Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|068080
Gene name
Locationscaffold_4:702871..704330
Strand-
Gene length (bp)1459
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 2.4E-10 63 232
PF08241 Methyltransf_11 Methyltransferase domain 4.4E-08 84 179
PF13649 Methyltransf_25 Methyltransferase domain 1.3E-06 83 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBS1|NDUF5_PONAB NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Pongo abelii GN=NDUFAF5 PE=2 SV=1 2 322 1.0E-97
sp|A2APY7|NDUF5_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Mus musculus GN=Ndufaf5 PE=1 SV=1 20 322 4.0E-97
sp|A3KP37|NDUF5_DANRE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Danio rerio GN=ndufaf5 PE=2 SV=1 27 322 5.0E-97
sp|Q5TEU4|NDUF5_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Homo sapiens GN=NDUFAF5 PE=1 SV=1 2 322 9.0E-97
sp|B2GV71|NDUF5_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Rattus norvegicus GN=Ndufaf5 PE=2 SV=1 4 322 7.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBS1|NDUF5_PONAB NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Pongo abelii GN=NDUFAF5 PE=2 SV=1 2 322 1.0E-97
sp|A2APY7|NDUF5_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Mus musculus GN=Ndufaf5 PE=1 SV=1 20 322 4.0E-97
sp|A3KP37|NDUF5_DANRE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Danio rerio GN=ndufaf5 PE=2 SV=1 27 322 5.0E-97
sp|Q5TEU4|NDUF5_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Homo sapiens GN=NDUFAF5 PE=1 SV=1 2 322 9.0E-97
sp|B2GV71|NDUF5_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Rattus norvegicus GN=Ndufaf5 PE=2 SV=1 4 322 7.0E-96
sp|Q54JW0|NDUF5_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Dictyostelium discoideum GN=ndufaf5 PE=3 SV=1 36 325 4.0E-79
sp|O80543|Y1280_ARATH Putative methyltransferase At1g22800 OS=Arabidopsis thaliana GN=At1g22800 PE=2 SV=2 10 322 4.0E-70
sp|E4QJB8|BIOC_METS6 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Methylovorus sp. (strain MP688) GN=bioC PE=3 SV=1 47 305 4.0E-23
sp|A1WVM4|BIOC_HALHL Malonyl-[acyl-carrier protein] O-methyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=bioC PE=3 SV=1 32 322 7.0E-23
sp|C1D5S5|BIOC_LARHH Malonyl-[acyl-carrier protein] O-methyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=bioC PE=3 SV=1 64 316 3.0E-22
sp|B2IAI0|BIOC_XYLF2 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=bioC PE=3 SV=1 47 310 4.0E-21
sp|Q2Y9Y6|BIOC_NITMU Malonyl-[acyl-carrier protein] O-methyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=bioC PE=3 SV=1 64 307 5.0E-21
sp|D9SJ16|BIOC_GALCS Malonyl-[acyl-carrier protein] O-methyltransferase OS=Gallionella capsiferriformans (strain ES-2) GN=bioC PE=3 SV=1 36 307 1.0E-20
sp|Q9ZD84|Y459_RICPR Putative methyltransferase RP459 OS=Rickettsia prowazekii (strain Madrid E) GN=RP459 PE=3 SV=1 83 309 1.0E-19
sp|Q83E64|BIOC1_COXBU Malonyl-[acyl-carrier protein] O-methyltransferase 1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bioC1 PE=3 SV=1 48 299 4.0E-18
sp|Q749W5|BIOC_GEOSL Malonyl-[acyl-carrier protein] O-methyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioC PE=3 SV=1 65 304 4.0E-12
sp|Q21FY5|BIOHC_SACD2 Biotin biosynthesis bifunctional protein BioHC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=bioC PE=3 SV=1 47 297 6.0E-11
sp|Q609U9|BIOC_METCA Malonyl-[acyl-carrier protein] O-methyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=bioC PE=3 SV=1 83 298 3.0E-10
sp|Q5ZT34|BIOC_LEGPH Malonyl-[acyl-carrier protein] O-methyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=bioC PE=3 SV=2 61 306 1.0E-09
sp|C6CWS7|BIOC_PAESJ Malonyl-[acyl-carrier protein] O-methyltransferase OS=Paenibacillus sp. (strain JDR-2) GN=bioC PE=3 SV=1 64 299 4.0E-09
sp|Q9K623|BIOC_BACHD Malonyl-[acyl-carrier protein] O-methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bioC PE=3 SV=1 58 301 5.0E-09
sp|A3DBD7|BIOC_CLOTH Malonyl-[acyl-carrier protein] O-methyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bioC PE=3 SV=1 83 313 1.0E-08
sp|A6UYW3|BIOC_PSEA7 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=bioC PE=3 SV=1 84 301 1.0E-07
sp|A7GSD9|BIOC_BACCN Malonyl-[acyl-carrier protein] O-methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=bioC PE=3 SV=1 83 299 9.0E-07
sp|E3HCT1|BIOC2_ILYPC Malonyl-[acyl-carrier protein] O-methyltransferase 2 OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1) GN=bioC2 PE=3 SV=1 147 301 3.0E-06
sp|P36571|BIOC_SERMA Malonyl-[acyl-carrier protein] O-methyltransferase OS=Serratia marcescens GN=bioC PE=1 SV=1 71 304 4.0E-06
sp|Q6FDV0|BIOC_ACIAD Malonyl-[acyl-carrier protein] O-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=bioC PE=3 SV=1 60 302 5.0E-06
sp|C5BMZ8|BIOHC_TERTT Biotin biosynthesis bifunctional protein BioHC OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=bioC PE=3 SV=1 81 305 6.0E-06
sp|E3H9W1|BIOC1_ILYPC Malonyl-[acyl-carrier protein] O-methyltransferase 1 OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1) GN=bioC1 PE=3 SV=1 61 301 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|068080
MALSRLARAQLPTRRFASHSTGSSPPNFNTVGPYQVFDRNVKCMQKNRAALRKDSRMLDYVRDEVADRMMERFLD
IKRNFNSIVDLGSGPGHFTKLLEVDKVKKSIMIDSSAASLNRDLEEEFDVEVERIEADEENLLSVVSPNSQEAVV
SCLSLHWMNDLPGALVQIKEALQPDGLFLGAMFGGDTLFELRTALQLAEIEREGGISPHVSPMTETGDISNLLGR
AGFNLLTVDTDDVKVGYPSMWELVEDLRNMGEGNAVIGRRPYLHRDTIAAASAIYKELHGNEEGAIPATFQIIYM
IGWKPAPSQPKPLDRGTGKVNLKTVL*
Coding >AgabiH97|068080
ATGGCTCTTTCTCGATTAGCACGCGCACAGCTCCCGACGCGTCGCTTTGCGTCCCACTCGACTGGCTCGTCTCCG
CCGAACTTCAATACCGTTGGACCCTACCAGGTTTTTGACAGAAATGTAAAATGCATGCAAAAAAATAGAGCGGCT
CTCAGGAAGGATAGTCGTATGCTGGACTATGTTCGTGACGAAGTTGCAGACCGTATGATGGAAAGGTTCCTGGAT
ATCAAACGCAACTTCAATTCCATCGTCGATCTCGGTTCAGGTCCAGGTCATTTTACCAAGCTGCTTGAGGTCGAC
AAAGTAAAAAAGTCTATTATGATTGACAGCAGTGCTGCAAGTCTCAATCGTGATCTGGAAGAAGAATTTGATGTG
GAGGTTGAGCGAATAGAAGCAGACGAAGAGAATCTCCTTTCAGTCGTCTCTCCAAATTCGCAAGAAGCGGTGGTC
TCTTGTCTTAGTCTACACTGGATGAATGACCTACCAGGTGCTCTCGTGCAGATCAAGGAAGCGCTACAACCAGAT
GGTCTATTTCTCGGCGCCATGTTCGGGGGAGATACGCTATTTGAGCTCAGGACCGCACTCCAACTGGCTGAAATC
GAACGAGAGGGAGGTATCTCACCACATGTGTCTCCAATGACTGAAACTGGCGATATCTCTAACTTGCTTGGCCGA
GCCGGTTTCAATCTACTTACAGTCGACACTGACGACGTAAAGGTTGGCTATCCTAGCATGTGGGAACTAGTAGAA
GATCTCAGGAACATGGGCGAAGGAAACGCTGTCATTGGACGACGTCCTTACCTTCATCGAGACACTATCGCGGCA
GCCTCCGCGATCTACAAAGAGTTACATGGCAACGAAGAAGGGGCGATTCCTGCCACATTTCAAATTATCTATATG
ATCGGGTGGAAGCCGGCACCCTCACAACCTAAGCCCCTGGATCGTGGAACGGGAAAAGTCAACTTGAAAACTGTC
TTATAA
Transcript >AgabiH97|068080
ATGGCTCTTTCTCGATTAGCACGCGCACAGCTCCCGACGCGTCGCTTTGCGTCCCACTCGACTGGCTCGTCTCCG
CCGAACTTCAATACCGTTGGACCCTACCAGGTTTTTGACAGAAATGTAAAATGCATGCAAAAAAATAGAGCGGCT
CTCAGGAAGGATAGTCGTATGCTGGACTATGTTCGTGACGAAGTTGCAGACCGTATGATGGAAAGGTTCCTGGAT
ATCAAACGCAACTTCAATTCCATCGTCGATCTCGGTTCAGGTCCAGGTCATTTTACCAAGCTGCTTGAGGTCGAC
AAAGTAAAAAAGTCTATTATGATTGACAGCAGTGCTGCAAGTCTCAATCGTGATCTGGAAGAAGAATTTGATGTG
GAGGTTGAGCGAATAGAAGCAGACGAAGAGAATCTCCTTTCAGTCGTCTCTCCAAATTCGCAAGAAGCGGTGGTC
TCTTGTCTTAGTCTACACTGGATGAATGACCTACCAGGTGCTCTCGTGCAGATCAAGGAAGCGCTACAACCAGAT
GGTCTATTTCTCGGCGCCATGTTCGGGGGAGATACGCTATTTGAGCTCAGGACCGCACTCCAACTGGCTGAAATC
GAACGAGAGGGAGGTATCTCACCACATGTGTCTCCAATGACTGAAACTGGCGATATCTCTAACTTGCTTGGCCGA
GCCGGTTTCAATCTACTTACAGTCGACACTGACGACGTAAAGGTTGGCTATCCTAGCATGTGGGAACTAGTAGAA
GATCTCAGGAACATGGGCGAAGGAAACGCTGTCATTGGACGACGTCCTTACCTTCATCGAGACACTATCGCGGCA
GCCTCCGCGATCTACAAAGAGTTACATGGCAACGAAGAAGGGGCGATTCCTGCCACATTTCAAATTATCTATATG
ATCGGGTGGAAGCCGGCACCCTCACAACCTAAGCCCCTGGATCGTGGAACGGGAAAAGTCAACTTGAAAACTGTC
TTATAA
Gene >AgabiH97|068080
ATGGCTCTTTCTCGATTAGCACGCGCACAGCTCCCGACGCGTCGCTTTGCGTCCCACTCGACTGGCTCGTCTCCG
CCGAACTTCAATACCGTTGGACCCTACCAGGTTTTTGACAGAAATGTAAAATGCATGCAAAAAAATAGAGCGGCT
CTCAGGAAGGATAGTCGTATGCTGGACTATGTTCGTGACGAAGTTGCAGACCGTATGATGGAAAGGTTCCTGGTA
CACCCTTCTCTCTGCGGTCTAGGTATGCTCAGCGAACGTATCCGGTTATGTAGGATATCAAACGCAACTTCAATT
CCATCGTCGATCTCGGTTCAGGTCCAGGTCATTTTACCAAGCTGCTTGAGGTCGACAAAGTAAAAAAGTCTATTA
TGATTGACAGCAGTGGTGTGTCACACTGACTCCCCATTTGTCGAACCTCTACTCATTCCTCCCATCAGCTGCAAG
TCTCAATCGTGATCTGGAAGAAGAATTTGATGGTCTGTTGTAAGCTTAACAAGTTGTGGCACGGTACTTACATCT
GGCATACTACAGTGGAGGTTGAGCGAATAGAAGCAGACGAAGAGAATCTCCTTTCAGTCGTCTCTCCAAATTCGC
AAGAAGCGGTGGTCTCTTGTCTTAGTCTACACTGGATGAATGACCTACCAGGTGCGATTATTTCCGCTTCGACCA
ACCCAATACCAAACCCAATAGGTGCTCTCGTGCAGATCAAGGAAGCGCTACAACCAGATGGTCTATTTCTCGGCG
CCATGTTCGGGGGAGATACGCTATTTGAGCTCAGGTAAATGATGTCATGTCCCCTACTAACATCGCAATACTCAC
GTATTCAAGGACCGCACTCCAACTGGCTGAAATCGAACGAGAGGGAGGTATCTCACCACATGTGTCTCCAATGAC
TGGTATGTTCTTTTTCTTCTCCGTATCGTGTGTACAGTAGCTCACGCGTATACAAAGAAACTGGCGATATCTCTA
ACTTGCTTGGCCGAGCCGGTTTCAATCTACTTACAGTCGACACTGACGACGTAAAGGTTGGCTATCCTAGCATGT
GGGAACTAGTAGAAGATCTCAGGAACATGGGCGAAGGAAACGCTGTCATTGGACGGTTTGCAGATTTACATCCCA
TTAGATTGCCACCCTGATATAAGCTTCTAGACGTCCTTACCTTCATCGAGACACTATCGCGGCAGCCTCCGCGAT
CTACAAAGGTATATCTCCACGGATCCACCGCATGGCTATCGGTTGTGGCTAATATATCATCTAGAGTTACATGGC
AACGAAGAAGGGGCGATTCCTGCCACATTTCAAATTATCTATATGGTACACTTATATGATTTTGTCTTGTCATCG
TTTTTCTGATATCCGTATTTTTCCACAGATCGGGTGGAAGCCGGCACCCTCACAACCTAAGCCCCTGGATCGTGG
AACGGGAAAAGTCAACTTGAAAACTGTCTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail