Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|068490
Gene name
Locationscaffold_4:804378..807996
Strand+
Gene length (bp)3618
Transcript length (bp)3339
Coding sequence length (bp)3339
Protein length (aa) 1113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 7.8E-29 253 700

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94543|YCD3_SCHPO Uncharacterized membrane protein C1322.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1322.03 PE=3 SV=1 493 844 3.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 191 213 22
2 377 399 22
3 494 516 22
4 528 550 22
5 580 602 22
6 609 631 22
7 635 657 22
8 670 692 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|068490
MRSRPGGLPPSLLSLLLALLPFAHAGPATLPFKDCFDDTTSQAQKLNVSTIYAQVLQNNDLGEYLDLTVLGQSPQ
QIFGMTNTSGSLSTLFTTTSVLTLNAWTNSSYLCDTLRPPSPLPQVNQQTNNYCPLAAGPFALSANIPWGSNRAL
TTLVTRLRAVDPFGHELVCIDVSTTPLRPSTKDGPYGDARVILWASVALAAAYWLVVGVARVVSAWGRGVSRSAH
GVWGKLQSGGFILASAISGERLATSPALMRYCTPSLRDVIFHTQWCATLAMIAVQWPPFIYPLLTQTAWSTLTFN
VTLISSSTPHRWDPLSTLLFSPPDDFSEQLADSSSPLFIDTAAPNFLFTLPQNASNGIQSFAYAVGIRPEELFPN
CLILFLGIVAATIVLSTLLWALDYFMVAVVFKYTSRTGYSTNLSRSRSPAFNASISTRSALNKDAFESTTSPMSG
DESKSLTGHSTGGNSIFGVGTRAVGSHRSWWRLRTDIGSFHGSVLHGNLVRILVLFHLPITTFSAFQMVQHGSGV
SRTSVALAALSFAVFSVLIPLHLVLKVTFTTTNKLYDETRTLLSLGPLYNHYRHGSQMFATLLFATNLVFGVTIG
AGQKSGMAQAIIILVVEVMSALGTSIWLPWGSGASMGLISFLFCVARIVIAVLLVILTPTISIGPGPGGWVAYGI
LIILALVYLALLVMLFFKLVEAVFRIAGGLGFDRSRHVSDSGLLGVLGLLGWCGFRSHSKRRRKKSRKAPRHKSS
QGLPEMSPYATPDPLLPSVPPFLHSDSRKASTHSGPPPSVLRPEHALPKPYREDDDDEGYIMGAWQPYSQKAGYS
PVAEPAPTSPPQPKSGFSRIGGGRSHIDTPYAIMDGSGSAFAARNGSIQAIASSSMHALGNGSTHTFPSVKQQTQ
DGSFYRGYGGTAASGSVTALYEDDDPQPSLSSLTNVGRQAEYGQLPPGAMQPAHVRTKSQTAIIEDASKVYGLAA
TLTVNPSGSSNSNPEGGVGAVRPPRFSVSVDDDDDDDSSSIEEQPKKKPWYRIGRRRPDGSDGPSSSSSTAAPAV
DSELGGMSMSGADGSSNDASGSLSAQPTRSFVVIRRTQPQSMNQLNQSRNASRLQNTTYPPS*
Coding >AgabiH97|068490
ATGCGCTCGCGTCCAGGCGGTCTGCCGCCGTCGTTGCTGTCCCTTCTCCTCGCCCTTCTCCCTTTCGCCCATGCG
GGTCCTGCCACACTTCCATTCAAGGACTGCTTTGATGATACAACGTCGCAAGCACAGAAGCTGAATGTGTCGACC
ATATATGCTCAAGTTTTGCAAAATAATGACTTGGGGGAGTATCTTGACCTAACAGTGCTAGGTCAAAGCCCACAG
CAGATATTTGGCATGACAAACACTAGCGGCAGCCTCTCCACGCTCTTTACGACAACGTCTGTCCTCACGTTGAAC
GCGTGGACGAACAGCTCATATCTTTGTGATACTCTCCGACCGCCTTCTCCGCTTCCGCAAGTCAATCAACAGACC
AATAACTACTGTCCTCTCGCTGCCGGTCCTTTCGCTCTTTCGGCTAATATTCCATGGGGATCTAATCGTGCGTTG
ACGACACTGGTTACAAGACTCCGCGCAGTGGATCCTTTTGGTCACGAGCTCGTTTGCATCGATGTATCCACAACC
CCACTTCGGCCATCAACGAAAGACGGACCTTATGGTGATGCTCGGGTCATTTTGTGGGCTAGCGTGGCATTGGCT
GCAGCTTATTGGCTTGTTGTGGGTGTGGCTAGAGTTGTGTCTGCTTGGGGACGAGGCGTGAGTCGCAGTGCACAT
GGTGTTTGGGGGAAGCTGCAAAGCGGTGGATTCATTTTGGCCAGTGCTATTAGTGGGGAGAGGTTGGCTACATCT
CCCGCATTGATGCGATACTGCACGCCGTCGCTGAGAGATGTCATATTTCATACGCAATGGTGTGCGACACTTGCT
ATGATTGCTGTTCAGTGGCCTCCGTTCATTTACCCTCTTCTGACCCAAACTGCTTGGTCCACGCTTACTTTTAAT
GTCACTCTCATCTCATCTTCAACACCTCACCGCTGGGACCCGCTCTCGACACTACTATTTTCGCCACCTGACGAT
TTTTCTGAACAACTTGCGGACTCTTCATCACCCCTTTTCATAGATACGGCAGCTCCTAATTTTCTCTTCACCCTC
CCACAAAATGCGTCTAATGGCATTCAATCGTTCGCTTACGCAGTTGGAATACGACCCGAAGAATTGTTCCCTAAT
TGCCTTATACTTTTCCTTGGCATCGTTGCAGCTACCATAGTACTGTCTACTCTTCTGTGGGCTCTTGACTATTTT
ATGGTCGCAGTCGTGTTCAAGTACACCTCCCGTACAGGTTACAGCACCAATCTTTCAAGATCACGTAGCCCTGCC
TTCAATGCAAGTATCTCCACGAGAAGTGCTTTGAACAAGGATGCGTTCGAGTCAACGACCTCACCTATGTCAGGA
GATGAAAGTAAAAGCCTGACAGGGCATAGCACGGGTGGAAATAGCATTTTTGGTGTTGGAACTCGTGCGGTTGGA
TCACACAGATCGTGGTGGCGCTTACGGACAGACATTGGGTCGTTCCATGGAAGTGTTCTTCATGGAAACTTGGTC
CGTATTCTCGTGCTATTCCACCTCCCTATCACTACCTTTTCGGCCTTCCAAATGGTGCAGCACGGTTCAGGCGTC
AGTCGCACAAGTGTTGCTTTGGCTGCTTTGTCGTTTGCCGTATTTTCCGTCCTCATTCCCCTTCATCTAGTTTTG
AAAGTTACGTTTACGACAACCAACAAACTATATGATGAAACACGGACCTTGTTATCTCTTGGGCCTTTGTATAAC
CATTACAGGCATGGTTCGCAGATGTTTGCGACACTGCTCTTTGCGACGAACCTTGTGTTTGGAGTCACAATTGGC
GCTGGGCAGAAGAGTGGGATGGCTCAAGCTATCATCATTCTTGTTGTGGAGGTGATGTCGGCTTTGGGAACCAGT
ATTTGGCTGCCTTGGGGCAGTGGTGCGAGTATGGGTCTTATTAGTTTCTTGTTTTGCGTTGCTAGGATCGTTATT
GCGGTTCTTTTGGTCATCCTGACACCGACGATATCCATCGGTCCTGGGCCTGGTGGCTGGGTTGCTTATGGCATA
CTCATCATTCTTGCACTCGTTTATCTCGCTCTTCTTGTTATGCTTTTCTTCAAGTTGGTTGAAGCTGTTTTCCGT
ATTGCTGGTGGTTTGGGCTTTGATCGTAGTCGTCATGTATCCGATTCTGGACTTCTCGGGGTACTCGGCCTTTTG
GGCTGGTGCGGATTCCGATCCCACTCAAAGAGACGAAGAAAGAAGTCGAGGAAAGCGCCACGCCATAAATCATCT
CAGGGGCTACCCGAAATGAGCCCATACGCCACACCAGATCCACTTTTGCCTTCCGTTCCTCCGTTTTTACACTCT
GATAGCAGGAAGGCTTCGACACATTCGGGACCGCCACCTAGCGTGTTGCGCCCTGAACATGCCCTGCCAAAGCCA
TATCGAGAGGATGATGATGATGAGGGGTACATAATGGGTGCCTGGCAGCCTTATTCACAGAAAGCTGGTTATTCT
CCAGTTGCGGAGCCTGCTCCTACGTCGCCTCCTCAACCGAAGAGCGGTTTTTCGAGAATAGGAGGTGGACGATCA
CATATCGACACTCCGTATGCTATCATGGATGGGTCTGGAAGTGCTTTTGCTGCAAGGAATGGATCTATTCAAGCC
ATTGCTAGTTCGTCTATGCATGCACTCGGAAATGGTTCAACCCATACCTTCCCTTCGGTCAAGCAGCAGACTCAG
GATGGGTCATTTTATCGGGGATATGGTGGTACTGCTGCCAGCGGGAGTGTGACTGCGCTTTATGAGGATGACGAT
CCACAACCTTCGTTATCATCTCTGACGAATGTGGGAAGGCAAGCAGAGTATGGGCAATTGCCACCTGGAGCAATG
CAACCTGCTCACGTGCGTACGAAGTCGCAGACCGCCATAATTGAAGACGCGAGTAAAGTATACGGCCTCGCCGCT
ACTCTGACGGTTAACCCCAGCGGGTCTTCTAATAGTAATCCTGAAGGCGGCGTAGGCGCTGTCCGGCCACCGCGG
TTTTCTGTTAGTGTGGACGATGACGACGACGACGATAGTAGTAGTATTGAAGAACAACCGAAGAAGAAGCCGTGG
TACCGTATTGGCCGACGGCGGCCCGATGGTAGTGATGGTCCTTCGTCTTCATCGTCGACTGCAGCGCCCGCTGTG
GACTCCGAATTGGGTGGCATGTCTATGTCAGGTGCGGATGGATCTAGTAATGATGCCAGTGGCAGTCTCTCTGCA
CAGCCAACGAGGTCGTTTGTTGTCATTCGAAGGACACAACCGCAGAGCATGAACCAGCTGAACCAGAGTCGCAAT
GCGAGCCGGCTTCAGAATACAACTTACCCTCCATCATAG
Transcript >AgabiH97|068490
ATGCGCTCGCGTCCAGGCGGTCTGCCGCCGTCGTTGCTGTCCCTTCTCCTCGCCCTTCTCCCTTTCGCCCATGCG
GGTCCTGCCACACTTCCATTCAAGGACTGCTTTGATGATACAACGTCGCAAGCACAGAAGCTGAATGTGTCGACC
ATATATGCTCAAGTTTTGCAAAATAATGACTTGGGGGAGTATCTTGACCTAACAGTGCTAGGTCAAAGCCCACAG
CAGATATTTGGCATGACAAACACTAGCGGCAGCCTCTCCACGCTCTTTACGACAACGTCTGTCCTCACGTTGAAC
GCGTGGACGAACAGCTCATATCTTTGTGATACTCTCCGACCGCCTTCTCCGCTTCCGCAAGTCAATCAACAGACC
AATAACTACTGTCCTCTCGCTGCCGGTCCTTTCGCTCTTTCGGCTAATATTCCATGGGGATCTAATCGTGCGTTG
ACGACACTGGTTACAAGACTCCGCGCAGTGGATCCTTTTGGTCACGAGCTCGTTTGCATCGATGTATCCACAACC
CCACTTCGGCCATCAACGAAAGACGGACCTTATGGTGATGCTCGGGTCATTTTGTGGGCTAGCGTGGCATTGGCT
GCAGCTTATTGGCTTGTTGTGGGTGTGGCTAGAGTTGTGTCTGCTTGGGGACGAGGCGTGAGTCGCAGTGCACAT
GGTGTTTGGGGGAAGCTGCAAAGCGGTGGATTCATTTTGGCCAGTGCTATTAGTGGGGAGAGGTTGGCTACATCT
CCCGCATTGATGCGATACTGCACGCCGTCGCTGAGAGATGTCATATTTCATACGCAATGGTGTGCGACACTTGCT
ATGATTGCTGTTCAGTGGCCTCCGTTCATTTACCCTCTTCTGACCCAAACTGCTTGGTCCACGCTTACTTTTAAT
GTCACTCTCATCTCATCTTCAACACCTCACCGCTGGGACCCGCTCTCGACACTACTATTTTCGCCACCTGACGAT
TTTTCTGAACAACTTGCGGACTCTTCATCACCCCTTTTCATAGATACGGCAGCTCCTAATTTTCTCTTCACCCTC
CCACAAAATGCGTCTAATGGCATTCAATCGTTCGCTTACGCAGTTGGAATACGACCCGAAGAATTGTTCCCTAAT
TGCCTTATACTTTTCCTTGGCATCGTTGCAGCTACCATAGTACTGTCTACTCTTCTGTGGGCTCTTGACTATTTT
ATGGTCGCAGTCGTGTTCAAGTACACCTCCCGTACAGGTTACAGCACCAATCTTTCAAGATCACGTAGCCCTGCC
TTCAATGCAAGTATCTCCACGAGAAGTGCTTTGAACAAGGATGCGTTCGAGTCAACGACCTCACCTATGTCAGGA
GATGAAAGTAAAAGCCTGACAGGGCATAGCACGGGTGGAAATAGCATTTTTGGTGTTGGAACTCGTGCGGTTGGA
TCACACAGATCGTGGTGGCGCTTACGGACAGACATTGGGTCGTTCCATGGAAGTGTTCTTCATGGAAACTTGGTC
CGTATTCTCGTGCTATTCCACCTCCCTATCACTACCTTTTCGGCCTTCCAAATGGTGCAGCACGGTTCAGGCGTC
AGTCGCACAAGTGTTGCTTTGGCTGCTTTGTCGTTTGCCGTATTTTCCGTCCTCATTCCCCTTCATCTAGTTTTG
AAAGTTACGTTTACGACAACCAACAAACTATATGATGAAACACGGACCTTGTTATCTCTTGGGCCTTTGTATAAC
CATTACAGGCATGGTTCGCAGATGTTTGCGACACTGCTCTTTGCGACGAACCTTGTGTTTGGAGTCACAATTGGC
GCTGGGCAGAAGAGTGGGATGGCTCAAGCTATCATCATTCTTGTTGTGGAGGTGATGTCGGCTTTGGGAACCAGT
ATTTGGCTGCCTTGGGGCAGTGGTGCGAGTATGGGTCTTATTAGTTTCTTGTTTTGCGTTGCTAGGATCGTTATT
GCGGTTCTTTTGGTCATCCTGACACCGACGATATCCATCGGTCCTGGGCCTGGTGGCTGGGTTGCTTATGGCATA
CTCATCATTCTTGCACTCGTTTATCTCGCTCTTCTTGTTATGCTTTTCTTCAAGTTGGTTGAAGCTGTTTTCCGT
ATTGCTGGTGGTTTGGGCTTTGATCGTAGTCGTCATGTATCCGATTCTGGACTTCTCGGGGTACTCGGCCTTTTG
GGCTGGTGCGGATTCCGATCCCACTCAAAGAGACGAAGAAAGAAGTCGAGGAAAGCGCCACGCCATAAATCATCT
CAGGGGCTACCCGAAATGAGCCCATACGCCACACCAGATCCACTTTTGCCTTCCGTTCCTCCGTTTTTACACTCT
GATAGCAGGAAGGCTTCGACACATTCGGGACCGCCACCTAGCGTGTTGCGCCCTGAACATGCCCTGCCAAAGCCA
TATCGAGAGGATGATGATGATGAGGGGTACATAATGGGTGCCTGGCAGCCTTATTCACAGAAAGCTGGTTATTCT
CCAGTTGCGGAGCCTGCTCCTACGTCGCCTCCTCAACCGAAGAGCGGTTTTTCGAGAATAGGAGGTGGACGATCA
CATATCGACACTCCGTATGCTATCATGGATGGGTCTGGAAGTGCTTTTGCTGCAAGGAATGGATCTATTCAAGCC
ATTGCTAGTTCGTCTATGCATGCACTCGGAAATGGTTCAACCCATACCTTCCCTTCGGTCAAGCAGCAGACTCAG
GATGGGTCATTTTATCGGGGATATGGTGGTACTGCTGCCAGCGGGAGTGTGACTGCGCTTTATGAGGATGACGAT
CCACAACCTTCGTTATCATCTCTGACGAATGTGGGAAGGCAAGCAGAGTATGGGCAATTGCCACCTGGAGCAATG
CAACCTGCTCACGTGCGTACGAAGTCGCAGACCGCCATAATTGAAGACGCGAGTAAAGTATACGGCCTCGCCGCT
ACTCTGACGGTTAACCCCAGCGGGTCTTCTAATAGTAATCCTGAAGGCGGCGTAGGCGCTGTCCGGCCACCGCGG
TTTTCTGTTAGTGTGGACGATGACGACGACGACGATAGTAGTAGTATTGAAGAACAACCGAAGAAGAAGCCGTGG
TACCGTATTGGCCGACGGCGGCCCGATGGTAGTGATGGTCCTTCGTCTTCATCGTCGACTGCAGCGCCCGCTGTG
GACTCCGAATTGGGTGGCATGTCTATGTCAGGTGCGGATGGATCTAGTAATGATGCCAGTGGCAGTCTCTCTGCA
CAGCCAACGAGGTCGTTTGTTGTCATTCGAAGGACACAACCGCAGAGCATGAACCAGCTGAACCAGAGTCGCAAT
GCGAGCCGGCTTCAGAATACAACTTACCCTCCATCATAG
Gene >AgabiH97|068490
ATGCGCTCGCGTCCAGGCGGTCTGCCGCCGTCGTTGCTGTCCCTTCTCCTCGCCCTTCTCCCTTTCGCCCATGCG
GGTCCTGCCACACTTCCATTCAAGGACTGCTTTGATGATACAACGTCGCAAGCACAGAAGCTGAATGTGTCGACC
ATATATGCTCAAGTTTTGCAAAATAATGACTTGGGGGAGTATCTTGACCTAACAGTGCTAGGTCAAAGCCCACAG
CAGATATTTGGCATGACAAACACTAGCGGCAGCCTCTGTCAGTTTATCTTCTCTGCTGCTGGCTAGGTCAGCGAG
CTAACACTTTCTTCCTATAGCCACGCTCTTTACGACAACGTCTGTCCTCACGTTGAACGCGTGGACGAACAGCTC
ATATCTTTGTGATACTCTCCGACCGCCTTCTCCGCTTCCGCAAGTCAATCAACAGACCAATAACTACTGTCCTCT
CGCTGCCGGTCCTTTCGCTCTTTCGGCTAATATTCCATGGGGATCTAATCGTGCGTTGACGACACTGGTTACAAG
ACTCCGCGCAGTGGATCCTTTTGGTCACGAGCTCGTTTGCATCGATGTATCCACAACCCCACTTCGGCCATCAAC
GAAAGACGGACCTTATGGTGATGCTCGGGTCATTTTGTGGGCTAGCGTGGCATTGGCTGCAGCTTATTGGCTTGT
TGTGGGTGTGGCTAGAGTTGTGTCTGCTTGGGGACGAGGCGTGAGTCGCAGTGCACATGGTGTTTGGGGGAAGCT
GCAAAGCGGTGGATTCATTTTGGCCAGTGCTATTAGTGGGGAGAGGTTGGCTACATCTCCCGCATTGATGCGATA
CTGTGGGTCCCTTCGCCCTTTTCCTGTTGGTACAGTTCGTCTGATATTCGCCTCGACGTATAGGCACGCCGTCGC
TGAGAGATGTCATATTTCATACGCAATGGTGTGCGACACTTGCTATGATTGCTGTTCAGTGGCCTCCGTTCATTT
GTAAGTTTCAGGGGCGTCTAACTGCTTCTTTGATTGATCCGTTCATAGACCCTCTTCTGACCCAAACTGCTTGGT
CCACGCTTACTTTTAGTGCGTATATGTGCTGCTCCTGTGATGTTTTCATGGTAATAACATTGACCCTAGATGTCA
CTCTCATCTCATCTTCAACACCTCACCGCTGGGACCCGCTCTCGACACTACTATTTTCGCCACCTGACGATTTTT
CTGAACAACTTGCGGACTCTTCATCACCCCTTTTCATAGATACGGCAGCTCCTAATTTTCTCTTCACCCTCCCAC
AAAATGCGTCTAATGGCATTCAATCGTTCGCTTACGCAGTTGGAATACGACCCGAAGAATTGTTCCCTAATTGCC
TTATACTTTTCCTTGGCATCGTTGCAGCTACCATAGTACTGTCTACTCTTCTGTGGGCTCTTGACTATTTTATGG
TCGCAGTCGTGTTCAAGTACACCTCCCGTACAGGTTACAGCACCAATCTTTCAAGATCACGTAGCCCTGCCTTCA
ATGCAAGTATCTCCACGAGAAGTGCTTTGAACAAGGATGCGTTCGAGTCAACGACCTCACCTATGTCAGGAGATG
AAAGTAAAAGCCTGACAGGGCATAGCACGGGTGGAAATAGCATTTTTGGTGTTGGAACTCGTGCGGTTGGATCAC
ACAGATCGTGGTGGCGCTTACGGACAGACATTGGGTCGTTCCATGGAAGTGTTCTTCATGGAAACTTGGTCCGTA
TTCTCGTGCTATTCCACCTCCCTATCACTACCTTTTCGGCCTTCCAAATGGTGCAGCACGGTTCAGGCGTCAGTC
GCACAAGTGTTGCTTTGGCTGCTTTGTCGTTTGCCGTATTTTCCGTCCTCATTCCCCTTCATCTAGTTTTGAAAG
TTACGTTTACGACAACCAACAAACTATATGATGAAACACGGACCTTGTTATCTCTTGGGCCTTTGTATAACCATT
ACAGGCATGGTTCGCAGATGTTTGCGACACTGCTCTTTGCGACGAACCTTGTGTTTGGAGTCACAATTGGCGCTG
GGCAGAAGAGTGGGATGGCTCAAGCTATCATCATTCTTGTTGTGGAGGTGATGTCGGCTTTGGGAACCAGTATTT
GGCTGCCTTGGGGCAGTGGTGCGAGTATGGGTCTTATTAGTTTCTTGTTTTGCGTTGCTAGGATCGTTATTGCGG
TTCTTTTGGTCATCCTGACACCGACGGTTCGTGCTTCCTTTTCAACCATCTAATTCTATGCTTACCCCAATATCT
CTGACCCAGATATCCATCGGTCCTGGGCCTGGTGGCTGGGTTGCTTATGGCATACTCATCATTCTTGCACTCGTT
TATCTCGCTCTTCTTGTTATGCTTTTCTTCAAGTTGGTTGAAGCTGTTTTCCGTATTGCTGGTGGTTTGGGCTTT
GATCGTAGTCGTCATGTATCCGATTCTGGACTTCTCGGGGTACTCGGCCTTTTGGGCTGGTGCGGATTCCGATCC
CACTCAAAGAGACGAAGAAAGAAGTCGAGGAAAGCGCCACGCCATAAATCATCTCAGGGGCTACCCGAAATGAGC
CCATACGCCACACCAGATCCACTTTTGCCTTCCGTTCCTCCGTTTTTACACTCTGATAGCAGGAAGGCTTCGACA
CATTCGGGACCGCCACCTAGCGTGTTGCGCCCTGAACATGCCCTGCCAAAGCCATATCGAGAGGATGATGATGAT
GAGGGGTACATAATGGGTGCCTGGCAGCCTTATTCACAGAAAGCTGGTTATTCTCCAGTTGCGGAGCCTGCTCCT
ACGTCGCCTCCTCAACCGAAGAGCGGTTTTTCGAGAATAGGAGGTGGACGATCACATATCGACACTCCGTATGCT
ATCATGGATGGGTCTGGAAGTGCTTTTGCTGCAAGGAATGGATCTATTCAAGCCATTGCTAGTTCGTCTATGCAT
GCACTCGGAAATGGTTCAACCCATACCTTCCCTTCGGTCAAGCAGCAGACTCAGGATGGGTCATTTTATCGGGGA
TATGGTGGTACTGCTGCCAGCGGGAGTGTGACTGCGCTTTATGAGGATGACGATCCACAACCTTCGTTATCATCT
CTGACGAATGTGGGAAGGCAAGCAGAGTATGGGCAATTGCCACCTGGAGCAATGCAACCTGCTCACGTGCGTACG
AAGTCGCAGACCGCCATAATTGAAGACGCGAGTAAAGTATACGGCCTCGCCGCTACTCTGACGGTTAACCCCAGC
GGGTCTTCTAATAGTAATCCTGAAGGCGGCGTAGGCGCTGTCCGGCCACCGCGGTTTTCTGTTAGTGTGGACGAT
GACGACGACGACGATAGTAGTAGTATTGAAGAACAACCGAAGAAGAAGCCGTGGTACCGTATTGGCCGACGGCGG
CCCGATGGTAGTGATGGTCCTTCGTCTTCATCGTCGACTGCAGCGCCCGCTGTGGACTCCGAATTGGGTGGCATG
TCTATGTCAGGTGCGGATGGATCTAGTAATGATGCCAGTGGCAGTCTCTCTGCACAGCCAACGAGGTCGTTTGTT
GTCATTCGAAGGACACAACCGCAGAGCATGAACCAGCTGAACCAGAGTCGCAATGCGAGCCGGCTTCAGAATACA
ACTTACCCTCCATCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail