Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|068440
Gene name
Locationscaffold_4:797876..798653
Strand+
Gene length (bp)777
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|068440
MRFSISSLIVVGAYLLNTVSANVEQVESIATSQHATAAELGSLALAFVPTTRVYAALLVVIVAAMDDAAVQAVGA
TLLQFVVVMTPTDARTRDAVPRVPTVAPTGIAAHWAGTATGVQATEVPFAAARMDRRVLESNIPSSSIRMLHVSF
LNVTEFSSVNSFPAIW*
Coding >AgabiH97|068440
ATGCGCTTCTCTATTTCTTCTCTCATCGTCGTCGGTGCTTACTTGCTCAACACGGTCTCCGCCAATGTTGAGCAG
GTTGAGTCCATTGCCACCTCTCAACATGCCACGGCGGCTGAACTTGGAAGCCTGGCTTTGGCCTTTGTCCCAACG
ACGCGGGTGTATGCTGCCCTCTTGGTGGTGATTGTTGCGGCAATGGACGATGCTGCGGTGCAGGCAGTTGGTGCT
ACACTCCTTCAATTTGTTGTGGTAATGACGCCAACGGATGCGCGAACCAGGGATGCTGTCCCAAGGGTTCCAACT
GTTGCGCCGACGGGAATTGCTGCTCATTGGGCTGGTACTGCTACAGGAGTCCAAGCAACGGAGGTGCCATTCGCT
GCTGCCCGAATGGACAGACGTGTGCTTGAGAGCAATATACCCAGTTCTAGTATCAGAATGCTTCACGTATCTTTT
TTGAATGTCACCGAGTTTTCGAGCGTTAATTCTTTTCCTGCCATATGGTAA
Transcript >AgabiH97|068440
ATGCGCTTCTCTATTTCTTCTCTCATCGTCGTCGGTGCTTACTTGCTCAACACGGTCTCCGCCAATGTTGAGCAG
GTTGAGTCCATTGCCACCTCTCAACATGCCACGGCGGCTGAACTTGGAAGCCTGGCTTTGGCCTTTGTCCCAACG
ACGCGGGTGTATGCTGCCCTCTTGGTGGTGATTGTTGCGGCAATGGACGATGCTGCGGTGCAGGCAGTTGGTGCT
ACACTCCTTCAATTTGTTGTGGTAATGACGCCAACGGATGCGCGAACCAGGGATGCTGTCCCAAGGGTTCCAACT
GTTGCGCCGACGGGAATTGCTGCTCATTGGGCTGGTACTGCTACAGGAGTCCAAGCAACGGAGGTGCCATTCGCT
GCTGCCCGAATGGACAGACGTGTGCTTGAGAGCAATATACCCAGTTCTAGTATCAGAATGCTTCACGTATCTTTT
TTGAATGTCACCGAGTTTTCGAGCGTTAATTCTTTTCCTGCCATATGGTAA
Gene >AgabiH97|068440
ATGCGCTTCTCTATTTCTTCTCTCATCGTCGTCGGTGCTTACTTGCTCAACACGGTCTCCGCCAATGTTGAGCAG
GTTGAGTCCATTGCCACCTCTCAACATGCCACGGCGGCTGAACTTGGAAGCCGTGAATTGGCAGGGTTGTTGAGC
AAACGGACGACCTGTGATAGTGGCTTTGGCCTTTGTCCCAACGACGCGGGTGTATGCTGCCCTCTTGGTGGTGAT
TGTTGCGGCAATGGTTGGTGTTTTACCCTTAATTCTCTTTATGTACAGAACTTGAACTTTCTTTAACTTTCAGGA
CGATGCTGCGGTGCAGGCAGTTGGTGCTACACTCCTTCAAGTATGGCTGTAATACTGCTTGTCCGACTGCAACGT
TTGATTTACCCGTTGTGTTTCTTTTTTTAGTTTGTTGTGGTAATGACGCCAACGGATGCGCGAACCAGGGATGCT
GTCCCAAGGGTTCCAACTGTTGCGCCGGTAAGCTTGTCTCGCTGTCATATGAAGCATATCTGACTTTATTCTGGG
TCACGCAGACGGGAATTGCTGCTCATTGGGGTAAGTTTTTGACGAGTAGAAACCTCGAGCTTTCGACTGATTGTT
TCTTCAGCTGGTACTGCTACAGGAGTCCAAGCAACGGAGGTGCCATTCGCTGCTGCCCGAATGGACAGACGTGTG
CTTGAGAGCAATATACCCAGTTCTAGTATCAGAATGCTTCACGTATCTTTTTTGAATGTCACCGAGTTTTCGAGC
GTTAATTCTTTTCCTGCCATATGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail