Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069220
Gene name
Locationscaffold_4:989867..992127
Strand+
Gene length (bp)2260
Transcript length (bp)1905
Coding sequence length (bp)1905
Protein length (aa) 635

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.0E-23 109 301
PF08386 Abhydrolase_4 TAP-like protein 2.7E-25 453 552

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 59 552 5.0E-33
sp|P9WHR3|CAEA_MYCTU Carboxylesterase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeA PE=1 SV=1 59 552 5.0E-33
sp|P9WHR2|CAEA_MYCTO Carboxylesterase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeA PE=3 SV=1 59 552 5.0E-33
sp|P65822|Y2247_MYCBO Putative hydrolase Mb2247c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2247c PE=3 SV=1 69 552 3.0E-30
sp|P9WHR5|CAEB_MYCTU Carboxylesterase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeB PE=1 SV=1 69 552 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 59 552 5.0E-33
sp|P9WHR3|CAEA_MYCTU Carboxylesterase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeA PE=1 SV=1 59 552 5.0E-33
sp|P9WHR2|CAEA_MYCTO Carboxylesterase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeA PE=3 SV=1 59 552 5.0E-33
sp|P65822|Y2247_MYCBO Putative hydrolase Mb2247c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2247c PE=3 SV=1 69 552 3.0E-30
sp|P9WHR5|CAEB_MYCTU Carboxylesterase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeB PE=1 SV=1 69 552 3.0E-30
sp|P9WHR4|CAEB_MYCTO Carboxylesterase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeB PE=3 SV=1 69 552 3.0E-30
sp|Q54410|TAP_STRLI Tripeptidyl aminopeptidase OS=Streptomyces lividans GN=tap PE=1 SV=1 69 272 4.0E-21
sp|Q9FCD7|TAP_STRCO Tripeptidyl aminopeptidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tap PE=3 SV=1 69 272 6.0E-21
sp|P34211|YUAR_ECOLI Putative hydrolase YuaR OS=Escherichia coli (strain K12) GN=yuaR PE=3 SV=3 70 541 9.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069220
MDTWSLARLRVVLAVALLVLVLSLILLSGLADGDYEAISSSAVKDFYWIDIKPSHDLVWHPCYNSLRRECARLLV
PLDHLNHSDENPGHAAIALIRVPSPFLSTPRYRGPILFNPGGPGGSGVDLVNLLGDDLALVVGEGFDVVGFDPRG
VARSTPKVNFFDGPGERAAWGDTLDVIRGGPNDELQGESGRSIEKTWARAVVTNKLVGERGGDWLGNINTEQTAH
DMLSIVKAYGREKLMYWGFSYGTILGSTFAALFPDNVERMVLDGVVDSADYYATAWNTNLLNTSETLHQFFTSCH
QAGPSSCPFWAPTPSLISANLTRIYHDLVANPIPVRGSTAYGVLDYSFVRQGIFAALYAPYATWPALADALAALG
GPQRDPTLMWNFTPREMFKCSCSGSCDDESDKDEREKDFVKALPDGQAAILCSDGESIPFNISSSRAYLEDLSKT
SEWADIWANIHLSCTGWPKAKKPFRGPIEGNTSFPILFIGNTADPVTPLVHARTMSKRFPGSRVLTQDSPGHCSL
NSPSICTQAHVQNYFLTGTLPAEGTICPVIMPPFPPASSEDNYNDVNEGVVVGDSREKEMVFDAGEKKAENVGSG
DASEILMMMMDKKMKDVVVELSKAWKPFNRPLLG*
Coding >AgabiH97|069220
ATGGATACCTGGTCTCTGGCTCGCTTGCGGGTTGTGTTGGCAGTCGCCTTGCTGGTCTTGGTTCTGTCACTCATT
CTACTCAGTGGACTAGCTGATGGTGATTATGAAGCCATTTCGTCCTCCGCAGTCAAAGACTTTTATTGGATTGAC
ATCAAACCATCACACGATCTAGTTTGGCATCCGTGCTACAACTCTTTGCGTCGTGAATGTGCTCGTCTCCTAGTC
CCTCTTGATCACCTTAACCACTCCGACGAAAATCCCGGCCATGCCGCCATCGCACTCATACGGGTCCCTTCTCCC
TTCTTGTCTACTCCACGCTATCGTGGTCCGATTCTCTTCAACCCAGGAGGCCCAGGTGGTAGTGGGGTTGACTTA
GTCAACCTATTGGGAGATGATTTGGCTCTGGTGGTGGGTGAAGGATTTGATGTCGTAGGTTTTGATCCCAGAGGT
GTTGCTCGTTCTACGCCCAAGGTAAATTTCTTCGATGGGCCCGGAGAGAGAGCAGCTTGGGGAGATACCCTGGAT
GTCATCCGTGGCGGACCTAACGATGAATTGCAAGGGGAGAGTGGTAGAAGTATCGAAAAGACATGGGCACGAGCA
GTGGTGACGAACAAGTTAGTTGGCGAACGAGGGGGCGACTGGTTGGGCAACATCAACACGGAACAGACTGCGCAT
GACATGTTGAGTATCGTCAAGGCATATGGAAGGGAGAAGCTCATGTATTGGGGTTTTTCGTATGGCACTATACTG
GGCTCAACATTCGCTGCTCTATTTCCGGACAATGTGGAGAGGATGGTATTGGATGGAGTTGTGGACTCCGCAGAT
TATTACGCGACGGCATGGAATACCAACCTCTTAAATACCTCCGAAACTCTCCATCAATTCTTCACATCATGCCAC
CAGGCTGGCCCCAGCTCCTGCCCATTCTGGGCCCCGACTCCATCTTTGATCTCTGCCAATTTAACTCGCATTTAT
CACGATCTTGTAGCGAACCCAATCCCAGTCCGTGGCTCTACCGCTTATGGAGTTCTCGATTATTCTTTCGTTCGA
CAAGGAATATTCGCAGCCTTATACGCTCCTTACGCAACATGGCCTGCTCTAGCCGACGCTCTAGCTGCTCTTGGT
GGACCACAACGTGATCCCACTTTAATGTGGAATTTCACTCCTCGTGAAATGTTCAAGTGCTCTTGTTCTGGTTCT
TGTGACGATGAGAGTGACAAAGATGAACGAGAGAAAGATTTCGTAAAAGCTCTTCCTGATGGACAAGCCGCAATC
TTATGTTCTGATGGAGAAAGCATTCCATTCAATATCTCCTCTTCCAGAGCTTACTTGGAAGACTTGAGCAAAACA
TCTGAATGGGCGGATATATGGGCAAATATACATTTATCGTGTACCGGCTGGCCCAAGGCAAAGAAACCGTTCCGA
GGACCCATAGAGGGCAATACGAGCTTCCCTATTCTCTTCATCGGGAATACTGCGGATCCTGTTACACCTCTTGTT
CACGCAAGGACCATGTCAAAACGGTTTCCCGGCTCGCGAGTTCTTACACAAGATTCTCCCGGCCATTGCTCGCTT
AATTCACCATCGATCTGTACCCAAGCTCATGTCCAGAATTATTTCCTTACTGGTACCCTCCCTGCTGAAGGTACT
ATTTGTCCCGTCATCATGCCTCCATTCCCTCCCGCATCCTCAGAAGACAACTATAACGATGTGAATGAAGGAGTC
GTAGTAGGTGATAGCCGTGAAAAGGAGATGGTATTTGATGCAGGTGAAAAGAAGGCCGAGAACGTTGGCAGTGGT
GATGCAAGCGAGATATTGATGATGATGATGGACAAAAAGATGAAGGATGTGGTAGTCGAATTGAGTAAGGCTTGG
AAACCTTTCAATCGGCCGTTATTGGGATGA
Transcript >AgabiH97|069220
ATGGATACCTGGTCTCTGGCTCGCTTGCGGGTTGTGTTGGCAGTCGCCTTGCTGGTCTTGGTTCTGTCACTCATT
CTACTCAGTGGACTAGCTGATGGTGATTATGAAGCCATTTCGTCCTCCGCAGTCAAAGACTTTTATTGGATTGAC
ATCAAACCATCACACGATCTAGTTTGGCATCCGTGCTACAACTCTTTGCGTCGTGAATGTGCTCGTCTCCTAGTC
CCTCTTGATCACCTTAACCACTCCGACGAAAATCCCGGCCATGCCGCCATCGCACTCATACGGGTCCCTTCTCCC
TTCTTGTCTACTCCACGCTATCGTGGTCCGATTCTCTTCAACCCAGGAGGCCCAGGTGGTAGTGGGGTTGACTTA
GTCAACCTATTGGGAGATGATTTGGCTCTGGTGGTGGGTGAAGGATTTGATGTCGTAGGTTTTGATCCCAGAGGT
GTTGCTCGTTCTACGCCCAAGGTAAATTTCTTCGATGGGCCCGGAGAGAGAGCAGCTTGGGGAGATACCCTGGAT
GTCATCCGTGGCGGACCTAACGATGAATTGCAAGGGGAGAGTGGTAGAAGTATCGAAAAGACATGGGCACGAGCA
GTGGTGACGAACAAGTTAGTTGGCGAACGAGGGGGCGACTGGTTGGGCAACATCAACACGGAACAGACTGCGCAT
GACATGTTGAGTATCGTCAAGGCATATGGAAGGGAGAAGCTCATGTATTGGGGTTTTTCGTATGGCACTATACTG
GGCTCAACATTCGCTGCTCTATTTCCGGACAATGTGGAGAGGATGGTATTGGATGGAGTTGTGGACTCCGCAGAT
TATTACGCGACGGCATGGAATACCAACCTCTTAAATACCTCCGAAACTCTCCATCAATTCTTCACATCATGCCAC
CAGGCTGGCCCCAGCTCCTGCCCATTCTGGGCCCCGACTCCATCTTTGATCTCTGCCAATTTAACTCGCATTTAT
CACGATCTTGTAGCGAACCCAATCCCAGTCCGTGGCTCTACCGCTTATGGAGTTCTCGATTATTCTTTCGTTCGA
CAAGGAATATTCGCAGCCTTATACGCTCCTTACGCAACATGGCCTGCTCTAGCCGACGCTCTAGCTGCTCTTGGT
GGACCACAACGTGATCCCACTTTAATGTGGAATTTCACTCCTCGTGAAATGTTCAAGTGCTCTTGTTCTGGTTCT
TGTGACGATGAGAGTGACAAAGATGAACGAGAGAAAGATTTCGTAAAAGCTCTTCCTGATGGACAAGCCGCAATC
TTATGTTCTGATGGAGAAAGCATTCCATTCAATATCTCCTCTTCCAGAGCTTACTTGGAAGACTTGAGCAAAACA
TCTGAATGGGCGGATATATGGGCAAATATACATTTATCGTGTACCGGCTGGCCCAAGGCAAAGAAACCGTTCCGA
GGACCCATAGAGGGCAATACGAGCTTCCCTATTCTCTTCATCGGGAATACTGCGGATCCTGTTACACCTCTTGTT
CACGCAAGGACCATGTCAAAACGGTTTCCCGGCTCGCGAGTTCTTACACAAGATTCTCCCGGCCATTGCTCGCTT
AATTCACCATCGATCTGTACCCAAGCTCATGTCCAGAATTATTTCCTTACTGGTACCCTCCCTGCTGAAGGTACT
ATTTGTCCCGTCATCATGCCTCCATTCCCTCCCGCATCCTCAGAAGACAACTATAACGATGTGAATGAAGGAGTC
GTAGTAGGTGATAGCCGTGAAAAGGAGATGGTATTTGATGCAGGTGAAAAGAAGGCCGAGAACGTTGGCAGTGGT
GATGCAAGCGAGATATTGATGATGATGATGGACAAAAAGATGAAGGATGTGGTAGTCGAATTGAGTAAGGCTTGG
AAACCTTTCAATCGGCCGTTATTGGGATGA
Gene >AgabiH97|069220
ATGGATACCTGGTCTCTGGCTCGCTTGCGGGTTGTGTTGGCAGTCGCCTTGCTGGTCTTGGTTCTGTCACTCATT
CTACTCAGTGGACTAGCTGATGGTGATTATGAAGCCATTTCGTCCTCCGCAGTCAAAGACTTTTATTGGATTGAC
GTGAGTTACATGTTTAAACAACATGAACTTGCCTTGATGAACTTCTCTGTAGATCAAACCATCACACGATCTAGT
TTGGCATCCGTGCTACAACTCTTTGCGTCGTGAATGTGCTCGTCTCCTAGTCCCTCTTGATCACCTTAACCACTC
CGACGAAAATCCCGGCCATGCCGCCATCGCACTCATACGGGTCCCTTCTCCCTTCTTGTCTACTCCACGCTATCG
TGGTCCGATTCTCTTCAACCCAGGAGGCCCAGGTGGTAGTGGGGTTGACTTAGTCAACCTATTGGGAGATGATTT
GGCTCTGGTGGTGGGTGAAGGATTTGATGTCGTAGGTTTTGATCCCAGAGGTGTTGCTCGTTCTACGCCCAAGGT
AAATTTCTTCGATGGGCCCGGAGAGAGAGCAGCTTGGGGAGATACCCTGGATGTCATCCGTGGCGGACCTAACGA
TGAATTGCAAGGGGAGAGTGGTAGAAGTATCGAAAAGACATGGGCACGAGCAGTGGTGACGAACAAGTTAGTTGG
CGAACGAGGGGGCGACTGGTTGGGCAACATCAACACGGAACAGACTGCGCATGACATGTTGAGTATCGTCAAGGC
ATATGGAAGGGAGAAGCTCATGTATTGGGGTTTTTCGTATGGCACTATACTGGGCTCAACATTCGCTGCTCTATT
TCCGGTATGTCATATGTGTGTTCGTACACCCTCACGATTACCCTAACACTGCGTAGGACAATGTGGAGAGGATGG
TATTGGATGGAGTTGTGGACTCCGCAGATTATTACGCGAGTGCGTAACCTCTCCCGTCTTTCAACTCTTCTCTAA
TCCCTGTTTCTTCTTAGCGGCATGGAATACCAACCTCTTAAATACCTCCGAAACTCTCCATCAATTCTTCACATC
ATGCCACCAGGCTGGCCCCAGCTCCTGCCCATTCTGGGCCCCGACTCCATCTTTGATCTCTGCCAATTTAACTCG
CATTTATCACGATCTTGTAGCGAACCCAATCCCAGTCCGTGGCTCTACCGCTTATGGAGTTCTCGATTATTCTTT
CGTTCGACAAGGAATATTCGCAGCCTTATACGCTCCTTACGCAACATGGCCTGCTCTAGCCGACGCTCTAGCTGC
TCTTGGTGGACCACAACGTGATCCCACTTTAATGTGGAATTTCACTCCTCGTGAAATGTTCAAGTGCTCTTGTTC
TGGTTCTTGTGACGATGAGAGTGACAAAGATGAACGAGAGAAAGATTTCGTAAAAGCTCTTCCTGATGGACAAGC
CGCAATCTTATGTTCTGATGGAGAAAGCATTCCATTCAATATCTCCTCTTCCAGAGCTTACTTGGAAGACTTGAG
CAAAACATCTGAATGGGCGGATATATGGGCAAATATACATTTATCGTGTACCGGCTGGCCCAAGGCAAAGAAACC
GTTCCGAGGACCCATAGAGGGCAATACGAGCTTCCCTATTCTCTTCATCGGGAATACTGCGGGTATGTCGTTTCG
GACTTGATATTTTCATACTTGGCGTTACTCATCATAACTCTTGCTACTCCTCGATCTTAGATCCTGTTACACCTC
TTGTTCAGTGAGCACCAACCATCATGTCACTTATCCCATCATGACTGACAACGTGTTTACAGCGCAAGGACCATG
TCAAAACGGTTTCCCGGCTCGCGAGTTCTTACACAAGATTCTCCCGGCGTATGTTTTTCGTTTGTCTTACGAAAT
GATTACCGAAGTATTCATCATTTTATTCTATTTTATTTTCCAGCATTGCTCGCTTAATTCACCATCGATCTGTAC
CCAAGCTCATGTCCAGAATTATTTCCTTACTGGTACCCTCCCTGCTGAAGGTACTATTTGTCCCGTCATCATGCC
TCCATTCCCTCCCGCATCCTCAGAAGACAACTATAACGATGTGAATGAAGGAGTCGTAGTAGGTGATAGCCGTGA
AAAGGAGATGGTATTTGATGCAGGTGAAAAGAAGGCCGAGAACGTTGGCAGTGGTGATGCAAGCGAGATATTGAT
GATGATGATGGACAAAAAGATGAAGGATGTGGTAGTCGAATTGAGTAAGGCTTGGAAACCTTTCAATCGGCCGTT
ATTGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail