
sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 82 178 4.0E-07
sp|Q6TUG0|DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1 82 178 4.0E-07
sp|A0AIS3|DNAJ_LISW6 Chaperone protein DnaJ OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaJ PE=3 SV=1 104 178 4.0E-07
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 104 218 4.0E-07
sp|B7VJX0|DNAJ_VIBTL Chaperone protein DnaJ OS=Vibrio tasmaniensis (strain LGP32) GN=dnaJ PE=3 SV=1 104 173 4.0E-07
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 104 173 5.0E-07
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 90 213 5.0E-07
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 104 173 5.0E-07
sp|P17631|DNAJ_BACSU Chaperone protein DnaJ OS=Bacillus subtilis (strain 168) GN=dnaJ PE=2 SV=3 104 178 5.0E-07
sp|Q3IC07|DNAJ_PSEHT Chaperone protein DnaJ OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaJ PE=3 SV=1 104 173 5.0E-07
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 104 210 5.0E-07
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 104 173 5.0E-07
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 104 210 6.0E-07
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 104 210 6.0E-07
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 104 210 6.0E-07
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 104 210 6.0E-07
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 104 210 6.0E-07
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 104 210 6.0E-07
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 104 210 6.0E-07
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 104 210 6.0E-07
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 104 210 6.0E-07
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 104 210 6.0E-07
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 104 210 6.0E-07
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 104 210 6.0E-07
sp|Q8CP18|DNAJ_STAES Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaJ PE=3 SV=1 104 173 6.0E-07
sp|A8FFD1|DNAJ_BACP2 Chaperone protein DnaJ OS=Bacillus pumilus (strain SAFR-032) GN=dnaJ PE=3 SV=1 104 178 6.0E-07
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 104 173 7.0E-07
sp|A7Z6W0|DNAJ_BACMF Chaperone protein DnaJ OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaJ PE=3 SV=1 104 178 7.0E-07
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 104 173 7.0E-07
sp|A4SQ24|DNAJ_AERS4 Chaperone protein DnaJ OS=Aeromonas salmonicida (strain A449) GN=dnaJ PE=3 SV=1 104 173 8.0E-07
sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 104 173 8.0E-07
sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 95 216 8.0E-07
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 104 173 9.0E-07
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 104 173 9.0E-07
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 104 173 9.0E-07
sp|C4K3I5|DNAJ_HAMD5 Chaperone protein DnaJ OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaJ PE=3 SV=1 104 229 1.0E-06
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 104 173 1.0E-06
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 104 173 1.0E-06
sp|Q5HNW7|DNAJ_STAEQ Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaJ PE=3 SV=1 104 173 1.0E-06
sp|C4L424|DNAJ_EXISA Chaperone protein DnaJ OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dnaJ PE=3 SV=1 104 172 1.0E-06
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 104 173 1.0E-06
sp|Q99KV1|DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1 82 178 1.0E-06
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 104 173 1.0E-06
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 104 173 1.0E-06
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 104 173 1.0E-06
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 104 210 1.0E-06
sp|Q5KWZ8|DNAJ_GEOKA Chaperone protein DnaJ OS=Geobacillus kaustophilus (strain HTA426) GN=dnaJ PE=3 SV=1 104 175 1.0E-06
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 104 173 1.0E-06
sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 104 213 2.0E-06
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|Q8RH03|DNAJ_FUSNN Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 104 173 2.0E-06
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 104 173 2.0E-06
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|Q65H55|DNAJ_BACLD Chaperone protein DnaJ OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaJ PE=3 SV=1 104 178 2.0E-06
sp|Q1QSX1|DNAJ_CHRSD Chaperone protein DnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1 104 210 2.0E-06
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 104 173 2.0E-06
sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 84 178 2.0E-06
sp|Q5UP23|YR260_MIMIV DnaJ-like protein R260 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R260 PE=3 SV=1 104 182 2.0E-06
sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 104 173 3.0E-06
sp|A7FME2|DNAJ_YERP3 Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaJ PE=3 SV=1 104 210 3.0E-06
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 104 173 3.0E-06
sp|B1JL03|DNAJ_YERPY Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaJ PE=3 SV=1 104 210 3.0E-06
sp|Q66ES9|DNAJ_YERPS Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dnaJ PE=3 SV=1 104 210 3.0E-06
sp|A4TQF8|DNAJ_YERPP Chaperone protein DnaJ OS=Yersinia pestis (strain Pestoides F) GN=dnaJ PE=3 SV=1 104 210 3.0E-06
sp|Q1CMV6|DNAJ_YERPN Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaJ PE=3 SV=1 104 210 3.0E-06
sp|A9R014|DNAJ_YERPG Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaJ PE=3 SV=1 104 210 3.0E-06
sp|Q8ZIM6|DNAJ_YERPE Chaperone protein DnaJ OS=Yersinia pestis GN=dnaJ PE=3 SV=1 104 210 3.0E-06
sp|B2K3M1|DNAJ_YERPB Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaJ PE=3 SV=1 104 210 3.0E-06
sp|Q1C0J8|DNAJ_YERPA Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaJ PE=3 SV=1 104 210 3.0E-06
sp|A4IR30|DNAJ_GEOTN Chaperone protein DnaJ OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaJ PE=3 SV=1 104 175 3.0E-06
sp|O35824|DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=1 SV=1 95 172 3.0E-06
sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1 95 172 3.0E-06
sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1 95 172 3.0E-06
sp|Q5HZT9|DJC25_XENTR DnaJ homolog subfamily C member 25 OS=Xenopus tropicalis GN=dnajc25 PE=2 SV=1 104 169 4.0E-06
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 104 173 4.0E-06
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 104 173 4.0E-06
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 104 175 4.0E-06
sp|Q0C454|DNAJ_HYPNA Chaperone protein DnaJ OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaJ PE=3 SV=1 104 173 4.0E-06
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 104 210 5.0E-06
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|B1HUD0|DNAJ_LYSSC Chaperone protein DnaJ OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaJ PE=3 SV=1 104 175 5.0E-06
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 104 173 5.0E-06
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 104 173 6.0E-06
sp|C5D4U0|DNAJ_GEOSW Chaperone protein DnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1 104 178 6.0E-06
sp|Q9SDN0|DNJ20_ARATH Chaperone protein dnaJ 20, chloroplastic OS=Arabidopsis thaliana GN=ATJ20 PE=1 SV=2 104 186 6.0E-06
sp|P25303|SCJ1_YEAST DnaJ-related protein SCJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCJ1 PE=1 SV=2 104 172 6.0E-06
sp|A6VNB0|DNAJ_ACTSZ Chaperone protein DnaJ OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaJ PE=3 SV=1 104 173 7.0E-06
sp|Q9RUG2|DNAJ_DEIRA Chaperone protein DnaJ OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaJ PE=3 SV=2 104 176 7.0E-06
sp|Q9KWS6|DNAJ_GEOTM Chaperone protein DnaJ OS=Geobacillus thermoglucosidasius GN=dnaJ PE=3 SV=1 104 178 7.0E-06
sp|Q7NBW0|DNAJ_MYCGA Chaperone protein DnaJ OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=dnaJ PE=3 SV=2 104 173 7.0E-06
sp|Q58E03|DJC25_XENLA DnaJ homolog subfamily C member 25 OS=Xenopus laevis GN=dnajc25 PE=2 SV=1 104 169 7.0E-06
sp|B2G6W4|DNAJ_LACRJ Chaperone protein DnaJ OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaJ PE=3 SV=1 104 173 7.0E-06
sp|A5VJE8|DNAJ_LACRD Chaperone protein DnaJ OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaJ PE=3 SV=1 104 173 7.0E-06
sp|Q70WY6|DNAJ_FUSNP Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. polymorphum GN=dnaJ PE=3 SV=1 104 173 7.0E-06
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 104 173 7.0E-06
sp|B9E6X0|DNAJ_MACCJ Chaperone protein DnaJ OS=Macrococcus caseolyticus (strain JCSC5402) GN=dnaJ PE=3 SV=1 104 173 8.0E-06
sp|Q0VBY7|DJC24_BOVIN DnaJ homolog subfamily C member 24 OS=Bos taurus GN=DNAJC24 PE=2 SV=2 104 180 8.0E-06
sp|Q45552|DNAJ_GEOSE Chaperone protein DnaJ OS=Geobacillus stearothermophilus GN=dnaJ PE=3 SV=1 104 178 8.0E-06
sp|Q9H1X3|DJC25_HUMAN DnaJ homolog subfamily C member 25 OS=Homo sapiens GN=DNAJC25 PE=1 SV=1 92 169 8.0E-06
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 104 172 8.0E-06
sp|Q03QU2|DNAJ_LACBA Chaperone protein DnaJ OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaJ PE=3 SV=1 104 176 8.0E-06
sp|Q31HA6|DNAJ_THICR Chaperone protein DnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1 104 173 8.0E-06
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 104 203 8.0E-06
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 104 172 9.0E-06
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|Q6GGC1|DNAJ_STAAR Chaperone protein DnaJ OS=Staphylococcus aureus (strain MRSA252) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|P63971|DNAJ_STAAN Chaperone protein DnaJ OS=Staphylococcus aureus (strain N315) GN=dnaJ PE=1 SV=1 104 173 9.0E-06
sp|P63970|DNAJ_STAAM Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|A6QHC2|DNAJ_STAAE Chaperone protein DnaJ OS=Staphylococcus aureus (strain Newman) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|Q5HFI1|DNAJ_STAAC Chaperone protein DnaJ OS=Staphylococcus aureus (strain COL) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|A5ITA7|DNAJ_STAA9 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH9) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|Q2FXZ3|DNAJ_STAA8 Chaperone protein DnaJ OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|Q2FGE4|DNAJ_STAA3 Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|A6U251|DNAJ_STAA2 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH1) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|A7X2Y0|DNAJ_STAA1 Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|Q2YT48|DNAJ_STAAB Chaperone protein DnaJ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|Q24SS4|DNAJ_DESHY Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain Y51) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|B8FUN3|DNAJ_DESHD Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaJ PE=3 SV=1 104 173 9.0E-06
sp|Q2JW78|DNAJ_SYNJA Chaperone protein DnaJ OS=Synechococcus sp. (strain JA-3-3Ab) GN=dnaJ PE=3 SV=1 104 171 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 74 96 22
3 197 219 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069350
MANYHYDEGGSLAAYFLITILALVLTPMTLSSISKRPAKQHPRGCQCQACLDQRARIAKREKGTILAFNLSKKTY
FLIAGWTLFAFLCYKVSGAVVENKLYNPFEILGISPSLSEKDIKSHYKKLSKQFHPDKVKPSANETAEEISDRFV
QLTKAYKSLTDETIRKNWELYGNPDGRQEMSMGIALPKWIVESHNNIWVLGIYGLIFGGALPALVGRWWFGSRQK
TKDGVNAKSAAVFFKSLKEESMMEEVVGTLGKAYQFEMSDVGVKKVDVNIDRLESEIEKRAGVKWSEVRKIAKDV
DGKLHVKRRRALVLLYAHLLRIDISDEKLQKEQAQILLQIPLLLNALLNVSISRNWLLPSLAIMRLNAYFAQALP
PVEDERLRLTQLPFIQKADVETLGDAKNLTDVADILDSKKDKRASVVRKALERWGAIDIVDAAFKVIGERGVTPS
SIVFLVLKLRISPPGKKVQRKELSVDETKRAIKYNEKQDDEFLLSKSEMEEFTNEETVATSAHAPYWPGERKPSW
WVVLADDKLNRIVVPPFKVTDVPYANSDAEHERDYRSYKIQFQAPQNVGMFTWKVYLVSDTFVGEDVTRDIILKI
EQPQAMESPDDEISDPEEDSLAGQMAAMRGGKVKKLADQGDDDDESSTDDDEEENESSDSDSD*
Coding >AgabiH97|069350
ATGGCAAACTATCACTACGATGAAGGCGGCAGCTTGGCTGCATACTTTCTCATCACTATACTTGCTTTGGTCCTT
ACCCCGATGACGCTGTCTTCAATTAGCAAGAGACCAGCGAAACAACATCCGAGAGGCTGCCAGTGTCAGGCGTGC
CTTGACCAACGAGCAAGGATTGCAAAACGAGAGAAGGGCACAATACTGGCCTTTAATCTCAGCAAGAAGACATAC
TTCCTAATTGCTGGCTGGACACTGTTCGCATTCCTCTGCTATAAGGTCTCCGGCGCTGTGGTCGAGAACAAGCTC
TACAATCCTTTTGAAATCCTTGGAATCAGTCCAAGTCTGTCTGAGAAAGATATCAAATCTCATTACAAGAAACTC
TCGAAACAATTCCATCCGGACAAAGTAAAACCATCAGCCAACGAGACCGCGGAAGAAATTTCAGATCGTTTCGTT
CAACTCACCAAAGCCTACAAATCCCTCACAGACGAAACAATCCGCAAGAATTGGGAACTATATGGCAACCCGGAT
GGCCGTCAAGAGATGTCCATGGGTATCGCTCTACCAAAATGGATCGTCGAATCTCACAACAATATCTGGGTGCTT
GGAATTTATGGTTTGATTTTCGGGGGTGCCTTACCTGCCCTAGTCGGCCGGTGGTGGTTTGGTAGCAGGCAAAAA
ACGAAAGACGGTGTAAATGCGAAATCAGCTGCCGTTTTCTTCAAAAGCTTGAAGGAAGAGAGTATGATGGAAGAA
GTCGTTGGCACACTCGGCAAGGCATATCAATTCGAAATGTCAGACGTAGGCGTCAAAAAGGTGGATGTAAATATT
GATAGGCTTGAAAGTGAGATTGAGAAGAGGGCTGGTGTGAAGTGGAGTGAAGTTAGGAAGATCGCGAAGGACGTC
GACGGCAAACTCCACGTGAAACGTCGGAGAGCACTCGTTTTACTTTACGCTCACTTGCTGAGAATTGATATTTCC
GACGAAAAATTGCAAAAGGAACAAGCTCAGATTCTCCTTCAAATTCCTCTTCTTTTAAATGCTCTCCTCAACGTG
TCAATCTCACGCAATTGGCTCCTACCATCGTTGGCAATCATGCGTCTCAATGCCTATTTCGCCCAAGCTCTACCT
CCGGTCGAGGACGAGCGGCTACGACTTACTCAACTACCTTTTATCCAGAAGGCGGACGTTGAGACCCTTGGTGAT
GCCAAAAACTTGACGGATGTTGCGGATATCCTCGATTCAAAGAAGGATAAGCGTGCCAGTGTCGTTCGAAAAGCA
TTGGAAAGGTGGGGTGCCATCGATATCGTCGATGCTGCTTTTAAAGTCATTGGTGAACGCGGCGTGACGCCATCT
TCTATCGTATTCCTCGTCTTGAAACTTCGTATCAGCCCACCAGGAAAAAAGGTTCAACGTAAAGAGCTCAGTGTG
GATGAAACCAAGCGGGCCATCAAGTATAATGAGAAGCAGGATGATGAATTCCTTTTATCGAAAAGTGAGATGGAG
GAATTTACAAACGAAGAAACCGTTGCCACTAGTGCACATGCACCTTACTGGCCTGGGGAACGTAAACCGTCGTGG
TGGGTTGTCCTAGCAGACGACAAACTCAATCGCATAGTCGTTCCACCTTTCAAAGTCACTGATGTACCCTATGCC
AATTCTGATGCTGAACACGAGCGCGACTATCGATCATACAAAATTCAATTCCAGGCTCCACAAAATGTGGGAATG
TTCACATGGAAGGTTTATTTGGTCTCGGATACATTCGTTGGAGAAGATGTGACTAGAGATATCATCTTGAAAATC
GAGCAGCCTCAGGCTATGGAATCACCTGACGATGAAATTTCAGATCCTGAGGAAGATTCACTCGCGGGTCAGATG
GCTGCCATGCGTGGTGGGAAGGTGAAGAAGCTTGCAGATCAAGGAGATGATGATGATGAGAGTAGTACTGACGAT
GATGAGGAAGAGAATGAGAGTAGTGATAGCGACAGCGATTAG
Transcript >AgabiH97|069350
ATGGCAAACTATCACTACGATGAAGGCGGCAGCTTGGCTGCATACTTTCTCATCACTATACTTGCTTTGGTCCTT
ACCCCGATGACGCTGTCTTCAATTAGCAAGAGACCAGCGAAACAACATCCGAGAGGCTGCCAGTGTCAGGCGTGC
CTTGACCAACGAGCAAGGATTGCAAAACGAGAGAAGGGCACAATACTGGCCTTTAATCTCAGCAAGAAGACATAC
TTCCTAATTGCTGGCTGGACACTGTTCGCATTCCTCTGCTATAAGGTCTCCGGCGCTGTGGTCGAGAACAAGCTC
TACAATCCTTTTGAAATCCTTGGAATCAGTCCAAGTCTGTCTGAGAAAGATATCAAATCTCATTACAAGAAACTC
TCGAAACAATTCCATCCGGACAAAGTAAAACCATCAGCCAACGAGACCGCGGAAGAAATTTCAGATCGTTTCGTT
CAACTCACCAAAGCCTACAAATCCCTCACAGACGAAACAATCCGCAAGAATTGGGAACTATATGGCAACCCGGAT
GGCCGTCAAGAGATGTCCATGGGTATCGCTCTACCAAAATGGATCGTCGAATCTCACAACAATATCTGGGTGCTT
GGAATTTATGGTTTGATTTTCGGGGGTGCCTTACCTGCCCTAGTCGGCCGGTGGTGGTTTGGTAGCAGGCAAAAA
ACGAAAGACGGTGTAAATGCGAAATCAGCTGCCGTTTTCTTCAAAAGCTTGAAGGAAGAGAGTATGATGGAAGAA
GTCGTTGGCACACTCGGCAAGGCATATCAATTCGAAATGTCAGACGTAGGCGTCAAAAAGGTGGATGTAAATATT
GATAGGCTTGAAAGTGAGATTGAGAAGAGGGCTGGTGTGAAGTGGAGTGAAGTTAGGAAGATCGCGAAGGACGTC
GACGGCAAACTCCACGTGAAACGTCGGAGAGCACTCGTTTTACTTTACGCTCACTTGCTGAGAATTGATATTTCC
GACGAAAAATTGCAAAAGGAACAAGCTCAGATTCTCCTTCAAATTCCTCTTCTTTTAAATGCTCTCCTCAACGTG
TCAATCTCACGCAATTGGCTCCTACCATCGTTGGCAATCATGCGTCTCAATGCCTATTTCGCCCAAGCTCTACCT
CCGGTCGAGGACGAGCGGCTACGACTTACTCAACTACCTTTTATCCAGAAGGCGGACGTTGAGACCCTTGGTGAT
GCCAAAAACTTGACGGATGTTGCGGATATCCTCGATTCAAAGAAGGATAAGCGTGCCAGTGTCGTTCGAAAAGCA
TTGGAAAGGTGGGGTGCCATCGATATCGTCGATGCTGCTTTTAAAGTCATTGGTGAACGCGGCGTGACGCCATCT
TCTATCGTATTCCTCGTCTTGAAACTTCGTATCAGCCCACCAGGAAAAAAGGTTCAACGTAAAGAGCTCAGTGTG
GATGAAACCAAGCGGGCCATCAAGTATAATGAGAAGCAGGATGATGAATTCCTTTTATCGAAAAGTGAGATGGAG
GAATTTACAAACGAAGAAACCGTTGCCACTAGTGCACATGCACCTTACTGGCCTGGGGAACGTAAACCGTCGTGG
TGGGTTGTCCTAGCAGACGACAAACTCAATCGCATAGTCGTTCCACCTTTCAAAGTCACTGATGTACCCTATGCC
AATTCTGATGCTGAACACGAGCGCGACTATCGATCATACAAAATTCAATTCCAGGCTCCACAAAATGTGGGAATG
TTCACATGGAAGGTTTATTTGGTCTCGGATACATTCGTTGGAGAAGATGTGACTAGAGATATCATCTTGAAAATC
GAGCAGCCTCAGGCTATGGAATCACCTGACGATGAAATTTCAGATCCTGAGGAAGATTCACTCGCGGGTCAGATG
GCTGCCATGCGTGGTGGGAAGGTGAAGAAGCTTGCAGATCAAGGAGATGATGATGATGAGAGTAGTACTGACGAT
GATGAGGAAGAGAATGAGAGTAGTGATAGCGACAGCGATTAG
Gene >AgabiH97|069350
ATGGCAAACTATCACTACGATGAAGGCGGCAGCTTGGCTGCATACTTTCTCATCACTATACTTGCTTTGGTCCTT
ACCCCGATGACGCTGTCTTCAATTAGCAAGAGACCAGCGAGTATGTTGCTTTTCTTATCGAGATTTATTGACGGT
GTTTCTCATGGACGGCCAACGTGTGTATTTAGAACAACATCCGAGAGGCTGCCAGTGTCAGGCGTGCCTTGACCA
ACGAGCAAGGATTGCAAAACGAGAGAAGGGCACAATACTGGCCTTTAATCTCAGCAAGAAGTATGGTTCTTTTCT
CCCAAGATTCTATGATACTAATATCTATGCAGGACATACTTCCTAATTGCTGGCTGGACACTGTTCGCATTCCTC
TGCTATAAGGTCTCCGGCGCTGTGGTCGAGAACAAGCTCTACAATCCTTTTGAAATCCTTGGAATCAGTCCAGTG
AGTTCATAATTTCCGGAAAGTCAATTACAAATTATATATGCAAATACAGAGTCTGTCTGAGAAAGATATCAAATC
TCATTACAAGAAACTCTCGAAACAATTGTACGTCACAATACGAATACTCCCGTTTTGCCCGTTAACTCAATTATA
ATCAGCCATCCGGACAAAGTAAAACCATCAGCCAACGAGACCGCGGAAGAAATTTCAGATCGTTTCGTTCAACTC
ACCAAAGCCTACAAATCCCTCACAGACGAAACAATCCGCAAGAATTGGGAACTATATGGCAACCCGGATGGCCGT
CAAGAGATGTCCATGGGTATCGCTCTACCAAAATGGATCGTCGAATCTCACAACAATATCTGGGTGCTTGGAATT
TATGGTTTGATTTTCGGGGGTGCCTTACCTGCCCTAGTCGGCCGGTGGTGGTTTGGTAGCAGGCAAAAAACGAAA
GACGGTGTAAATGCGAAATCAGCTGCCGTTTTCTTCAAAAGCTTGAAGGAAGAGAGTATGATGGAAGAAGTCGTT
GGCACACTCGGCAAGGCATATCAATTCGAAATGTCAGACGTAGGCGTCAAAAAGGTGGATGTAAATATTGATAGG
CTTGAAAGTGAGATTGAGAAGAGGGCTGGTGTGAAGTGGAGTGAAGTTAGGAAGATCGCGAAGGACGTCGACGGC
AAACTCCACGTGAAACGTCGGAGAGCACTCGTTTTACTTTACGCTCACTTGCTGAGAATTGATATTTCCGACGAA
AAATTGCAAAAGGGTGTGTGTCATTGTTCTATTCTAGCTGACTGATGTTGATTACTTGGTTTATAGAACAAGCTC
AGATTCTCCTTCAAATTCCTCTTCTTTTAAATGCTCTCCTCAACGTGTCAATCTCACGCAATTGGCTCCTACCAT
CGTTGGCAATCATGCGTCTCAATGCCTATTTCGCCCAAGCTCTACCTCCGGTCGAGGACGAGCGGCTACGACTTA
CTCAACTACCTTTTATCCAGAAGGCGGACGTTGAGACCCTTGGTGATGCCAAAAACTTGACGGATGTTGCGGATA
TCCTCGATTCAAAGAAGGATAAGCGTGCCAGTGTCGTTCGAAAAGCATTGGAAAGGTGGGGTGCCATCGATATCG
TCGATGCTGCTTTTAAAGGTTCGTTACCGTGATCCCATAGCTTTTGTCAACTTGCCTGATCATTATATTGTTTAT
AGTCATTGGTGAACGCGGCGTGACGCCATCTTCTATCGTATTCCTCGTCTTGAAACTTCGTATCAGCCCACCAGG
AAAAAAGGTTCAACGTAAAGAGCTCAGTGTGGATGAAACCAAGCGGGCCATCAAGTATAATGAGAAGCAGGATGA
TGAATTCCTTTTATCGAAAAGTGAGATGGAGGAATTTACAAACGAAGAAACCGTTGCCACTAGTGCACATGCACC
TTACTGGCCTGGGGTATGTTTTATATTCTGATCTATTTAACCATTTACTAAACCTTGTATATGTTTGTGTGGAAT
TTATAGGAACGTAAACCGTCGTGGTGGGTTGTCCTAGCAGACGACAAACTCAATCGCATAGTCGTTCCACCTTTC
AAAGTCACTGATGTACCCTATGCCAATTCTGATGCTGAACACGAGCGCGACTATCGATCATACAAAATTCAATTC
CAGGCTCCACAAAATGTGGGAATGTTCACATGGAAGGTTTATTTGGTCTCGGATACATTCGTTGGAGAAGATGTG
ACTAGAGATATCATCGTACGTATCATAATATCTATAATGGTGCTCAAACTGACTCTTTCTTATAGTTGAAAATCG
AGCAGCCTCAGGCTATGGAATCACCTGACGATGAAATTTCAGATCCTGAGGAAGATTCACTCGCGGGTCAGATGG
CTGCCATGCGTGGTGGGAAGGTGAAGAAGCTTGCAGATCAAGGAGATGATGATGATGAGAGTAGTACTGACGATG
ATGAGGAAGAGAATGAGAGTAGTGATAGCGACAGCGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail