Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|068590
Gene name
Locationscaffold_4:832272..833469
Strand-
Gene length (bp)1197
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 251 273 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 60.83 35.54 86.13
Initials Initials knots 35.76 19.80 51.72
Pileal_Stipeal_center Stage I stipe center 43.20 24.46 61.93
Pileal_Stipeal_shell Stage I stipe shell 56.02 32.67 79.38
DIF_stipe_center Stage II stipe center 58.35 34.17 82.53
DIF_stipe_shell Stage II stipe shell 31.79 17.44 46.14
DIF_stipe_skin Stage II stipe skin 38.92 21.89 55.95
DIF_cap_skin Stage II cap skin 62.81 36.77 88.85
DIF_cap_tissue Stage II cap tissue 64.06 37.72 90.39
DIF_gill_tissue Stage II gill tissue 71.06 42.17 99.95
YFB_stipe_center Young fruiting body stipe center 41.90 23.74 60.06
YFB_stipe_shell Young fruiting body stipe shell 38.94 21.89 55.99
YFB_stipe_skin Young fruiting body stipe skin 38.26 21.51 55.00
YFB_cap_skin Young fruiting body cap skin 51.49 29.57 73.40
YFB_cap_tissue Young fruiting body cap tissue 44.77 25.42 64.12
YFB_gill_tissue Young fruiting body gill tissue 53.16 30.47 75.85
YFB_veil Young fruiting body veil 51.85 29.72 73.98

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.710153 no
Casing YFB_stipe_center 0.248876 no
Casing YFB_stipe_shell 0.141536 no
Casing YFB_stipe_skin 0.121568 no
Casing YFB_cap_skin 0.696033 no
Casing YFB_cap_tissue 0.360534 no
Casing YFB_gill_tissue 0.768827 no
Casing YFB_veil 0.709803 no
Casing Initials 0.072150 no
Casing Pileal_Stipeal_center 0.301839 no
Casing Pileal_Stipeal_shell 0.869333 no
Casing DIF_stipe_center 0.939951 no
Casing DIF_stipe_shell 0.021322 yes
Casing DIF_stipe_skin 0.134423 no
Casing DIF_cap_skin 0.954432 no
Casing DIF_cap_tissue 0.922664 no
DIF_gill_tissue YFB_stipe_center 0.064705 no
DIF_gill_tissue YFB_stipe_shell 0.029890 yes
DIF_gill_tissue YFB_stipe_skin 0.027943 yes
DIF_gill_tissue YFB_cap_skin 0.334631 no
DIF_gill_tissue YFB_cap_tissue 0.107122 no
DIF_gill_tissue YFB_gill_tissue 0.400686 no
DIF_gill_tissue YFB_veil 0.344139 no
YFB_stipe_center YFB_stipe_shell 0.892203 no
YFB_stipe_center YFB_stipe_skin 0.861463 no
YFB_stipe_center YFB_cap_skin 0.615155 no
YFB_stipe_center YFB_cap_tissue 0.902064 no
YFB_stipe_center YFB_gill_tissue 0.538515 no
YFB_stipe_center YFB_veil 0.596803 no
YFB_stipe_shell YFB_stipe_skin 0.975594 no
YFB_stipe_shell YFB_cap_skin 0.450443 no
YFB_stipe_shell YFB_cap_tissue 0.759230 no
YFB_stipe_shell YFB_gill_tissue 0.376462 no
YFB_stipe_shell YFB_veil 0.428302 no
YFB_stipe_skin YFB_cap_skin 0.404208 no
YFB_stipe_skin YFB_cap_tissue 0.718138 no
YFB_stipe_skin YFB_gill_tissue 0.334715 no
YFB_stipe_skin YFB_veil 0.384267 no
YFB_cap_skin YFB_cap_tissue 0.754130 no
YFB_cap_skin YFB_gill_tissue 0.955853 no
YFB_cap_skin YFB_veil 0.990021 no
YFB_cap_tissue YFB_gill_tissue 0.686450 no
YFB_cap_tissue YFB_veil 0.741922 no
YFB_gill_tissue YFB_veil 0.966897 no
Initials DIF_gill_tissue 0.009773 yes
Initials YFB_stipe_center 0.734118 no
Initials YFB_stipe_shell 0.872342 no
Initials YFB_stipe_skin 0.904552 no
Initials YFB_cap_skin 0.283853 no
Initials YFB_cap_tissue 0.570190 no
Initials YFB_gill_tissue 0.230883 no
Initials YFB_veil 0.271064 no
Initials Pileal_Stipeal_center 0.661997 no
Initials Pileal_Stipeal_shell 0.143064 no
Initials DIF_stipe_center 0.100894 no
Initials DIF_stipe_shell 0.816663 no
Initials DIF_stipe_skin 0.875347 no
Initials DIF_cap_skin 0.047798 yes
Initials DIF_cap_tissue 0.035309 yes
Pileal_Stipeal_center DIF_gill_tissue 0.085561 no
Pileal_Stipeal_center YFB_stipe_center 0.959731 no
Pileal_Stipeal_center YFB_stipe_shell 0.834994 no
Pileal_Stipeal_center YFB_stipe_skin 0.803166 no
Pileal_Stipeal_center YFB_cap_skin 0.687568 no
Pileal_Stipeal_center YFB_cap_tissue 0.949809 no
Pileal_Stipeal_center YFB_gill_tissue 0.611091 no
Pileal_Stipeal_center YFB_veil 0.668252 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.475513 no
Pileal_Stipeal_center DIF_stipe_center 0.385534 no
Pileal_Stipeal_center DIF_stipe_shell 0.390414 no
Pileal_Stipeal_center DIF_stipe_skin 0.834800 no
Pileal_Stipeal_center DIF_cap_skin 0.242017 no
Pileal_Stipeal_center DIF_cap_tissue 0.210433 no
Pileal_Stipeal_shell DIF_gill_tissue 0.503380 no
Pileal_Stipeal_shell YFB_stipe_center 0.402994 no
Pileal_Stipeal_shell YFB_stipe_shell 0.258519 no
Pileal_Stipeal_shell YFB_stipe_skin 0.229251 no
Pileal_Stipeal_shell YFB_cap_skin 0.871498 no
Pileal_Stipeal_shell YFB_cap_tissue 0.544796 no
Pileal_Stipeal_shell YFB_gill_tissue 0.925366 no
Pileal_Stipeal_shell YFB_veil 0.881089 no
Pileal_Stipeal_shell DIF_stipe_center 0.941443 no
Pileal_Stipeal_shell DIF_stipe_shell 0.046327 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.249412 no
Pileal_Stipeal_shell DIF_cap_skin 0.803199 no
Pileal_Stipeal_shell DIF_cap_tissue 0.760227 no
DIF_stipe_center DIF_gill_tissue 0.607437 no
DIF_stipe_center YFB_stipe_center 0.324693 no
DIF_stipe_center YFB_stipe_shell 0.199136 no
DIF_stipe_center YFB_stipe_skin 0.175019 no
DIF_stipe_center YFB_cap_skin 0.789634 no
DIF_stipe_center YFB_cap_tissue 0.449791 no
DIF_stipe_center YFB_gill_tissue 0.855325 no
DIF_stipe_center YFB_veil 0.800214 no
DIF_stipe_center DIF_stipe_shell 0.025711 yes
DIF_stipe_center DIF_stipe_skin 0.189762 no
DIF_stipe_center DIF_cap_skin 0.885247 no
DIF_stipe_center DIF_cap_tissue 0.848833 no
DIF_stipe_shell DIF_gill_tissue 0.001140 yes
DIF_stipe_shell YFB_stipe_center 0.466032 no
DIF_stipe_shell YFB_stipe_shell 0.627919 no
DIF_stipe_shell YFB_stipe_skin 0.669164 no
DIF_stipe_shell YFB_cap_skin 0.113500 no
DIF_stipe_shell YFB_cap_tissue 0.305868 no
DIF_stipe_shell YFB_gill_tissue 0.088779 no
DIF_stipe_shell YFB_veil 0.109462 no
DIF_stipe_shell DIF_stipe_skin 0.624182 no
DIF_stipe_shell DIF_cap_skin 0.012880 yes
DIF_stipe_shell DIF_cap_tissue 0.009123 yes
DIF_stipe_skin DIF_gill_tissue 0.026955 yes
DIF_stipe_skin YFB_stipe_center 0.893686 no
DIF_stipe_skin YFB_stipe_shell 0.998441 no
DIF_stipe_skin YFB_stipe_skin 0.977215 no
DIF_stipe_skin YFB_cap_skin 0.447261 no
DIF_stipe_skin YFB_cap_tissue 0.754805 no
DIF_stipe_skin YFB_gill_tissue 0.373991 no
DIF_stipe_skin YFB_veil 0.424727 no
DIF_stipe_skin DIF_cap_skin 0.104109 no
DIF_stipe_skin DIF_cap_tissue 0.080353 no
DIF_cap_skin DIF_gill_tissue 0.786231 no
DIF_cap_skin YFB_stipe_center 0.191454 no
DIF_cap_skin YFB_stipe_shell 0.105702 no
DIF_cap_skin YFB_stipe_skin 0.092330 no
DIF_cap_skin YFB_cap_skin 0.620893 no
DIF_cap_skin YFB_cap_tissue 0.284846 no
DIF_cap_skin YFB_gill_tissue 0.697471 no
DIF_cap_skin YFB_veil 0.634970 no
DIF_cap_skin DIF_cap_tissue 0.971764 no
DIF_cap_tissue DIF_gill_tissue 0.821089 no
DIF_cap_tissue YFB_stipe_center 0.163299 no
DIF_cap_tissue YFB_stipe_shell 0.087251 no
DIF_cap_tissue YFB_stipe_skin 0.074478 no
DIF_cap_tissue YFB_cap_skin 0.562962 no
DIF_cap_tissue YFB_cap_tissue 0.242440 no
DIF_cap_tissue YFB_gill_tissue 0.642300 no
DIF_cap_tissue YFB_veil 0.578613 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|068590
MRLLPLLALPSLVAAQYFSAGWQPGQPLHETQSSPAPTYTPAPQPAKGLSELFSLNTLLTLPPVAGLFERFGINI
TERVALSRADLWDERIPLITDDNFNELIANEPLTEEEEEKRVWVVVISVTAAKQEGLSKYLDQVFDSAYNETLEK
NDLPNIRWGRIDYLDVTYLTTKWNVWQAPYLAVITNRGKTLRFYRPHQIRLRDYALRDFLLTDGWQITPPWESRY
APGGDREWVLDLIATYLAKAYNYIVLVPRWALYILTGAIGSVILNFLHRPSKKRTPAKPPVKGGSTSAQSTTSTT
EKSDEAAAVSAVQIKPEPTNVPSTPTTPRSTPRRNGKKGKGRQ*
Coding >AgabiH97|068590
ATGCGCCTCCTCCCCCTCCTCGCTCTGCCCTCCCTCGTCGCCGCCCAGTACTTCTCTGCGGGTTGGCAGCCTGGC
CAGCCTCTGCACGAGACCCAGTCCTCCCCGGCACCCACATATACCCCCGCGCCACAACCCGCAAAAGGCTTATCG
GAGCTCTTCAGCCTCAACACCCTTCTCACCTTGCCCCCTGTCGCTGGTTTGTTTGAGCGCTTCGGAATTAACATC
ACCGAACGCGTGGCTCTTTCCAGGGCTGATCTTTGGGACGAGCGAATACCGCTTATCACGGACGACAACTTTAAC
GAACTCATTGCCAATGAACCCCTCACCGAAGAGGAGGAAGAAAAGCGCGTATGGGTTGTAGTCATCTCTGTCACC
GCTGCTAAACAAGAAGGTCTTTCCAAATACCTCGATCAAGTCTTCGACTCCGCCTACAACGAAACTCTCGAAAAG
AACGATCTTCCCAACATTCGCTGGGGTCGCATCGACTATCTCGATGTGACTTATCTAACCACAAAGTGGAACGTT
TGGCAAGCGCCATATCTTGCCGTTATCACCAACCGAGGAAAGACTTTGCGTTTCTATAGACCGCATCAAATACGT
CTCAGGGACTACGCTCTCCGTGACTTTCTCTTGACCGACGGCTGGCAAATCACCCCTCCCTGGGAGTCCCGTTAC
GCACCGGGAGGCGATCGTGAATGGGTTCTAGATTTGATTGCCACCTATCTCGCCAAGGCTTATAACTATATCGTC
CTTGTTCCTCGCTGGGCCTTGTATATTCTCACCGGCGCTATCGGTTCCGTTATTCTCAATTTCCTTCACCGTCCT
TCGAAGAAACGGACTCCAGCCAAACCCCCTGTCAAAGGAGGATCAACGTCTGCACAAAGCACCACATCCACTACC
GAAAAGTCTGATGAAGCCGCTGCTGTATCTGCTGTACAAATAAAGCCAGAGCCTACCAATGTGCCCTCCACTCCC
ACCACTCCACGCTCGACTCCGCGCCGCAACGGCAAGAAAGGTAAAGGCCGACAATAA
Transcript >AgabiH97|068590
ATGCGCCTCCTCCCCCTCCTCGCTCTGCCCTCCCTCGTCGCCGCCCAGTACTTCTCTGCGGGTTGGCAGCCTGGC
CAGCCTCTGCACGAGACCCAGTCCTCCCCGGCACCCACATATACCCCCGCGCCACAACCCGCAAAAGGCTTATCG
GAGCTCTTCAGCCTCAACACCCTTCTCACCTTGCCCCCTGTCGCTGGTTTGTTTGAGCGCTTCGGAATTAACATC
ACCGAACGCGTGGCTCTTTCCAGGGCTGATCTTTGGGACGAGCGAATACCGCTTATCACGGACGACAACTTTAAC
GAACTCATTGCCAATGAACCCCTCACCGAAGAGGAGGAAGAAAAGCGCGTATGGGTTGTAGTCATCTCTGTCACC
GCTGCTAAACAAGAAGGTCTTTCCAAATACCTCGATCAAGTCTTCGACTCCGCCTACAACGAAACTCTCGAAAAG
AACGATCTTCCCAACATTCGCTGGGGTCGCATCGACTATCTCGATGTGACTTATCTAACCACAAAGTGGAACGTT
TGGCAAGCGCCATATCTTGCCGTTATCACCAACCGAGGAAAGACTTTGCGTTTCTATAGACCGCATCAAATACGT
CTCAGGGACTACGCTCTCCGTGACTTTCTCTTGACCGACGGCTGGCAAATCACCCCTCCCTGGGAGTCCCGTTAC
GCACCGGGAGGCGATCGTGAATGGGTTCTAGATTTGATTGCCACCTATCTCGCCAAGGCTTATAACTATATCGTC
CTTGTTCCTCGCTGGGCCTTGTATATTCTCACCGGCGCTATCGGTTCCGTTATTCTCAATTTCCTTCACCGTCCT
TCGAAGAAACGGACTCCAGCCAAACCCCCTGTCAAAGGAGGATCAACGTCTGCACAAAGCACCACATCCACTACC
GAAAAGTCTGATGAAGCCGCTGCTGTATCTGCTGTACAAATAAAGCCAGAGCCTACCAATGTGCCCTCCACTCCC
ACCACTCCACGCTCGACTCCGCGCCGCAACGGCAAGAAAGGTAAAGGCCGACAATAA
Gene >AgabiH97|068590
ATGCGCCTCCTCCCCCTCCTCGCTCTGCCCTCCCTCGTCGCCGCCCAGTACTTCTCTGCGGGTTGGCAGCCTGGC
CAGCCTCTGCACGAGACCCAGTCCTCCCCGGCACCCACATATACCCCCGCGCCACAACCCGCAAAAGGCTTATCG
GAGCTCTTCAGCCTCAACACCCTTCTCACCTTGCCCCCTGTCGCTGGTTTGTTTGAGCGCTTCGGAATTAACATC
ACCGAACGCGTGGCTCTTTCCAGGGCTGATCTTTGGGACGAGCGAATACCGCTTATCACGGACGACAACTTTAAC
GAACTCATTGCCAATGAACCCCTCACCGAAGAGGAGGAAGAAAAGCGCGTATGGGTTGTAGTCATGTATGTCCTT
TGCATTTCTTTCTTTGCACCCGTCTCATTGCTGCCTGCACAGCTCTGTCACCGCTGCTAAACAAGAAGGTCTTTC
CAAATACCTCGATCAAGTCTTCGACTCCGCCTACAACGAAACTCTCGAAAAGAACGATCTTCCCAACATTCGCTG
GGGTCGCATCGACTATCTCGATGTGACTTATCTAACCACAAAGTGGAACGTTTGGCAGTAAGTCTTTGGTTCTCG
TAGAAGAAAAATTGCATTGCCTTATTCGTGTTTTTTTTTTTCAGAGCGCCATATCTTGCCGTTATCACCAACCGA
GGAAAGACTTTGCGTTTCTATAGACCGCATCAAATACGTCTCAGGGACTACGCTCTCCGTGACTTTCTCTTGACC
GACGGCTGGCAAATCACCCCTCCCTGGGAGTCCCGTTACGCACCGGGAGGCGATCGGTTAGCTTTTATTGTTTAT
TTAACCTTTATTCTTCGCTAACACTATATTAGTGAATGGGTTCTAGATTTGATTGCCACCTATCTCGCCAAGGCT
TATAACTATATCGTCCTTGTTCCTCGCTGGGCCTTGTATATTCTCACCGGCGCTATCGGTTCCGTTATTCTCAAT
TTCCTTCACCGTCCTTCGAAGAAACGGACTCCAGCCAAACCCCCTGTCAAAGGAGGATCAACGTCTGCACAAAGC
ACCACATCCACTACCGAAAAGTCTGATGAAGCCGCTGCTGTATCTGCTGTACAAATAAAGCCAGAGCCTACCAAT
GTGCCCTCCACTCCCACCACTCCACGCTCGACTCCGCGCCGCAACGGCAAGAAAGGTAAAGGCCGACAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail