Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069280
Gene name
Locationscaffold_4:1005340..1006942
Strand+
Gene length (bp)1602
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 91 113 22
3 215 237 22
4 242 264 22
5 453 475 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069280
MLLFLIMLAFIRQLEGAPITSFSTDTHSTMPFLLFTRADAEMCAQSDHRTIGDIVWGCLITIFACTWIAVHPNIP
ARTDSRWCVFKRGLSTMIYALIAPELMVAWALHQYLGARQIMHKYNKDVLHYKPKPIAFYRRVLNYIKKWFQEEC
DKPGDVKWTKTHGFFIQMGGFMLYRDGLPVEVLTYESFKEHIDKKEIDVPRITERTINDKSKSDYLSKGFVVVQT
TWFVVQCIARWARSLPLVELEVVTLAFAVLNAITYALWLNKPQNVQEAIRIDLKPNSDIDADVKKPEPSIASSQS
SSPLEPILPKSQLPYRSGGTQSWLHHRLLKDHDRLQGSRCGLLWFVIYRIPYRLITSALRPMKKLIVCNPQDGPS
PRVPMFGYETPESLHPALEPYLPCLIGASFGLLHVMAWKSGPTELEQQLWRCSTLVITIEPLLFAVAKRLTSRKK
AAFSLWAGIGYVLIMLIWFPFIIGLPAYVVARVALFTQALASLRQLPPAAYCDVDWGSFIPHI*
Coding >AgabiH97|069280
ATGCTGCTCTTCCTGATCATGTTAGCCTTCATACGGCAGCTTGAGGGAGCTCCCATTACGAGTTTTTCTACGGAC
ACTCATTCGACAATGCCTTTCCTACTATTCACTCGCGCAGACGCTGAAATGTGTGCGCAGTCTGATCACAGGACG
ATCGGGGACATAGTCTGGGGCTGTCTCATCACCATTTTTGCCTGCACATGGATTGCTGTTCACCCAAACATACCT
GCCCGAACTGATTCCCGTTGGTGTGTTTTCAAACGGGGACTATCGACCATGATCTATGCCCTCATAGCCCCAGAA
CTTATGGTGGCTTGGGCGCTACACCAGTATCTGGGTGCCCGACAAATCATGCACAAATACAACAAGGACGTTCTG
CATTATAAACCAAAGCCTATCGCTTTTTATCGGCGAGTGCTAAATTATATCAAGAAGTGGTTTCAGGAGGAGTGC
GATAAACCTGGCGACGTCAAATGGACGAAAACACATGGTTTCTTCATTCAAATGGGAGGTTTTATGCTATACAGG
GATGGATTACCTGTCGAAGTCCTCACATACGAGAGTTTCAAAGAACATATTGACAAAAAAGAAATCGACGTACCG
AGGATCACCGAACGAACAATCAACGACAAGAGCAAAAGCGACTACCTCTCAAAAGGTTTCGTTGTCGTACAAACA
ACCTGGTTTGTGGTTCAGTGTATAGCCCGTTGGGCGAGGTCTCTTCCCTTAGTGGAGTTGGAGGTTGTAACACTT
GCCTTTGCCGTTCTAAATGCCATCACATACGCCCTATGGCTCAACAAGCCTCAGAACGTCCAGGAGGCGATCAGG
ATTGATCTAAAGCCCAACAGCGACATCGATGCTGACGTCAAAAAGCCGGAACCCTCCATAGCATCATCTCAATCG
TCCAGCCCTCTGGAACCTATCCTGCCAAAGTCCCAGCTTCCCTACCGGTCCGGCGGTACGCAGAGCTGGTTGCAC
CACCGTTTACTCAAAGACCACGACCGACTACAGGGGTCGAGGTGCGGGCTTCTGTGGTTCGTAATATACCGCATC
CCATACCGCCTCATCACATCAGCTCTTCGCCCTATGAAGAAACTCATTGTCTGCAATCCGCAGGACGGACCTTCC
CCGCGCGTACCGATGTTCGGCTACGAAACTCCAGAATCACTTCATCCAGCGTTGGAGCCATATCTTCCTTGCCTC
ATCGGAGCATCATTCGGGCTGCTACACGTCATGGCTTGGAAGTCCGGGCCTACCGAGCTCGAGCAACAGCTTTGG
AGATGCTCGACCCTCGTGATCACAATTGAACCCTTGCTTTTTGCAGTCGCAAAGCGTCTAACTAGTCGTAAAAAG
GCAGCTTTTAGCTTATGGGCAGGTATTGGATATGTTCTGATAATGTTGATTTGGTTTCCTTTCATCATTGGTCTC
CCTGCTTATGTGGTCGCGCGCGTTGCACTTTTCACGCAAGCGTTAGCTTCCCTTAGGCAATTGCCTCCAGCAGCG
TACTGCGACGTTGACTGGGGTTCGTTTATTCCTCATATTTGA
Transcript >AgabiH97|069280
ATGCTGCTCTTCCTGATCATGTTAGCCTTCATACGGCAGCTTGAGGGAGCTCCCATTACGAGTTTTTCTACGGAC
ACTCATTCGACAATGCCTTTCCTACTATTCACTCGCGCAGACGCTGAAATGTGTGCGCAGTCTGATCACAGGACG
ATCGGGGACATAGTCTGGGGCTGTCTCATCACCATTTTTGCCTGCACATGGATTGCTGTTCACCCAAACATACCT
GCCCGAACTGATTCCCGTTGGTGTGTTTTCAAACGGGGACTATCGACCATGATCTATGCCCTCATAGCCCCAGAA
CTTATGGTGGCTTGGGCGCTACACCAGTATCTGGGTGCCCGACAAATCATGCACAAATACAACAAGGACGTTCTG
CATTATAAACCAAAGCCTATCGCTTTTTATCGGCGAGTGCTAAATTATATCAAGAAGTGGTTTCAGGAGGAGTGC
GATAAACCTGGCGACGTCAAATGGACGAAAACACATGGTTTCTTCATTCAAATGGGAGGTTTTATGCTATACAGG
GATGGATTACCTGTCGAAGTCCTCACATACGAGAGTTTCAAAGAACATATTGACAAAAAAGAAATCGACGTACCG
AGGATCACCGAACGAACAATCAACGACAAGAGCAAAAGCGACTACCTCTCAAAAGGTTTCGTTGTCGTACAAACA
ACCTGGTTTGTGGTTCAGTGTATAGCCCGTTGGGCGAGGTCTCTTCCCTTAGTGGAGTTGGAGGTTGTAACACTT
GCCTTTGCCGTTCTAAATGCCATCACATACGCCCTATGGCTCAACAAGCCTCAGAACGTCCAGGAGGCGATCAGG
ATTGATCTAAAGCCCAACAGCGACATCGATGCTGACGTCAAAAAGCCGGAACCCTCCATAGCATCATCTCAATCG
TCCAGCCCTCTGGAACCTATCCTGCCAAAGTCCCAGCTTCCCTACCGGTCCGGCGGTACGCAGAGCTGGTTGCAC
CACCGTTTACTCAAAGACCACGACCGACTACAGGGGTCGAGGTGCGGGCTTCTGTGGTTCGTAATATACCGCATC
CCATACCGCCTCATCACATCAGCTCTTCGCCCTATGAAGAAACTCATTGTCTGCAATCCGCAGGACGGACCTTCC
CCGCGCGTACCGATGTTCGGCTACGAAACTCCAGAATCACTTCATCCAGCGTTGGAGCCATATCTTCCTTGCCTC
ATCGGAGCATCATTCGGGCTGCTACACGTCATGGCTTGGAAGTCCGGGCCTACCGAGCTCGAGCAACAGCTTTGG
AGATGCTCGACCCTCGTGATCACAATTGAACCCTTGCTTTTTGCAGTCGCAAAGCGTCTAACTAGTCGTAAAAAG
GCAGCTTTTAGCTTATGGGCAGGTATTGGATATGTTCTGATAATGTTGATTTGGTTTCCTTTCATCATTGGTCTC
CCTGCTTATGTGGTCGCGCGCGTTGCACTTTTCACGCAAGCGTTAGCTTCCCTTAGGCAATTGCCTCCAGCAGCG
TACTGCGACGTTGACTGGGGTTCGTTTATTCCTCATATTTGA
Gene >AgabiH97|069280
ATGCTGCTCTTCCTGATCATGTTAGCCTTCATACGGCAGCTTGAGGGAGCTCCCATTACGAGTTTTTCTACGGAC
ACTCATTCGACAATGCCTTTCCTACTATTCACTCGCGCAGACGCTGAAATGTGTGCGCAGTCTGATCACAGGACG
ATCGGGGACATAGTCTGGGGCTGTCTCATCACCATTTTTGCCTGCACATGGATTGCTGTTCACCCAAACATACCT
GCCCGAACTGATTCCCGTTGGTGTGTTTTCAAACGGGGACTATCGACCATGATCTATGCCCTCATAGCCCCAGAA
CTTATGGTGGCTTGGGCGCTACACCAGTATCTGGGTGCCCGACAAATCATGCACAAATACAACAAGGACGTTCTG
CATTGTACGTAAAAGCTTTTCGTTCGCGTTTGCTTTTGCTTACGGTATTATCACCATACACTAGATAAACCAAAG
CCTATCGCTTTTTATCGGCGAGTGCTAAATTATATCAAGAAGTGGTTTCAGGAGGAGTGCGATAAACCTGGCGAC
GTCAAATGGACGAAAACACATGGTTTCTTCATTCAAATGGGAGGTTTTATGCTATACAGGGATGGATTACCTGTC
GAAGTCCTCACATACGAGAGTTTCAAAGAACATATTGACAAAAAAGAAATCGACGTACCGAGGATCACCGAACGA
ACAATCAACGACAAGAGCAAAAGCGACTACCTCTCAAAAGGTTTCGTTGTCGTACAAACAACCTGGTTTGTGGTT
CAGTGTATAGCCCGTTGGGCGAGGTCTCTTCCCTTAGTGGAGTTGGAGGTTGTAACACTTGCCTTTGCCGTTCTA
AATGCCATCACATACGCCCTATGGCTCAACAAGCCTCAGAACGTCCAGGAGGCGATCAGGATTGATCTAAAGCCC
AACAGCGACATCGATGCTGACGTCAAAAAGCCGGAACCCTCCATAGCATCATCTCAATCGTCCAGCCCTCTGGAA
CCTATCCTGCCAAAGTCCCAGCTTCCCTACCGGTCCGGCGGTACGCAGAGCTGGTTGCACCACCGTTTACTCAAA
GACCACGACCGACTACAGGGGTCGAGGTGCGGGCTTCTGTGGTTCGTAATATACCGCATCCCATACCGCCTCATC
ACATCAGCTCTTCGCCCTATGAAGAAACTCATTGTCTGCAATCCGCAGGACGGACCTTCCCCGCGCGTACCGATG
TTCGGCTACGAAACTCCAGAATCACTTCATCCAGCGTTGGAGCCATATCTTCCTTGCCTCATCGGAGCATCATTC
GGGCTGCTACACGTCATGGCTTGGAAGTCCGGGCCTACCGAGCTCGAGCAACAGCTTTGGAGATGCTCGACCCTC
GTGATCACAATTGAACCCTTGCTTTTTGCAGTCGCAAAGCGTCTAACTAGTCGTAAAAAGGCAGCTTTTAGCTTA
TGGGCAGGTATTGGATATGTTCTGATAATGTTGATTTGGTTTCCTTTCATCATTGGTCTCCCTGCTTATGTGGTC
GCGCGCGTTGCACTTTTCACGCAAGCGTTAGCTTCCCTTAGGCAATTGCCTCCAGCAGCGTACTGCGACGTTGAC
TGGGGTTCGTTTATTCCTCATATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail