Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|069200
Gene name
Locationscaffold_4:985931..988149
Strand-
Gene length (bp)2218
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-31 76 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 75 408 5.0E-39
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 75 416 3.0E-34
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 46 417 5.0E-33
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 82 489 6.0E-33
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 75 387 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 75 408 5.0E-39
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 75 416 3.0E-34
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 46 417 5.0E-33
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 82 489 6.0E-33
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 75 387 2.0E-32
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 79 398 5.0E-31
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 72 278 8.0E-29
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 77 487 1.0E-26
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 72 288 3.0E-26
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 74 452 2.0E-21
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 75 382 2.0E-21
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 72 447 3.0E-20
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 70 415 4.0E-20
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 60 285 8.0E-20
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 70 360 4.0E-18
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 72 459 3.0E-17
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 86 395 6.0E-16
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 74 369 2.0E-15
sp|P39398|LGOT_ECOLI Probable L-galactonate transporter OS=Escherichia coli (strain K12) GN=lgoT PE=1 SV=2 73 248 7.0E-12
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 72 407 8.0E-12
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 61 297 8.0E-12
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 72 403 2.0E-11
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 112 493 2.0E-11
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 72 281 2.0E-09
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 74 282 4.0E-09
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 144 285 8.0E-09
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 116 411 4.0E-08
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 72 262 2.0E-07
sp|P42237|GUDP_BACSU Probable glucarate transporter OS=Bacillus subtilis (strain 168) GN=gudP PE=3 SV=2 74 249 4.0E-07
sp|P0AA80|GARP_ECOLI Probable galactarate transporter OS=Escherichia coli (strain K12) GN=garP PE=1 SV=1 69 240 4.0E-07
sp|P0AA81|GARP_ECO57 Probable galactarate transporter OS=Escherichia coli O157:H7 GN=garP PE=3 SV=1 69 240 4.0E-07
sp|P0AA76|DGOT_ECOLI D-galactonate transporter OS=Escherichia coli (strain K12) GN=dgoT PE=1 SV=1 72 318 5.0E-07
sp|P0AA77|DGOT_ECOL6 D-galactonate transporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dgoT PE=3 SV=1 72 318 5.0E-07
sp|P37489|YYBO_BACSU Uncharacterized transporter YybO OS=Bacillus subtilis (strain 168) GN=yybO PE=3 SV=1 73 248 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 108 130 22
3 137 159 22
4 163 185 22
5 198 220 22
6 235 254 19
7 310 332 22
8 352 374 22
9 386 408 22
10 423 445 22
11 454 476 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|069200
MRSKAQGFSSDRSNYPVIIIFHCPRIEIQEGNLRTLVKYVNGRAFSTSTTTSNTFTTAIWIEFLAPAYNVRMSML
LLMYIVNYIDRISAAAARLRGFEDDLKLKGAKFASILSIFYVGYITLQVPSNMILSQVKKPSLYIPCCMMVWGVI
SFMTGFVTNYCSALAARFLLGFSVAAFFPGALYLIARWYKRDELSLRIAFFACGSNLSNAFGSLIASAVLDLLDG
ALGYSAWRWLFFVEGAFTILVAIIATFILPDFPESENISWLTSSEHALAKARMREDTATEITRPESLNQYNVKSM
KRFYNVSAGNLVLAISDWKVWYMALAELVSIISSSHYLYFPTLTKTMGYNTTISLLLCAPPWLLTAVWCLWLSWH
SDKTGERCMHVIVPHFIAIVGAILAMSMMNTAARYVSLFLVAQTNAGFLALALINAVSQCGNIAGSFIWAKAWEP
TYKLSFAICATFGMITIVLCLWLRTALKGMNEKMDCRDGNDDEVMNPARKRWRYQI*
Coding >AgabiH97|069200
ATGAGATCTAAAGCGCAAGGTTTCAGTTCCGATAGGTCCAATTATCCTGTAATCATTATCTTCCATTGCCCCAGG
ATAGAAATACAGGAAGGCAATCTTCGGACCTTAGTCAAGTATGTCAACGGAAGAGCGTTCTCTACTTCCACGACC
ACCTCAAACACCTTCACCACAGCAATATGGATCGAATTCCTTGCCCCGGCTTACAATGTTCGAATGTCAATGTTG
TTGCTCATGTATATCGTCAACTATATCGACCGTATTAGTGCAGCTGCAGCTCGATTGCGTGGGTTTGAAGATGAT
CTGAAGCTAAAGGGTGCTAAGTTCGCATCAATCTTGTCGATATTCTATGTGGGCTACATAACACTGCAGGTTCCT
TCAAATATGATTCTTAGTCAGGTCAAGAAGCCATCTCTCTACATACCGTGTTGCATGATGGTTTGGGGAGTGATT
TCATTCATGACGGGATTCGTCACAAACTATTGCAGTGCCCTTGCCGCGCGGTTCCTTCTTGGGTTCTCGGTAGCC
GCCTTTTTTCCTGGAGCCCTTTATCTGATAGCTCGATGGTACAAACGAGATGAACTATCTCTCCGAATCGCTTTC
TTTGCATGTGGAAGCAATTTGAGCAATGCTTTCGGCTCTCTCATTGCATCTGCAGTTTTGGACCTCCTCGATGGT
GCCCTAGGCTACTCAGCATGGCGTTGGCTTTTCTTTGTAGAGGGTGCTTTCACAATCCTCGTCGCGATAATCGCC
ACCTTCATTCTCCCCGATTTTCCCGAATCTGAAAACATATCATGGCTTACATCCTCTGAGCACGCTTTGGCAAAA
GCGAGAATGCGTGAAGACACCGCCACTGAAATCACTCGCCCCGAATCTTTGAACCAATACAATGTCAAGTCAATG
AAGCGATTTTACAATGTAAGCGCCGGCAATCTCGTCCTCGCCATTTCAGACTGGAAGGTCTGGTATATGGCACTT
GCTGAGCTGGTTTCCATTATCTCCTCTTCGCACTATCTCTACTTCCCTACTCTGACAAAAACCATGGGCTACAAC
ACAACAATCTCGCTATTACTCTGTGCTCCTCCCTGGCTTCTTACCGCTGTATGGTGCCTTTGGCTTTCTTGGCAT
TCGGACAAAACTGGAGAACGGTGCATGCATGTTATAGTTCCTCACTTCATCGCTATCGTGGGTGCCATCTTAGCA
ATGTCTATGATGAATACTGCTGCTCGTTATGTATCATTATTCCTTGTCGCTCAAACTAATGCCGGGTTTCTCGCA
CTTGCGCTTATCAATGCCGTATCACAGTGCGGAAATATAGCTGGATCCTTTATATGGGCGAAGGCTTGGGAACCC
ACTTATAAATTGTCGTTTGCTATTTGTGCTACGTTTGGGATGATTACTATAGTGCTGTGTCTTTGGTTACGGACG
GCATTGAAGGGGATGAATGAAAAAATGGACTGTAGGGACGGGAATGACGATGAAGTGATGAATCCGGCAAGGAAG
CGTTGGAGGTATCAAATTTGA
Transcript >AgabiH97|069200
ATGAGATCTAAAGCGCAAGGTTTCAGTTCCGATAGGTCCAATTATCCTGTAATCATTATCTTCCATTGCCCCAGG
ATAGAAATACAGGAAGGCAATCTTCGGACCTTAGTCAAGTATGTCAACGGAAGAGCGTTCTCTACTTCCACGACC
ACCTCAAACACCTTCACCACAGCAATATGGATCGAATTCCTTGCCCCGGCTTACAATGTTCGAATGTCAATGTTG
TTGCTCATGTATATCGTCAACTATATCGACCGTATTAGTGCAGCTGCAGCTCGATTGCGTGGGTTTGAAGATGAT
CTGAAGCTAAAGGGTGCTAAGTTCGCATCAATCTTGTCGATATTCTATGTGGGCTACATAACACTGCAGGTTCCT
TCAAATATGATTCTTAGTCAGGTCAAGAAGCCATCTCTCTACATACCGTGTTGCATGATGGTTTGGGGAGTGATT
TCATTCATGACGGGATTCGTCACAAACTATTGCAGTGCCCTTGCCGCGCGGTTCCTTCTTGGGTTCTCGGTAGCC
GCCTTTTTTCCTGGAGCCCTTTATCTGATAGCTCGATGGTACAAACGAGATGAACTATCTCTCCGAATCGCTTTC
TTTGCATGTGGAAGCAATTTGAGCAATGCTTTCGGCTCTCTCATTGCATCTGCAGTTTTGGACCTCCTCGATGGT
GCCCTAGGCTACTCAGCATGGCGTTGGCTTTTCTTTGTAGAGGGTGCTTTCACAATCCTCGTCGCGATAATCGCC
ACCTTCATTCTCCCCGATTTTCCCGAATCTGAAAACATATCATGGCTTACATCCTCTGAGCACGCTTTGGCAAAA
GCGAGAATGCGTGAAGACACCGCCACTGAAATCACTCGCCCCGAATCTTTGAACCAATACAATGTCAAGTCAATG
AAGCGATTTTACAATGTAAGCGCCGGCAATCTCGTCCTCGCCATTTCAGACTGGAAGGTCTGGTATATGGCACTT
GCTGAGCTGGTTTCCATTATCTCCTCTTCGCACTATCTCTACTTCCCTACTCTGACAAAAACCATGGGCTACAAC
ACAACAATCTCGCTATTACTCTGTGCTCCTCCCTGGCTTCTTACCGCTGTATGGTGCCTTTGGCTTTCTTGGCAT
TCGGACAAAACTGGAGAACGGTGCATGCATGTTATAGTTCCTCACTTCATCGCTATCGTGGGTGCCATCTTAGCA
ATGTCTATGATGAATACTGCTGCTCGTTATGTATCATTATTCCTTGTCGCTCAAACTAATGCCGGGTTTCTCGCA
CTTGCGCTTATCAATGCCGTATCACAGTGCGGAAATATAGCTGGATCCTTTATATGGGCGAAGGCTTGGGAACCC
ACTTATAAATTGTCGTTTGCTATTTGTGCTACGTTTGGGATGATTACTATAGTGCTGTGTCTTTGGTTACGGACG
GCATTGAAGGGGATGAATGAAAAAATGGACTGTAGGGACGGGAATGACGATGAAGTGATGAATCCGGCAAGGAAG
CGTTGGAGGTATCAAATTTGA
Gene >AgabiH97|069200
ATGAGATCTAAAGCGCAAGGTTTCAGTTCCGATAGGTCCAATTATCCTGTAATCAGTGAGCGGTCTCTTTTATTC
TACCTCAGGCTCAAGTTAAAGTTAATCCTACTGAGTTATCTTCCATTGCGTGTCTCGGATACCGGCCCGTTATCA
ATTAAGTAAATGCTAATTGTTCAGAACGCCTAGCCCAGGATAGAAATACAGGAAGGCAATCTTCGGACCTTAGTC
AAGGTGAGCTTCCTCCAACTGTACATATATTGAGATGCCTTGCTTACGCTTTTCACCGGTGTTTGGCTGATTGCT
CGCTGGCCGCCAGTATGTCAACGGAAGAGCGTTCTCTACTTCCACGACCACCTCAAACACCTTGTATTTATTGGT
CCTTCGTTTTCCTTCGCCGAGGCTCATTCACCTTCATAGCACCACAGCAATATGGATCGAATTCCTTGCCCCGGC
TTACAGTATCTAAGAACAGGGAGAAATTGGAGAAACGGCTACTCAGGAAGTTAGATGTTCGAATGTCAATGTTGT
TGCTCATGTATATCGTCAACTGTGAGTTTTTCATACGTTGAGGCATTTCTACTACAAAGCTGAACATTTTAGATA
TCGACCGTATTAGTGCAGCGTATGTACTTCGTTGCATACATAGGAAAATCATTCACTGACATCCGGATTCCTCCA
GTGCAGCTCGATTGCGTGGGTTTGAAGATGATCTGAAGCTAAAGGGTGCTAAGTTCGCATCAATCTTGTCGATAT
TCTATGTGGGCTACATAACACTGCAGGTTCCTTCGTGAGTCCTCAAATCTTGATCTTGTTGTCATCTCGTAAAAT
ATGTTCCTAATGTCAGGCCACCAGAAATATGATTCTTAGTCAGGTCAAGAAGCCATCTCTCTACATACCGTGTTG
CATGATGGTTTGGGGAGTGATTTCATTCATGACGGGTCCGTCGTCTTTCCAGTATATGGCTGTTTCCCCGCGTTG
ACGTCAAACATTTCGATGCTCAGGATTCGTCACAAAGTATGCGACTTCTCTTCTGTGCCTTCCTCTTCCTTATAC
TGTCGTAGCTATTGCAGTGCCCTTGCCGCGCGGTTCCTTCTTGGGTTCTCGGTAGCCGCCTTTTTTCCTGGAGCC
CTTTATCTGATAGCTCGATGGTACAAACGAGATGAACTATCTCTCCGAATCGCTTTCTTTGCATGTGGAAGCAAT
TTGAGCAATGCTTTCGGCTCTCTCATTGCATCTGCAGTTTTGGACCTCCTCGATGGTGCCCTAGGCTACTCAGCA
TGGCGTTGGCTTTTCTTTGTAGAGGGTGCTTTCACAATCCTCGTCGCGATAATCGCCACCTTCATTCTCCCCGAT
TTTCCCGAATCTGAAAACATATCATGGCTTACATCCTCTGAGCACGCTTTGGCAAAAGCGAGAATGCGTGAAGAC
ACCGCCACTGAAATCACTCGCCCCGAATCTTTGAACCAATACAATGTCAAGTCAATGAAGCGATTTTACAATGTA
AGCGCCGGCAATCTCGTCCTCGCCATTTCAGACTGGAAGGTCTGGTATATGGCACTTGCTGAGCTGGTTTCCATT
ATCTCCTCTTCGCACTATCTCTACTTCCCTACTCTGACAAAAACCATGGGCTACAACACAACAATCTCGCTATTA
CTCTGTGCTCCTCCCTGGCTTCTTACCGCTGTATGGTGCCTTTGGCTTTCTTGGCATTCGGACAAAACTGGAGAA
CGGTGCATGCATGTTATAGTTCCTCACTTCATCGCTATCGTGGGTGCCATCTTAGCAATGTCTATGATGAATACT
GCTGCTCGTTATGTATCATTGTAAGTTCCTCCACGTTTCGCCTCCATTAAAATCATAATTGACTTTACAATGTTT
AGATTCCTTGTCGCTCAAACTAATGCCGGGTTTCGTATGTCTCATCGCCTGGTCTTCATCTACGGTTTCCAATCC
TCCCGAAAAACGCGCAGTCGCACTTGCGCTTATCAATGCCGTATCACAGTGCGGAAATATAGCTGGATCCTTTAT
ATGGGCGAAGGCTTGGGAACCCACTTATAAATTGTCGTTTGCTATTTGTGCTACGTTTGGGATGATTACTATAGT
GCTGTGTCTTTGGTTACGGACGGCATTGAAGGGGATGAATGAAAAAATGGACTGTAGGGACGGGAATGACGATGA
AGTGATGAATCCGGCAAGGAAGCGTTGGAGGTATCAAATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail