Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069260
Gene name
Locationscaffold_4:999588..1000875
Strand+
Gene length (bp)1287
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.3E-10 58 193

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 15.93 4.6 27.26
Initials Initials knots 0.35 0.0 0.74
Pileal_Stipeal_center Stage I stipe center 0.13 0.0 0.34
Pileal_Stipeal_shell Stage I stipe shell 0.06 0.0 0.18
DIF_stipe_center Stage II stipe center 0.10 0.0 0.28
DIF_stipe_shell Stage II stipe shell 0.03 0.0 0.11
DIF_stipe_skin Stage II stipe skin 0.09 0.0 0.24
DIF_cap_skin Stage II cap skin 0.15 0.0 0.37
DIF_cap_tissue Stage II cap tissue 0.11 0.0 0.32
DIF_gill_tissue Stage II gill tissue 0.23 0.0 0.54
YFB_stipe_center Young fruiting body stipe center 0.34 0.0 0.79
YFB_stipe_shell Young fruiting body stipe shell 0.47 0.0 0.98
YFB_stipe_skin Young fruiting body stipe skin 0.16 0.0 0.41
YFB_cap_skin Young fruiting body cap skin 0.36 0.0 0.77
YFB_cap_tissue Young fruiting body cap tissue 0.18 0.0 0.45
YFB_gill_tissue Young fruiting body gill tissue 0.19 0.0 0.46
YFB_veil Young fruiting body veil 0.24 0.0 0.60

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.009773 yes
Casing YFB_stipe_center 0.004160 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.037364 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.022111 yes
Casing YFB_gill_tissue 0.017783 yes
Casing YFB_veil 0.017507 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.153410 no
Casing Pileal_Stipeal_shell 0.364751 no
Casing DIF_stipe_center 0.175547 no
Casing DIF_stipe_shell 0.504737 no
Casing DIF_stipe_skin 0.257674 no
Casing DIF_cap_skin 0.055979 no
Casing DIF_cap_tissue 0.142649 no
DIF_gill_tissue YFB_stipe_center 0.786836 no
DIF_gill_tissue YFB_stipe_shell 0.478256 no
DIF_gill_tissue YFB_stipe_skin 1.000000 no
DIF_gill_tissue YFB_cap_skin 0.743567 no
DIF_gill_tissue YFB_cap_tissue 1.000000 no
DIF_gill_tissue YFB_gill_tissue 1.000000 no
DIF_gill_tissue YFB_veil 1.000000 no
YFB_stipe_center YFB_stipe_shell 0.798261 no
YFB_stipe_center YFB_stipe_skin 0.568546 no
YFB_stipe_center YFB_cap_skin 0.980893 no
YFB_stipe_center YFB_cap_tissue 0.616585 no
YFB_stipe_center YFB_gill_tissue 0.658297 no
YFB_stipe_center YFB_veil 0.818267 no
YFB_stipe_shell YFB_stipe_skin 0.335232 no
YFB_stipe_shell YFB_cap_skin 0.828166 no
YFB_stipe_shell YFB_cap_tissue 0.345468 no
YFB_stipe_shell YFB_gill_tissue 0.385946 no
YFB_stipe_shell YFB_veil 0.572218 no
YFB_stipe_skin YFB_cap_skin 0.531678 no
YFB_stipe_skin YFB_cap_tissue 1.000000 no
YFB_stipe_skin YFB_gill_tissue 1.000000 no
YFB_stipe_skin YFB_veil 1.000000 no
YFB_cap_skin YFB_cap_tissue 0.596238 no
YFB_cap_skin YFB_gill_tissue 0.611197 no
YFB_cap_skin YFB_veil 0.794189 no
YFB_cap_tissue YFB_gill_tissue 1.000000 no
YFB_cap_tissue YFB_veil 1.000000 no
YFB_gill_tissue YFB_veil 1.000000 no
Initials DIF_gill_tissue 0.739006 no
Initials YFB_stipe_center 0.980431 no
Initials YFB_stipe_shell 0.804827 no
Initials YFB_stipe_skin 0.520840 no
Initials YFB_cap_skin 0.979682 no
Initials YFB_cap_tissue 0.578662 no
Initials YFB_gill_tissue 0.601481 no
Initials YFB_veil 0.786797 no
Initials Pileal_Stipeal_center 0.493977 no
Initials Pileal_Stipeal_shell 0.375595 no
Initials DIF_stipe_center 0.394653 no
Initials DIF_stipe_shell 0.504935 no
Initials DIF_stipe_skin 0.365647 no
Initials DIF_cap_skin 0.465910 no
Initials DIF_cap_tissue 0.385626 no
Pileal_Stipeal_center DIF_gill_tissue 1.000000 no
Pileal_Stipeal_center YFB_stipe_center 0.530481 no
Pileal_Stipeal_center YFB_stipe_shell 0.357374 no
Pileal_Stipeal_center YFB_stipe_skin 1.000000 no
Pileal_Stipeal_center YFB_cap_skin 0.508639 no
Pileal_Stipeal_center YFB_cap_tissue 1.000000 no
Pileal_Stipeal_center YFB_gill_tissue 1.000000 no
Pileal_Stipeal_center YFB_veil 1.000000 no
Pileal_Stipeal_center Pileal_Stipeal_shell 1.000000 no
Pileal_Stipeal_center DIF_stipe_center 1.000000 no
Pileal_Stipeal_center DIF_stipe_shell 1.000000 no
Pileal_Stipeal_center DIF_stipe_skin 1.000000 no
Pileal_Stipeal_center DIF_cap_skin 1.000000 no
Pileal_Stipeal_center DIF_cap_tissue 1.000000 no
Pileal_Stipeal_shell DIF_gill_tissue 1.000000 no
Pileal_Stipeal_shell YFB_stipe_center 0.394498 no
Pileal_Stipeal_shell YFB_stipe_shell 0.367818 no
Pileal_Stipeal_shell YFB_stipe_skin 1.000000 no
Pileal_Stipeal_shell YFB_cap_skin 0.380464 no
Pileal_Stipeal_shell YFB_cap_tissue 1.000000 no
Pileal_Stipeal_shell YFB_gill_tissue 1.000000 no
Pileal_Stipeal_shell YFB_veil 1.000000 no
Pileal_Stipeal_shell DIF_stipe_center 1.000000 no
Pileal_Stipeal_shell DIF_stipe_shell 1.000000 no
Pileal_Stipeal_shell DIF_stipe_skin 1.000000 no
Pileal_Stipeal_shell DIF_cap_skin 1.000000 no
Pileal_Stipeal_shell DIF_cap_tissue 1.000000 no
DIF_stipe_center DIF_gill_tissue 1.000000 no
DIF_stipe_center YFB_stipe_center 0.433593 no
DIF_stipe_center YFB_stipe_shell 0.304778 no
DIF_stipe_center YFB_stipe_skin 1.000000 no
DIF_stipe_center YFB_cap_skin 0.414019 no
DIF_stipe_center YFB_cap_tissue 1.000000 no
DIF_stipe_center YFB_gill_tissue 1.000000 no
DIF_stipe_center YFB_veil 1.000000 no
DIF_stipe_center DIF_stipe_shell 1.000000 no
DIF_stipe_center DIF_stipe_skin 1.000000 no
DIF_stipe_center DIF_cap_skin 1.000000 no
DIF_stipe_center DIF_cap_tissue 1.000000 no
DIF_stipe_shell DIF_gill_tissue 1.000000 no
DIF_stipe_shell YFB_stipe_center 0.506327 no
DIF_stipe_shell YFB_stipe_shell 0.504585 no
DIF_stipe_shell YFB_stipe_skin 1.000000 no
DIF_stipe_shell YFB_cap_skin 0.504935 no
DIF_stipe_shell YFB_cap_tissue 1.000000 no
DIF_stipe_shell YFB_gill_tissue 1.000000 no
DIF_stipe_shell YFB_veil 1.000000 no
DIF_stipe_shell DIF_stipe_skin 1.000000 no
DIF_stipe_shell DIF_cap_skin 1.000000 no
DIF_stipe_shell DIF_cap_tissue 1.000000 no
DIF_stipe_skin DIF_gill_tissue 1.000000 no
DIF_stipe_skin YFB_stipe_center 0.424353 no
DIF_stipe_skin YFB_stipe_shell 0.310012 no
DIF_stipe_skin YFB_stipe_skin 1.000000 no
DIF_stipe_skin YFB_cap_skin 0.368322 no
DIF_stipe_skin YFB_cap_tissue 1.000000 no
DIF_stipe_skin YFB_gill_tissue 1.000000 no
DIF_stipe_skin YFB_veil 1.000000 no
DIF_stipe_skin DIF_cap_skin 1.000000 no
DIF_stipe_skin DIF_cap_tissue 1.000000 no
DIF_cap_skin DIF_gill_tissue 1.000000 no
DIF_cap_skin YFB_stipe_center 0.511055 no
DIF_cap_skin YFB_stipe_shell 0.305693 no
DIF_cap_skin YFB_stipe_skin 1.000000 no
DIF_cap_skin YFB_cap_skin 0.484539 no
DIF_cap_skin YFB_cap_tissue 1.000000 no
DIF_cap_skin YFB_gill_tissue 1.000000 no
DIF_cap_skin YFB_veil 1.000000 no
DIF_cap_skin DIF_cap_tissue 1.000000 no
DIF_cap_tissue DIF_gill_tissue 1.000000 no
DIF_cap_tissue YFB_stipe_center 0.404591 no
DIF_cap_tissue YFB_stipe_shell 0.272537 no
DIF_cap_tissue YFB_stipe_skin 1.000000 no
DIF_cap_tissue YFB_cap_skin 0.389002 no
DIF_cap_tissue YFB_cap_tissue 1.000000 no
DIF_cap_tissue YFB_gill_tissue 1.000000 no
DIF_cap_tissue YFB_veil 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069260
MLSTVAFLLTSLTLSTTAIVLPRDDVRLAVNPACGDYSSSSVKDVRGSLPDLKTFSTIVTFGDSYTDGGKHDGSP
LGPAAINAPIPSAGGRHTNGPVWAEYLAKAHGATLKDYASTGAVVDVNQWPERSFPTSNDFLTQANNFISQRNLT
DPDSTLYVVFFGIGDYVESLDHNNSSLSLQTQHILYTINRLASSPIFGKNFLFIDNHGRGTETPAGSSFKSQIFK
GMNSIQQLGLNTGFVDLSTMWDGVLSASSPGFEAFGYTSVEPCLDSSESTEGSCEDPEHAFYWFPGAPTTVTHKL
ISDYVQAVWDQC*
Coding >AgabiH97|069260
ATGCTTTCCACAGTCGCTTTCTTACTTACATCTCTCACTCTTTCTACTACCGCGATTGTTCTTCCTCGTGATGAT
GTCAGATTGGCTGTCAATCCGGCGTGTGGAGATTATTCTAGTAGTAGTGTGAAGGATGTGAGAGGAAGTTTACCT
GATCTTAAAACATTCAGTACTATCGTCACCTTCGGAGATTCTTATACCGATGGTGGTAAACATGATGGATCGCCT
TTGGGCCCTGCTGCCATCAATGCACCCATTCCATCTGCTGGAGGACGACATACTAATGGTCCCGTATGGGCAGAG
TATCTCGCTAAAGCTCATGGAGCCACTCTAAAGGATTACGCTTCGACGGGTGCCGTTGTTGATGTCAATCAATGG
CCTGAGCGTTCGTTCCCTACCTCAAACGACTTTTTAACGCAAGCCAATAATTTTATTAGCCAGCGGAACTTGACG
GATCCCGATTCAACTTTATATGTTGTCTTTTTTGGCATCGGGGACTATGTCGAATCACTCGACCATAACAATTCC
AGTTTATCATTACAAACCCAACATATCCTCTACACAATCAACCGCCTCGCCTCCTCTCCCATCTTCGGCAAAAAC
TTCCTCTTCATAGATAATCACGGACGTGGAACCGAAACCCCCGCGGGATCATCTTTCAAATCTCAAATATTCAAA
GGAATGAATTCGATCCAACAATTAGGTTTGAATACTGGGTTTGTGGATTTATCGACGATGTGGGATGGGGTTTTG
AGTGCGAGTTCTCCGGGGTTTGAGGCTTTTGGGTATACGAGTGTGGAACCGTGTTTGGATTCGAGTGAGTCTACG
GAGGGAAGTTGTGAAGATCCTGAACATGCTTTTTATTGGTTCCCTGGTGCTCCTACGACCGTTACACATAAACTT
ATTAGCGATTATGTACAAGCTGTTTGGGATCAATGCTAG
Transcript >AgabiH97|069260
ATGCTTTCCACAGTCGCTTTCTTACTTACATCTCTCACTCTTTCTACTACCGCGATTGTTCTTCCTCGTGATGAT
GTCAGATTGGCTGTCAATCCGGCGTGTGGAGATTATTCTAGTAGTAGTGTGAAGGATGTGAGAGGAAGTTTACCT
GATCTTAAAACATTCAGTACTATCGTCACCTTCGGAGATTCTTATACCGATGGTGGTAAACATGATGGATCGCCT
TTGGGCCCTGCTGCCATCAATGCACCCATTCCATCTGCTGGAGGACGACATACTAATGGTCCCGTATGGGCAGAG
TATCTCGCTAAAGCTCATGGAGCCACTCTAAAGGATTACGCTTCGACGGGTGCCGTTGTTGATGTCAATCAATGG
CCTGAGCGTTCGTTCCCTACCTCAAACGACTTTTTAACGCAAGCCAATAATTTTATTAGCCAGCGGAACTTGACG
GATCCCGATTCAACTTTATATGTTGTCTTTTTTGGCATCGGGGACTATGTCGAATCACTCGACCATAACAATTCC
AGTTTATCATTACAAACCCAACATATCCTCTACACAATCAACCGCCTCGCCTCCTCTCCCATCTTCGGCAAAAAC
TTCCTCTTCATAGATAATCACGGACGTGGAACCGAAACCCCCGCGGGATCATCTTTCAAATCTCAAATATTCAAA
GGAATGAATTCGATCCAACAATTAGGTTTGAATACTGGGTTTGTGGATTTATCGACGATGTGGGATGGGGTTTTG
AGTGCGAGTTCTCCGGGGTTTGAGGCTTTTGGGTATACGAGTGTGGAACCGTGTTTGGATTCGAGTGAGTCTACG
GAGGGAAGTTGTGAAGATCCTGAACATGCTTTTTATTGGTTCCCTGGTGCTCCTACGACCGTTACACATAAACTT
ATTAGCGATTATGTACAAGCTGTTTGGGATCAATGCTAG
Gene >AgabiH97|069260
ATGCTTTCCACAGTCGCTTTCTTACTTACATCTCTCACTCTTTCTACTACCGCGATTGTTCTTCCTCGTGATGAT
GTCAGATTGGCTGTCAATCCGGCGTGTGGAGATTATTCTAGTAGTAGTGTGAAGGATGTGAGAGGAAGTTTACCT
GATCTTAAAACATTCAGTACTATCGTCACCTTCGGAGTGAGTTTTTTTTTTCTATTTTGTGGATAATAATGTCTA
ATTGGAATGTATAGGATTCTTATACCGATGGTGGTAAACATGATGGATCGCCTTTGGGCCCTGCTGCCATCAATG
CACCCATTCCATCTGCTGGAGGACGACATACTAATGGTCCCGTATGGGCAGAGTATCTCGCTAAAGCTCATGGAG
CCACTCTAAAGGATTACGCTGTATGTTTTGTTTCATTCCACTTTAATTATCCTTTTTAAATTCAGAATTTTTCTA
GTCGACGGGTGCCGTTGTTGATGTCAATCAATGGCCTGAGCGTTCGTTCCCTACCTCAAACGACTTTTTAACGCA
AGGTGATATTAGCCAAAGTATTTTTTTTGGAGTTTCTGAATTTGAGTGAATTTCTCTTAGCCAATAATTTTATTA
GCCAGCGGAACTTGACGGATCCCGATTCAACTTTATATGTTGTCTTTTTTGGCATCGGGTAAGTGCACTCAATCA
ATACAATCATTTTTTTTGCTGAAATAATTAAAGGGACTATGTCGAATCACTCGGTAAGGAAATCCCAAACTCCAA
TTTCTACATAGTTAATAGTTCTTAACGTTGACCATATATCCTCACCAGACCATAACAATTCCAGTTTATCATTAC
AAACCCAACATATCCTCTACACAATCAACCGCCTCGCCTCCTCTCCCATCTTCGGCAAAAACTTCCTCTTCATAG
ATAATCACGGACGTGGAACCGAAACCCCCGCGGGATCATCTTTCAAATCTCAAATATTCAAAGGAATGAATTCGA
TCCAACAATTAGGTTTGAATACTGGGTTTGTGGATTTATCGACGATGTGGGATGGGGTTTTGAGTGCGAGTTCTC
CGGGGTTTGAGGCTTTTGGGTATACGAGTGTGGAACCGTGTTTGGATTCGAGTGAGTCTACGGAGGGAAGTTGTG
AAGATCCTGAACATGCTTTTTATTGGTTCCCTGGGTAAGTGAAAAAAAAATGAAAGCCTTGAGTAATTTTATTTA
CTGACATGTTTTGGGTGTAGTGCTCCTACGACCGTTACACATAAACTTATTAGCGATTATGTACAAGCTGTTTGG
GATCAATGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail