Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|068580
Gene name
Locationscaffold_4:830251..831803
Strand+
Gene length (bp)1552
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 100.28 59.35 141.21
Initials Initials knots 76.22 45.35 107.10
Pileal_Stipeal_center Stage I stipe center 44.00 24.58 63.42
Pileal_Stipeal_shell Stage I stipe shell 30.46 16.84 44.08
DIF_stipe_center Stage II stipe center 34.47 19.44 49.51
DIF_stipe_shell Stage II stipe shell 27.10 14.91 39.30
DIF_stipe_skin Stage II stipe skin 36.03 20.46 51.60
DIF_cap_skin Stage II cap skin 23.60 12.74 34.47
DIF_cap_tissue Stage II cap tissue 23.68 12.80 34.56
DIF_gill_tissue Stage II gill tissue 30.36 16.86 43.85
YFB_stipe_center Young fruiting body stipe center 51.91 29.82 73.99
YFB_stipe_shell Young fruiting body stipe shell 29.86 16.56 43.16
YFB_stipe_skin Young fruiting body stipe skin 27.70 15.25 40.15
YFB_cap_skin Young fruiting body cap skin 20.94 11.10 30.78
YFB_cap_tissue Young fruiting body cap tissue 29.97 16.60 43.34
YFB_gill_tissue Young fruiting body gill tissue 26.42 14.41 38.43
YFB_veil Young fruiting body veil 24.16 13.10 35.21

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.012880 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.411559 no
Casing Pileal_Stipeal_center 0.001140 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.074301 no
DIF_gill_tissue YFB_stipe_shell 0.979274 no
DIF_gill_tissue YFB_stipe_skin 0.865789 no
DIF_gill_tissue YFB_cap_skin 0.305777 no
DIF_gill_tissue YFB_cap_tissue 0.984477 no
DIF_gill_tissue YFB_gill_tissue 0.785375 no
DIF_gill_tissue YFB_veil 0.592871 no
YFB_stipe_center YFB_stipe_shell 0.056760 no
YFB_stipe_center YFB_stipe_skin 0.024698 yes
YFB_stipe_center YFB_cap_skin 0.001625 yes
YFB_stipe_center YFB_cap_tissue 0.058926 no
YFB_stipe_center YFB_gill_tissue 0.018896 yes
YFB_stipe_center YFB_veil 0.006742 yes
YFB_stipe_shell YFB_stipe_skin 0.893812 no
YFB_stipe_shell YFB_cap_skin 0.333349 no
YFB_stipe_shell YFB_cap_tissue 0.994482 no
YFB_stipe_shell YFB_gill_tissue 0.814836 no
YFB_stipe_shell YFB_veil 0.623983 no
YFB_stipe_skin YFB_cap_skin 0.479928 no
YFB_stipe_skin YFB_cap_tissue 0.889878 no
YFB_stipe_skin YFB_gill_tissue 0.938119 no
YFB_stipe_skin YFB_veil 0.785355 no
YFB_cap_skin YFB_cap_tissue 0.321351 no
YFB_cap_skin YFB_gill_tissue 0.594495 no
YFB_cap_skin YFB_veil 0.783355 no
YFB_cap_tissue YFB_gill_tissue 0.806904 no
YFB_cap_tissue YFB_veil 0.617037 no
YFB_gill_tissue YFB_veil 0.874937 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.213293 no
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.050085 no
Initials Pileal_Stipeal_shell 0.001625 yes
Initials DIF_stipe_center 0.004160 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.003365 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.276421 no
Pileal_Stipeal_center YFB_stipe_center 0.701385 no
Pileal_Stipeal_center YFB_stipe_shell 0.241581 no
Pileal_Stipeal_center YFB_stipe_skin 0.141124 no
Pileal_Stipeal_center YFB_cap_skin 0.011968 yes
Pileal_Stipeal_center YFB_cap_tissue 0.246090 no
Pileal_Stipeal_center YFB_gill_tissue 0.101862 no
Pileal_Stipeal_center YFB_veil 0.044844 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.274557 no
Pileal_Stipeal_center DIF_stipe_center 0.526654 no
Pileal_Stipeal_center DIF_stipe_shell 0.112874 no
Pileal_Stipeal_center DIF_stipe_skin 0.625107 no
Pileal_Stipeal_center DIF_cap_skin 0.029890 yes
Pileal_Stipeal_center DIF_cap_tissue 0.033444 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.994795 no
Pileal_Stipeal_shell YFB_stipe_center 0.081406 no
Pileal_Stipeal_shell YFB_stipe_shell 0.972996 no
Pileal_Stipeal_shell YFB_stipe_skin 0.858892 no
Pileal_Stipeal_shell YFB_cap_skin 0.302028 no
Pileal_Stipeal_shell YFB_cap_tissue 0.979377 no
Pileal_Stipeal_shell YFB_gill_tissue 0.774803 no
Pileal_Stipeal_shell YFB_veil 0.585032 no
Pileal_Stipeal_shell DIF_stipe_center 0.803166 no
Pileal_Stipeal_shell DIF_stipe_shell 0.819569 no
Pileal_Stipeal_shell DIF_stipe_skin 0.708904 no
Pileal_Stipeal_shell DIF_cap_skin 0.530712 no
Pileal_Stipeal_shell DIF_cap_tissue 0.538230 no
DIF_stipe_center DIF_gill_tissue 0.794518 no
DIF_stipe_center YFB_stipe_center 0.196877 no
DIF_stipe_center YFB_stipe_shell 0.764358 no
DIF_stipe_center YFB_stipe_skin 0.597205 no
DIF_stipe_center YFB_cap_skin 0.121717 no
DIF_stipe_center YFB_cap_tissue 0.771512 no
DIF_stipe_center YFB_gill_tissue 0.502142 no
DIF_stipe_center YFB_veil 0.315869 no
DIF_stipe_center DIF_stipe_shell 0.546417 no
DIF_stipe_center DIF_stipe_skin 0.939747 no
DIF_stipe_center DIF_cap_skin 0.267461 no
DIF_stipe_center DIF_cap_tissue 0.274557 no
DIF_stipe_shell DIF_gill_tissue 0.827262 no
DIF_stipe_shell YFB_stipe_center 0.020523 yes
DIF_stipe_shell YFB_stipe_shell 0.859404 no
DIF_stipe_shell YFB_stipe_skin 0.971082 no
DIF_stipe_shell YFB_cap_skin 0.531427 no
DIF_stipe_shell YFB_cap_tissue 0.852762 no
DIF_stipe_shell YFB_gill_tissue 0.966738 no
DIF_stipe_shell YFB_veil 0.828473 no
DIF_stipe_shell DIF_stipe_skin 0.444068 no
DIF_stipe_shell DIF_cap_skin 0.781427 no
DIF_stipe_shell DIF_cap_tissue 0.785227 no
DIF_stipe_skin DIF_gill_tissue 0.704487 no
DIF_stipe_skin YFB_stipe_center 0.265846 no
DIF_stipe_skin YFB_stipe_shell 0.663899 no
DIF_stipe_skin YFB_stipe_skin 0.497996 no
DIF_stipe_skin YFB_cap_skin 0.086914 no
DIF_stipe_skin YFB_cap_tissue 0.675621 no
DIF_stipe_skin YFB_gill_tissue 0.407913 no
DIF_stipe_skin YFB_veil 0.239759 no
DIF_stipe_skin DIF_cap_skin 0.195445 no
DIF_stipe_skin DIF_cap_tissue 0.203637 no
DIF_cap_skin DIF_gill_tissue 0.532315 no
DIF_cap_skin YFB_stipe_center 0.004548 yes
DIF_cap_skin YFB_stipe_shell 0.567388 no
DIF_cap_skin YFB_stipe_skin 0.734612 no
DIF_cap_skin YFB_cap_skin 0.822795 no
DIF_cap_skin YFB_cap_tissue 0.560937 no
DIF_cap_skin YFB_gill_tissue 0.836455 no
DIF_cap_skin YFB_veil 0.970380 no
DIF_cap_skin DIF_cap_tissue 0.995138 no
DIF_cap_tissue DIF_gill_tissue 0.543305 no
DIF_cap_tissue YFB_stipe_center 0.003765 yes
DIF_cap_tissue YFB_stipe_shell 0.576926 no
DIF_cap_tissue YFB_stipe_skin 0.740785 no
DIF_cap_tissue YFB_cap_skin 0.815693 no
DIF_cap_tissue YFB_cap_tissue 0.571786 no
DIF_cap_tissue YFB_gill_tissue 0.842165 no
DIF_cap_tissue YFB_veil 0.974447 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|068580
MHYLFLTTLASLLLGTSSALHIDNAGGFLARGDDNTAVLKPFRSNPLKNAKGDAVSKREPVVIKGLLQVRQSCPP
GFGDCNNGRCCPVGGDCCTGGCCNAGEFCYATGCCELSETGCEQVTCCPTGTHCCKGGGCCETGDYCVSGGCCPI
GKICVGGGGGGEITTRERSTTTHTTETTSTRTTSTSTTDFITSSFSSSALSPTGTRSPRPTAAAGQVSVTYGVHD
SRITWSSGWTDNASGCTTSSRRTTVAEESFTVIVGSASRIYLNVDVVSVVYDVYVNGLLTAPDSDTFLETTSCTY
SQLSLIATTNINVTVVVVGVGARNGKRQISDDWSFQLNEIIAIGSEEDSDLNSGSNSDSGPSSGSGSVSEAATSF
RVTWFQTIAAVLLVAFGCFW*
Coding >AgabiH97|068580
ATGCACTACTTGTTCCTCACTACGTTGGCCTCCCTTCTCCTTGGAACTTCTTCGGCTTTGCACATTGACAACGCG
GGAGGCTTTCTTGCTCGAGGCGACGATAATACAGCTGTACTTAAGCCTTTCCGAAGCAACCCGTTGAAGAACGCG
AAAGGAGATGCCGTTTCAAAACGCGAGCCCGTAGTGATCAAAGGTCTTCTTCAAGTCAGGCAGTCATGCCCGCCC
GGGTTTGGCGATTGCAACAACGGCAGGTGCTGTCCTGTAGGTGGCGATTGTTGCACAGGTGGTTGTTGTAATGCC
GGGGAATTCTGCTATGCTACAGGTTGTTGTGAACTAAGTGAAACAGGATGCGAGCAAGTCACTTGCTGCCCTACT
GGTACTCATTGTTGCAAAGGGGGAGGATGCTGTGAAACTGGTGACTATTGTGTCAGTGGGGGATGCTGCCCCATT
GGCAAAATTTGTGTCGGTGGTGGAGGCGGTGGAGAAATAACTACCCGTGAAAGGTCTACGACCACCCACACCACT
GAAACTACCAGTACTCGTACTACGTCAACTTCTACCACAGATTTTATCACTTCTAGCTTCAGCAGCTCTGCTTTG
TCTCCAACTGGCACTCGGTCTCCACGCCCGACAGCTGCTGCCGGCCAAGTTTCTGTTACATACGGTGTCCACGAT
AGCAGGATTACTTGGTCTTCTGGGTGGACCGATAATGCATCAGGGTGTACAACCAGTTCTAGACGTACAACCGTC
GCCGAGGAATCATTTACCGTCATAGTTGGATCTGCTTCTCGTATCTATCTGAACGTTGATGTCGTTTCGGTCGTG
TACGACGTTTATGTGAACGGCCTTCTCACAGCACCCGATTCTGACACCTTTTTGGAGACGACGTCCTGCACTTAC
TCCCAATTATCATTGATCGCAACCACCAATATTAATGTCACCGTTGTTGTTGTTGGCGTTGGCGCTAGAAATGGT
AAAAGGCAGATTTCAGATGACTGGTCTTTCCAATTGAATGAAATTATTGCCATTGGTTCGGAAGAAGATTCTGAT
TTGAATTCTGGTTCAAACTCTGATTCTGGGCCGTCATCTGGGTCTGGGTCGGTGTCAGAGGCTGCCACCAGTTTT
AGGGTTACATGGTTCCAGACTATCGCCGCTGTACTCCTAGTTGCATTTGGTTGCTTCTGGTGA
Transcript >AgabiH97|068580
ATGCACTACTTGTTCCTCACTACGTTGGCCTCCCTTCTCCTTGGAACTTCTTCGGCTTTGCACATTGACAACGCG
GGAGGCTTTCTTGCTCGAGGCGACGATAATACAGCTGTACTTAAGCCTTTCCGAAGCAACCCGTTGAAGAACGCG
AAAGGAGATGCCGTTTCAAAACGCGAGCCCGTAGTGATCAAAGGTCTTCTTCAAGTCAGGCAGTCATGCCCGCCC
GGGTTTGGCGATTGCAACAACGGCAGGTGCTGTCCTGTAGGTGGCGATTGTTGCACAGGTGGTTGTTGTAATGCC
GGGGAATTCTGCTATGCTACAGGTTGTTGTGAACTAAGTGAAACAGGATGCGAGCAAGTCACTTGCTGCCCTACT
GGTACTCATTGTTGCAAAGGGGGAGGATGCTGTGAAACTGGTGACTATTGTGTCAGTGGGGGATGCTGCCCCATT
GGCAAAATTTGTGTCGGTGGTGGAGGCGGTGGAGAAATAACTACCCGTGAAAGGTCTACGACCACCCACACCACT
GAAACTACCAGTACTCGTACTACGTCAACTTCTACCACAGATTTTATCACTTCTAGCTTCAGCAGCTCTGCTTTG
TCTCCAACTGGCACTCGGTCTCCACGCCCGACAGCTGCTGCCGGCCAAGTTTCTGTTACATACGGTGTCCACGAT
AGCAGGATTACTTGGTCTTCTGGGTGGACCGATAATGCATCAGGGTGTACAACCAGTTCTAGACGTACAACCGTC
GCCGAGGAATCATTTACCGTCATAGTTGGATCTGCTTCTCGTATCTATCTGAACGTTGATGTCGTTTCGGTCGTG
TACGACGTTTATGTGAACGGCCTTCTCACAGCACCCGATTCTGACACCTTTTTGGAGACGACGTCCTGCACTTAC
TCCCAATTATCATTGATCGCAACCACCAATATTAATGTCACCGTTGTTGTTGTTGGCGTTGGCGCTAGAAATGGT
AAAAGGCAGATTTCAGATGACTGGTCTTTCCAATTGAATGAAATTATTGCCATTGGTTCGGAAGAAGATTCTGAT
TTGAATTCTGGTTCAAACTCTGATTCTGGGCCGTCATCTGGGTCTGGGTCGGTGTCAGAGGCTGCCACCAGTTTT
AGGGTTACATGGTTCCAGACTATCGCCGCTGTACTCCTAGTTGCATTTGGTTGCTTCTGGTGA
Gene >AgabiH97|068580
ATGCACTACTTGTTCCTCACTACGTTGGCCTCCCTTCTCCTTGGAACTTCTTCGGCTTTGCACATTGACAACGCG
GGAGGCTTTCTTGCTCGAGGCGACGATAATACAGCTGTACTTAAGCCTTTCCGAAGCAACCCGTTGAAGAACGCG
AAAGGAGATGCCGTTTCAAAACGCGAGCCCGTAGTGATCAAAGGTCTTCTTCAAGTCAGGCAGTCATGCCCGCCC
GGGTTTGGCGATTGCAACAACGGCAGGTGCTGTCCTGTAGGTGGCGATTGTTGCACAGGTTCGGATATTTTCATT
TTGAGCTAGAAATCCAATCTGAAAAAAAATACTAATACTTTTAACAGGTGGTTGTTGTAATGCCGGGGAATTCTG
CTATGCTACAGGTTTGATATATACATTCAGTAACTTTTGAAGTTTGTTGACAAGTATCTACAGGTTGTTGTGAAC
TAAGTGAAACAGGATGCGAGCAAGTCACTTGCTGCCCTACTGGTACTCATTGTTGCAAAGGTGGGTTCATTCATA
TAATCCTCCTTCATTTTATTGAAAATTTGACGCGTGTTCGGATCATGTCAGGGGGAGGATGCTGTGAAACTGGTG
ACTATTGTGTCAGTGGGGGATGCTGCCCCATTGGCAAAATTTGTGTCGGTGGTGGAGGCGGTGGAGAAATAACTA
CCCGTGAAAGGTCTACGACCACCCACACCACTGAAACTACCAGTACTCGTACTACGTCAACTTCTACCACAGATT
TTATCACTTCTAGCTTCAGTAAGCATTATCAAGAGTTCTATTACGGTGTTGTTTGGTTGACTGGCATTTTAGGCA
GCTCTGCTTTGTCTCCAACTGGCACTCGGTCTCCACGCCCGACAGCTGCTGCCGGCCAAGTTTCTGTTACATACG
GTGTCCACGATAGCAGGATTACTTGGTCTTCTGGGTGGACCGATAATGCATCAGGGTGTACAACCAGTTCTAGAC
GTACAACCGTCGCCGAGGAATCATTTACCGTCATAGTTGGATCTGGTTAGTCCTTTTTTACCAGTATATTTGATT
ATGGGCCTTGAACGTTGACATCCTATTCACTTTCAGCTTCTCGTATCTATCTGAACGTTGATGTCGTTTCGGTCG
TGTACGACGTTTATGTGAACGGCCTTCTCACAGCACCCGATTCTGACACCTTTTTGGAGACGACGTCCTGCACTT
ACTCCCAATTATCATTGATCGCAACCACCAATATTAATGTCACCGTTGTTGTTGTTGGCGTTGGCGCTAGAAATG
GTAAAAGGCAGATTTCAGATGACTGGTCTTTCCAATTGAATGAAATTATGTGAGTGGAAGAGAATCCTGCGAAAA
AAAATTTATTGAGCGTTTGACTCATTATCTTTTCAGTGCCATTGGTTCGGAAGAAGATTCTGATTTGAATTCTGG
TTCAAACTCTGATTCTGGGCCGTCATCTGGGTCTGGGTCGGTGTCAGAGGCTGCCACCAGTTTTAGGGTTACATG
GTTCCAGACTATCGCCGCTGTACTCCTAGTTGCATTTGGTTGCTTCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail