Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|067980
Gene name
Locationscaffold_4:672410..675653
Strand-
Gene length (bp)3243
Transcript length (bp)2886
Coding sequence length (bp)2886
Protein length (aa) 962

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07819 PGAP1 PGAP1-like protein 1.4E-55 76 291
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 6.1E-07 80 199
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 6.7E-06 81 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 4 889 7.0E-69
sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 3 889 4.0E-67
sp|Q0UQV6|BST1_PHANO GPI inositol-deacylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=BST1 PE=3 SV=2 11 889 3.0E-66
sp|Q1DWP9|BST1_COCIM GPI inositol-deacylase OS=Coccidioides immitis (strain RS) GN=BST1 PE=3 SV=1 6 889 4.0E-64
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 5 901 9.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 4 889 7.0E-69
sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 3 889 4.0E-67
sp|Q0UQV6|BST1_PHANO GPI inositol-deacylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=BST1 PE=3 SV=2 11 889 3.0E-66
sp|Q1DWP9|BST1_COCIM GPI inositol-deacylase OS=Coccidioides immitis (strain RS) GN=BST1 PE=3 SV=1 6 889 4.0E-64
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 5 901 9.0E-61
sp|P0CM50|BST1_CRYNJ GPI inositol-deacylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BST1 PE=3 SV=1 11 334 1.0E-60
sp|P0CM51|BST1_CRYNB GPI inositol-deacylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BST1 PE=3 SV=1 11 334 2.0E-60
sp|Q5AYC8|BST1_EMENI GPI inositol-deacylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bst1 PE=3 SV=2 5 889 4.0E-56
sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 5 889 3.0E-55
sp|Q2USI0|BST1_ASPOR GPI inositol-deacylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bst1 PE=3 SV=2 5 321 2.0E-52
sp|Q6BRG1|BST1_DEBHA GPI inositol-deacylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BST1 PE=3 SV=2 8 601 3.0E-51
sp|Q6FLY9|BST1_CANGA GPI inositol-deacylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BST1 PE=3 SV=1 32 805 1.0E-47
sp|Q6CIN9|BST1_KLULA GPI inositol-deacylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BST1 PE=3 SV=1 35 949 2.0E-47
sp|Q752Q2|BST1_ASHGO GPI inositol-deacylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BST1 PE=3 SV=2 4 343 4.0E-47
sp|P43571|BST1_YEAST GPI inositol-deacylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BST1 PE=1 SV=1 31 315 5.0E-46
sp|Q9UT41|BST1_SCHPO GPI inositol-deacylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bst1 PE=3 SV=1 33 744 9.0E-42
sp|Q6CF60|BST1C_YARLI Putative GPI inositol-deacylase C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1C PE=3 SV=1 55 324 5.0E-41
sp|Q4P782|BST1_USTMA GPI inositol-deacylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BST1 PE=3 SV=1 33 290 6.0E-37
sp|Q59VP0|BST1_CANAL GPI inositol-deacylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BST1 PE=3 SV=1 7 314 3.0E-33
sp|Q6C2Z2|BST1A_YARLI GPI inositol-deacylase A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1A PE=3 SV=1 123 773 5.0E-32
sp|Q6BZU7|BST1B_YARLI GPI inositol-deacylase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1B PE=3 SV=1 33 299 4.0E-31
sp|Q3UUQ7|PGAP1_MOUSE GPI inositol-deacylase OS=Mus musculus GN=Pgap1 PE=1 SV=3 6 325 4.0E-31
sp|Q765A7|PGAP1_RAT GPI inositol-deacylase OS=Rattus norvegicus GN=Pgap1 PE=1 SV=1 6 292 1.0E-30
sp|Q75T13|PGAP1_HUMAN GPI inositol-deacylase OS=Homo sapiens GN=PGAP1 PE=1 SV=1 6 292 3.0E-30
sp|Q66J01|PGAP1_XENLA GPI inositol-deacylase OS=Xenopus laevis GN=pgap1 PE=2 SV=1 35 306 8.0E-29
sp|Q9W495|PGAP1_DROME GPI inositol-deacylase OS=Drosophila melanogaster GN=CG3160 PE=1 SV=3 78 215 2.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 3 22 19
2 628 650 22
3 670 692 22
4 707 729 22
5 750 772 22
6 841 863 22
7 876 893 17
8 908 927 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 25.39 15.10 35.68
Initials Initials knots 21.10 12.49 29.72
Pileal_Stipeal_center Stage I stipe center 27.72 16.61 38.83
Pileal_Stipeal_shell Stage I stipe shell 23.64 14.05 33.22
DIF_stipe_center Stage II stipe center 27.78 16.64 38.93
DIF_stipe_shell Stage II stipe shell 26.77 15.99 37.55
DIF_stipe_skin Stage II stipe skin 25.00 14.93 35.06
DIF_cap_skin Stage II cap skin 23.17 13.79 32.55
DIF_cap_tissue Stage II cap tissue 25.54 15.26 35.82
DIF_gill_tissue Stage II gill tissue 25.35 15.14 35.57
YFB_stipe_center Young fruiting body stipe center 22.08 13.02 31.14
YFB_stipe_shell Young fruiting body stipe shell 24.25 14.45 34.05
YFB_stipe_skin Young fruiting body stipe skin 25.78 15.41 36.16
YFB_cap_skin Young fruiting body cap skin 24.91 14.86 34.96
YFB_cap_tissue Young fruiting body cap tissue 32.40 19.49 45.31
YFB_gill_tissue Young fruiting body gill tissue 24.14 14.31 33.96
YFB_veil Young fruiting body veil 22.03 13.09 30.97

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.997529 no
Casing YFB_stipe_center 0.741922 no
Casing YFB_stipe_shell 0.931940 no
Casing YFB_stipe_skin 0.977303 no
Casing YFB_cap_skin 0.972803 no
Casing YFB_cap_tissue 0.481158 no
Casing YFB_gill_tissue 0.922644 no
Casing YFB_veil 0.739283 no
Casing Initials 0.632966 no
Casing Pileal_Stipeal_center 0.851857 no
Casing Pileal_Stipeal_shell 0.890122 no
Casing DIF_stipe_center 0.845852 no
Casing DIF_stipe_shell 0.920036 no
Casing DIF_stipe_skin 0.977185 no
Casing DIF_cap_skin 0.850408 no
Casing DIF_cap_tissue 0.991102 no
DIF_gill_tissue YFB_stipe_center 0.746452 no
DIF_gill_tissue YFB_stipe_shell 0.933885 no
DIF_gill_tissue YFB_stipe_skin 0.975904 no
DIF_gill_tissue YFB_cap_skin 0.975656 no
DIF_gill_tissue YFB_cap_tissue 0.476518 no
DIF_gill_tissue YFB_gill_tissue 0.924832 no
DIF_gill_tissue YFB_veil 0.743273 no
YFB_stipe_center YFB_stipe_shell 0.843047 no
YFB_stipe_center YFB_stipe_skin 0.706365 no
YFB_stipe_center YFB_cap_skin 0.788616 no
YFB_stipe_center YFB_cap_tissue 0.189390 no
YFB_stipe_center YFB_gill_tissue 0.853643 no
YFB_stipe_center YFB_veil 0.996634 no
YFB_stipe_shell YFB_stipe_skin 0.906807 no
YFB_stipe_shell YFB_cap_skin 0.961833 no
YFB_stipe_shell YFB_cap_tissue 0.376394 no
YFB_stipe_shell YFB_gill_tissue 0.992780 no
YFB_stipe_shell YFB_veil 0.841706 no
YFB_stipe_skin YFB_cap_skin 0.950785 no
YFB_stipe_skin YFB_cap_tissue 0.516602 no
YFB_stipe_skin YFB_gill_tissue 0.896195 no
YFB_stipe_skin YFB_veil 0.700835 no
YFB_cap_skin YFB_cap_tissue 0.433140 no
YFB_cap_skin YFB_gill_tissue 0.954167 no
YFB_cap_skin YFB_veil 0.782301 no
YFB_cap_tissue YFB_gill_tissue 0.362965 no
YFB_cap_tissue YFB_veil 0.181080 no
YFB_gill_tissue YFB_veil 0.846380 no
Initials DIF_gill_tissue 0.636230 no
Initials YFB_stipe_center 0.932841 no
Initials YFB_stipe_shell 0.744023 no
Initials YFB_stipe_skin 0.590773 no
Initials YFB_cap_skin 0.677830 no
Initials YFB_cap_tissue 0.128805 no
Initials YFB_gill_tissue 0.753716 no
Initials YFB_veil 0.936813 no
Initials Pileal_Stipeal_center 0.406997 no
Initials Pileal_Stipeal_shell 0.806264 no
Initials DIF_stipe_center 0.397831 no
Initials DIF_stipe_shell 0.500971 no
Initials DIF_stipe_skin 0.673977 no
Initials DIF_cap_skin 0.845884 no
Initials DIF_cap_tissue 0.621124 no
Pileal_Stipeal_center DIF_gill_tissue 0.850027 no
Pileal_Stipeal_center YFB_stipe_center 0.517363 no
Pileal_Stipeal_center YFB_stipe_shell 0.751981 no
Pileal_Stipeal_center YFB_stipe_skin 0.883571 no
Pileal_Stipeal_center YFB_cap_skin 0.813863 no
Pileal_Stipeal_center YFB_cap_tissue 0.692202 no
Pileal_Stipeal_center YFB_gill_tissue 0.739428 no
Pileal_Stipeal_center YFB_veil 0.513719 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.694930 no
Pileal_Stipeal_center DIF_stipe_center 0.996462 no
Pileal_Stipeal_center DIF_stipe_shell 0.948670 no
Pileal_Stipeal_center DIF_stipe_skin 0.822629 no
Pileal_Stipeal_center DIF_cap_skin 0.641922 no
Pileal_Stipeal_center DIF_cap_tissue 0.867462 no
Pileal_Stipeal_shell DIF_gill_tissue 0.889125 no
Pileal_Stipeal_shell YFB_stipe_center 0.891033 no
Pileal_Stipeal_shell YFB_stipe_shell 0.962538 no
Pileal_Stipeal_shell YFB_stipe_skin 0.856762 no
Pileal_Stipeal_shell YFB_cap_skin 0.919545 no
Pileal_Stipeal_shell YFB_cap_tissue 0.319589 no
Pileal_Stipeal_shell YFB_gill_tissue 0.969994 no
Pileal_Stipeal_shell YFB_veil 0.889298 no
Pileal_Stipeal_shell DIF_stipe_center 0.681549 no
Pileal_Stipeal_shell DIF_stipe_shell 0.776216 no
Pileal_Stipeal_shell DIF_stipe_skin 0.914054 no
Pileal_Stipeal_shell DIF_cap_skin 0.970806 no
Pileal_Stipeal_shell DIF_cap_tissue 0.876330 no
DIF_stipe_center DIF_gill_tissue 0.845771 no
DIF_stipe_center YFB_stipe_center 0.513776 no
DIF_stipe_center YFB_stipe_shell 0.748971 no
DIF_stipe_center YFB_stipe_skin 0.878052 no
DIF_stipe_center YFB_cap_skin 0.810748 no
DIF_stipe_center YFB_cap_tissue 0.699835 no
DIF_stipe_center YFB_gill_tissue 0.736521 no
DIF_stipe_center YFB_veil 0.510942 no
DIF_stipe_center DIF_stipe_shell 0.945037 no
DIF_stipe_center DIF_stipe_skin 0.818610 no
DIF_stipe_center DIF_cap_skin 0.638029 no
DIF_stipe_center DIF_cap_tissue 0.862597 no
DIF_stipe_shell DIF_gill_tissue 0.918132 no
DIF_stipe_shell YFB_stipe_center 0.611613 no
DIF_stipe_shell YFB_stipe_shell 0.833015 no
DIF_stipe_shell YFB_stipe_skin 0.944762 no
DIF_stipe_shell YFB_cap_skin 0.888375 no
DIF_stipe_shell YFB_cap_tissue 0.612292 no
DIF_stipe_shell YFB_gill_tissue 0.823199 no
DIF_stipe_shell YFB_veil 0.608287 no
DIF_stipe_shell DIF_stipe_skin 0.895176 no
DIF_stipe_shell DIF_cap_skin 0.732621 no
DIF_stipe_shell DIF_cap_tissue 0.930322 no
DIF_stipe_skin DIF_gill_tissue 0.979835 no
DIF_stipe_skin YFB_stipe_center 0.778436 no
DIF_stipe_skin YFB_stipe_shell 0.955207 no
DIF_stipe_skin YFB_stipe_skin 0.954346 no
DIF_stipe_skin YFB_cap_skin 0.994795 no
DIF_stipe_skin YFB_cap_tissue 0.437732 no
DIF_stipe_skin YFB_gill_tissue 0.948695 no
DIF_stipe_skin YFB_veil 0.773322 no
DIF_stipe_skin DIF_cap_skin 0.879194 no
DIF_stipe_skin DIF_cap_tissue 0.969142 no
DIF_cap_skin DIF_gill_tissue 0.850027 no
DIF_cap_skin YFB_stipe_center 0.927291 no
DIF_cap_skin YFB_stipe_shell 0.931704 no
DIF_cap_skin YFB_stipe_skin 0.814718 no
DIF_cap_skin YFB_cap_skin 0.884623 no
DIF_cap_skin YFB_cap_tissue 0.273655 no
DIF_cap_skin YFB_gill_tissue 0.939073 no
DIF_cap_skin YFB_veil 0.924354 no
DIF_cap_skin DIF_cap_tissue 0.835679 no
DIF_cap_tissue DIF_gill_tissue 0.988715 no
DIF_cap_tissue YFB_stipe_center 0.725366 no
DIF_cap_tissue YFB_stipe_shell 0.922099 no
DIF_cap_tissue YFB_stipe_skin 0.986192 no
DIF_cap_tissue YFB_cap_skin 0.963904 no
DIF_cap_tissue YFB_cap_tissue 0.495953 no
DIF_cap_tissue YFB_gill_tissue 0.912356 no
DIF_cap_tissue YFB_veil 0.722590 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|067980
MPLLSVLLACFTSLAVLLLFFANKELAATLSPQGCRMSFMSPSYVLQDSFNASWSHLASRYSLWLYREVGWDTQS
ANGLPVLFIPGNAGSSHQVRSIASSASRQYYSSPGQVSYSFSSRAIRPLDFYAVEFNEDLSAFHGTTLQSQIDYT
SKAIDYILSHYPPRTPLVILGHSMGGIVGTALLPSEHISAIITMSTPHTLPPARFDSKIDEIYTKVRHNLENDST
PILSLCGGATDGMVPSESCILPSGNSGIHRETVFSSALEGAWTGVGHREMVWCHQVRWRVARAVLELDSTFSPSS
RMEVLDTWLRDGHKLSTVAEKHQENGMDLELSDRAPHEIISSQLQLVRKPIGSHLYLLPIPLVANRTSPTRLSVL
VGKGSITSVPTHIQHGLKVSIYICSETEEGNNISHCSPLMPTTLKLLPKPIPGEPFPRPRLNSHPSSGGVDESEG
IALYEAEVEPSFGRWVGVKADNGEDESWVVAGFNHKEEITNVFSTTSLLFHNAFVDIKADDALRLDIHLPQLLSN
ALIVYRLTPHFQMPLHCAESHLAPLLIHTSHPVETHYFPLISTDDRRILLHTHYPAPYHDKQEQRGLHLIIYSSG
VSSCINKLEGLEFSIDWSATLGRWAPRYLTTLIGWAAGISSITLFLALGVCDRGVPVPSVHQSIRHYEKVLLRFL
LPMSLLASFLPWPTGLYLGLGSFAFSPLAPLILLLASGLVILSWGVLRICLFLLRPVAVFFMASRRHEGSAVGRT
TIISLFVICTTIFMVVPWQVAFLGCWMQQLLTCATLTPHTSHSARATVESYDLLNRSNPDEGNGNPQFRAGGPNA
NGRSISQDNHHLNCHILLFMTWLLPLVASVLAVWVRTLITAGLTTPFDGDHFFLNVLPFLIMVDYSSWTSGPIFT
KQSFEDRILSTRWALPLVAVVSFLVGGTQPHRIFDAGKIAIGLLVVVRIGRRYWGGHPWGS*
Coding >AgabiH97|067980
ATGCCACTTCTGAGTGTATTGCTGGCATGTTTTACCTCTTTGGCCGTGCTGTTACTCTTCTTTGCCAACAAGGAG
CTGGCTGCTACTCTGTCTCCGCAGGGATGTCGGATGTCTTTCATGTCGCCTTCCTATGTACTACAGGACAGCTTC
AATGCCTCCTGGTCGCATTTAGCAAGTAGATATTCGCTCTGGTTGTATAGGGAAGTCGGATGGGATACGCAGTCT
GCGAACGGTCTACCTGTGCTATTTATTCCAGGGAATGCTGGCTCTTCCCACCAAGTCCGCTCGATAGCATCATCC
GCGAGCAGGCAATATTATTCATCTCCTGGACAAGTTTCATACAGCTTCAGTTCCAGAGCAATCAGACCATTAGAT
TTTTATGCAGTCGAATTTAATGAAGACCTGTCCGCATTTCACGGAACGACTCTGCAGTCTCAGATCGACTATACG
TCAAAAGCAATTGATTATATTCTATCCCACTATCCGCCACGGACCCCATTGGTTATCTTGGGCCATTCCATGGGC
GGTATTGTAGGAACTGCGCTTTTGCCTTCCGAGCATATATCAGCGATTATCACAATGTCGACGCCTCATACTCTA
CCTCCAGCCCGATTCGACTCTAAAATAGACGAAATCTACACCAAGGTGCGCCACAACCTTGAGAACGACTCCACT
CCCATTCTATCCCTTTGTGGTGGTGCAACTGATGGGATGGTGCCCTCTGAATCATGCATCCTACCTTCCGGAAAC
AGTGGCATTCATCGAGAGACAGTTTTCTCCTCAGCACTGGAAGGTGCTTGGACTGGAGTGGGGCACAGGGAGATG
GTCTGGTGTCATCAAGTCCGCTGGCGAGTGGCTCGTGCCGTCTTAGAACTGGACTCGACATTTTCGCCGTCCTCC
AGGATGGAAGTTCTCGACACCTGGCTTCGTGACGGTCATAAGTTATCAACTGTTGCCGAGAAACACCAGGAAAAC
GGCATGGACTTGGAACTTTCAGATCGTGCACCTCATGAAATCATTTCCTCTCAATTACAGCTGGTGCGGAAGCCT
ATCGGTTCCCACCTGTACCTACTCCCCATTCCTTTAGTCGCTAATAGGACGTCACCTACCAGGCTGAGCGTGCTT
GTCGGAAAGGGCTCAATTACCTCCGTTCCTACTCACATCCAGCATGGATTAAAAGTTTCTATCTACATCTGTTCA
GAGACCGAAGAAGGAAATAACATTTCTCATTGCTCTCCTCTAATGCCTACTACCCTTAAATTGTTACCAAAACCG
ATTCCTGGAGAACCTTTTCCGAGGCCCCGGTTGAATTCTCATCCTTCCTCTGGGGGCGTGGATGAATCGGAAGGG
ATCGCTTTATATGAGGCGGAAGTAGAGCCATCATTTGGTCGATGGGTTGGTGTCAAGGCCGATAATGGTGAAGAT
GAAAGCTGGGTGGTTGCAGGCTTCAATCACAAAGAGGAAATAACTAATGTATTTTCAACTACATCTCTGCTTTTT
CACAACGCTTTTGTGGATATCAAAGCTGATGATGCGTTGAGACTGGATATTCACCTCCCTCAACTCTTGTCTAAT
GCCCTGATTGTATATCGTCTGACCCCTCATTTCCAGATGCCATTGCATTGTGCCGAATCTCATCTTGCGCCTCTC
CTGATTCATACCTCGCATCCAGTTGAAACGCATTATTTTCCTCTAATATCTACAGATGACCGCCGTATATTACTC
CATACCCATTATCCCGCCCCATACCACGACAAACAGGAACAAAGAGGACTTCATCTAATTATCTATTCATCTGGA
GTGTCAAGCTGCATCAACAAACTCGAAGGGTTGGAGTTCTCTATCGACTGGTCTGCAACTTTAGGACGGTGGGCT
CCCCGGTATTTGACAACTCTCATTGGTTGGGCAGCTGGCATCTCGTCCATAACACTATTTCTTGCTTTAGGGGTG
TGTGACCGCGGAGTCCCCGTGCCTTCCGTTCATCAATCGATACGACATTATGAAAAAGTACTATTACGCTTCCTA
CTCCCCATGTCGTTATTGGCCTCCTTTTTGCCTTGGCCAACAGGACTCTATCTAGGGCTCGGCAGTTTTGCTTTC
TCACCTCTGGCGCCACTTATCTTGCTCTTGGCTTCAGGGTTGGTCATTTTAAGTTGGGGAGTTTTGAGGATATGC
TTGTTTCTGTTGAGACCGGTTGCCGTCTTTTTCATGGCAAGTAGAAGACATGAGGGATCAGCGGTGGGCCGGACC
ACCATCATCTCTTTGTTTGTCATTTGTACGACGATTTTCATGGTCGTACCCTGGCAGGTCGCTTTTCTGGGCTGT
TGGATGCAGCAACTCTTGACTTGTGCGACACTCACGCCTCATACGAGTCACTCAGCTCGTGCCACTGTCGAAAGT
TATGACCTACTTAACCGTTCCAACCCTGACGAAGGAAACGGTAATCCTCAGTTTCGGGCGGGCGGGCCAAATGCG
AATGGCCGCTCTATCAGCCAGGATAACCACCACCTCAATTGCCATATCTTATTGTTCATGACCTGGCTATTGCCT
CTAGTCGCTTCGGTTCTGGCAGTTTGGGTGAGGACACTAATCACGGCCGGATTAACTACACCATTCGACGGAGAC
CATTTCTTCTTGAATGTGTTACCATTTTTAATCATGGTAGACTATTCTTCCTGGACGTCGGGCCCGATATTTACC
AAGCAGAGTTTTGAGGACCGCATACTATCCACCCGATGGGCACTTCCTTTGGTGGCGGTTGTCTCCTTTTTGGTC
GGAGGAACACAGCCACATAGAATTTTCGACGCGGGAAAAATAGCTATTGGACTCCTAGTAGTAGTAAGAATCGGG
CGGCGGTATTGGGGGGGTCACCCCTGGGGTAGTTGA
Transcript >AgabiH97|067980
ATGCCACTTCTGAGTGTATTGCTGGCATGTTTTACCTCTTTGGCCGTGCTGTTACTCTTCTTTGCCAACAAGGAG
CTGGCTGCTACTCTGTCTCCGCAGGGATGTCGGATGTCTTTCATGTCGCCTTCCTATGTACTACAGGACAGCTTC
AATGCCTCCTGGTCGCATTTAGCAAGTAGATATTCGCTCTGGTTGTATAGGGAAGTCGGATGGGATACGCAGTCT
GCGAACGGTCTACCTGTGCTATTTATTCCAGGGAATGCTGGCTCTTCCCACCAAGTCCGCTCGATAGCATCATCC
GCGAGCAGGCAATATTATTCATCTCCTGGACAAGTTTCATACAGCTTCAGTTCCAGAGCAATCAGACCATTAGAT
TTTTATGCAGTCGAATTTAATGAAGACCTGTCCGCATTTCACGGAACGACTCTGCAGTCTCAGATCGACTATACG
TCAAAAGCAATTGATTATATTCTATCCCACTATCCGCCACGGACCCCATTGGTTATCTTGGGCCATTCCATGGGC
GGTATTGTAGGAACTGCGCTTTTGCCTTCCGAGCATATATCAGCGATTATCACAATGTCGACGCCTCATACTCTA
CCTCCAGCCCGATTCGACTCTAAAATAGACGAAATCTACACCAAGGTGCGCCACAACCTTGAGAACGACTCCACT
CCCATTCTATCCCTTTGTGGTGGTGCAACTGATGGGATGGTGCCCTCTGAATCATGCATCCTACCTTCCGGAAAC
AGTGGCATTCATCGAGAGACAGTTTTCTCCTCAGCACTGGAAGGTGCTTGGACTGGAGTGGGGCACAGGGAGATG
GTCTGGTGTCATCAAGTCCGCTGGCGAGTGGCTCGTGCCGTCTTAGAACTGGACTCGACATTTTCGCCGTCCTCC
AGGATGGAAGTTCTCGACACCTGGCTTCGTGACGGTCATAAGTTATCAACTGTTGCCGAGAAACACCAGGAAAAC
GGCATGGACTTGGAACTTTCAGATCGTGCACCTCATGAAATCATTTCCTCTCAATTACAGCTGGTGCGGAAGCCT
ATCGGTTCCCACCTGTACCTACTCCCCATTCCTTTAGTCGCTAATAGGACGTCACCTACCAGGCTGAGCGTGCTT
GTCGGAAAGGGCTCAATTACCTCCGTTCCTACTCACATCCAGCATGGATTAAAAGTTTCTATCTACATCTGTTCA
GAGACCGAAGAAGGAAATAACATTTCTCATTGCTCTCCTCTAATGCCTACTACCCTTAAATTGTTACCAAAACCG
ATTCCTGGAGAACCTTTTCCGAGGCCCCGGTTGAATTCTCATCCTTCCTCTGGGGGCGTGGATGAATCGGAAGGG
ATCGCTTTATATGAGGCGGAAGTAGAGCCATCATTTGGTCGATGGGTTGGTGTCAAGGCCGATAATGGTGAAGAT
GAAAGCTGGGTGGTTGCAGGCTTCAATCACAAAGAGGAAATAACTAATGTATTTTCAACTACATCTCTGCTTTTT
CACAACGCTTTTGTGGATATCAAAGCTGATGATGCGTTGAGACTGGATATTCACCTCCCTCAACTCTTGTCTAAT
GCCCTGATTGTATATCGTCTGACCCCTCATTTCCAGATGCCATTGCATTGTGCCGAATCTCATCTTGCGCCTCTC
CTGATTCATACCTCGCATCCAGTTGAAACGCATTATTTTCCTCTAATATCTACAGATGACCGCCGTATATTACTC
CATACCCATTATCCCGCCCCATACCACGACAAACAGGAACAAAGAGGACTTCATCTAATTATCTATTCATCTGGA
GTGTCAAGCTGCATCAACAAACTCGAAGGGTTGGAGTTCTCTATCGACTGGTCTGCAACTTTAGGACGGTGGGCT
CCCCGGTATTTGACAACTCTCATTGGTTGGGCAGCTGGCATCTCGTCCATAACACTATTTCTTGCTTTAGGGGTG
TGTGACCGCGGAGTCCCCGTGCCTTCCGTTCATCAATCGATACGACATTATGAAAAAGTACTATTACGCTTCCTA
CTCCCCATGTCGTTATTGGCCTCCTTTTTGCCTTGGCCAACAGGACTCTATCTAGGGCTCGGCAGTTTTGCTTTC
TCACCTCTGGCGCCACTTATCTTGCTCTTGGCTTCAGGGTTGGTCATTTTAAGTTGGGGAGTTTTGAGGATATGC
TTGTTTCTGTTGAGACCGGTTGCCGTCTTTTTCATGGCAAGTAGAAGACATGAGGGATCAGCGGTGGGCCGGACC
ACCATCATCTCTTTGTTTGTCATTTGTACGACGATTTTCATGGTCGTACCCTGGCAGGTCGCTTTTCTGGGCTGT
TGGATGCAGCAACTCTTGACTTGTGCGACACTCACGCCTCATACGAGTCACTCAGCTCGTGCCACTGTCGAAAGT
TATGACCTACTTAACCGTTCCAACCCTGACGAAGGAAACGGTAATCCTCAGTTTCGGGCGGGCGGGCCAAATGCG
AATGGCCGCTCTATCAGCCAGGATAACCACCACCTCAATTGCCATATCTTATTGTTCATGACCTGGCTATTGCCT
CTAGTCGCTTCGGTTCTGGCAGTTTGGGTGAGGACACTAATCACGGCCGGATTAACTACACCATTCGACGGAGAC
CATTTCTTCTTGAATGTGTTACCATTTTTAATCATGGTAGACTATTCTTCCTGGACGTCGGGCCCGATATTTACC
AAGCAGAGTTTTGAGGACCGCATACTATCCACCCGATGGGCACTTCCTTTGGTGGCGGTTGTCTCCTTTTTGGTC
GGAGGAACACAGCCACATAGAATTTTCGACGCGGGAAAAATAGCTATTGGACTCCTAGTAGTAGTAAGAATCGGG
CGGCGGTATTGGGGGGGTCACCCCTGGGGTAGTTGA
Gene >AgabiH97|067980
ATGCCACTTCTGAGTGTATTGCTGGCATGTTTTACCTCTTTGGCCGTGCTGTTACTCTTCTTTGCCAACAAGGAG
CTGGCTGCTACTCTGTCTCCGCAGGGATGTCGGATGTCTTTCATGTCGCCTTCCTATGTACTACAGGACAGCTTC
AATGCCTCCTGGTCGCATTTAGCAAGTAGATATTCGCTCTGGTTGTATAGGGAAGTCGGATGGGATACGCAGGTG
GGTTTTGCCTTTGGTCTATTTCCCGTCACTCAGTTATCGCCTAGTCTGCGAACGGTCTACCTGTGCTATTTATTC
CAGGGAATGCTGGCTCTTCCCACCAAGTCCGCTCGATAGCATCATCCGCGAGCAGGCAATATTATTCATCTCCTG
GACAAGTTTCATACAGCTTCAGTTCCAGAGCAATCAGACCATTAGATTTTTATGCAGGCGCGTGGGACATATTGC
TTTCGTCCTACCATTCACTCTGACATTGGGTTTCTCAGTCGAATTTAATGAAGACCTGTCCGCATTTCACGGAAC
GACTCTGCAGTCTCAGATCGACTATACGTCAAAAGCAATTGATTATATTCTATCCCACTATCCGCCACGGACCCC
ATTGGTTATCTTGGGCCATTCCATGGGCGGTATTGTAGGAACTGCGCTTTTGCCTTCCGAGCATATATCAGCGAT
TATCACAATGTCGACGCCTCATACTCTACCTCCAGCCCGATTCGACTCTAAAATAGACGAAATCTACACCAAGGT
GCGCCACAACCTTGAGAACGACTCCACTCCCATTCTATCCCTTTGTGGTGGTGCAACTGATGGGATGGTGCCCTC
TGAATCATGCATCCTACCTTCCGGAAACAGTGGCATTCATCGAGAGACAGTTTTCTCCTCAGCACTGGAAGGTGC
TTGGACTGGAGTGGGGCACAGGGAGATGGTCTGGTGTCATCAAGTCCGCTGGCGAGTGGCTCGTGCCGTCTTAGA
ACTGGACTCGACATTTTCGCCGTCCTCCAGGATGGAAGTTCTCGACACCTGGCTTCGTGACGGTCATAAGTTATC
AACTGTTGCCGAGAAACACCAGGAAAACGGCATGGACTTGGAACTTTCAGATCGTGCACCTCATGAAATCATTTC
CTCTCAATTACAGCTGGTGCGGAAGCCTATCGGTTCCCACCTGTACCTACTCCCCATTCCTTTAGTCGCTAATAG
GACGTCACCTACCAGGCTGAGCGTGCTTGTCGGAAAGGGCTCAATTACCTCCGTTCCTACTCACATCCAGCATGG
ATTAAAAGTTTCTATCTACATCTGTTCAGAGACCGAAGAAGGAAATAACATTTCTCATTGCTCTCCTCTAATGCC
TACTACCCTTAAATTGTTACCAAAACCGATTCCTGGAGAACCTTTTCCGAGGCCCCGGTTGAATTCTCATCCTTC
CTCTGGGGGCGTGGATGAATCGGAAGGGATCGCTTTATATGAGGCGGAAGTAGAGCCATCATTTGGTCGATGGGT
TGGTGTCAAGGCCGATAATGGTGAAGATGAAAGCTGGGTGGTTGCAGGCTTCAATCACAAAGAGGAAATAACTAA
TGTATTTTCAACTACATGTACGTCTGTTGCATTAAATCCAAAAATGGAAGTTAGATGTGTCATTTTAGCTCTGCT
TTTTCACAACGCTTTTGTGGATATCAAAGCTGATGATGCGTTGAGACTGGATATTCACCTCCCTCAACTCTTGTC
TAATGCCCTGATTGTATATCGTCTGACCCCTCATTTCCAGATGCCATTGCATTGTGCCGGTGAGAAGCGAGTGAT
GACTAAGCCTTGACGATGCTTTAACGATACCGTAGAATCTCATCTTGCGCCTCTCCTGATTCATACCTCGCATCC
AGTTGAAACGCATTATTTTCCTCTAATATCTACAGATGACCGCCGTATATTACTCCATACCCATTATCCCGCCCC
ATACCACGACAAACAGGAACAAAGAGGACTTCATCTAATTATCTATTCATCTGGAGTGTCAAGCTGCATCAACAA
ACTCGAAGGGTTGGAGTTCTCTATCGACTGGTCTGCAACTTTAGGACGGTGGGCTCCCCGGTATTTGACAACTCT
CATTGGTTGGGCAGCTGGCATCTCGTCCATAACACTATTTCTTGCTTTAGGGGTGTGTGACCGCGGAGGTAGGTT
TTTGGTTTTACATCATACTAATTACTGACGTTTCATTGACAGTCCCCGTGCCTTCCGTTCATCAATCGATACGAC
ATTATGAAAAAGTACTATTACGCTTCCTACTCCCCATGTCGTTATTGGCCTCCTTTTTGCCTTGGCCAACAGGAC
TCTATCTAGGGCTCGGCAGTTTTGCTTTCTCACCTCTGGCGCCACTTATCTTGCTCTTGGCTTCAGGGTTGGTCA
TTTTAAGTTGGGGAGTTTTGAGGATATGCTTGTTTCTGTTGAGACCGGTTGCCGTCTTTTTCATGGCAAGGTAAG
CTTTATGCTGTGGCGTTTCGTCACAATCCTTATTTACCTCAGTAGAAGACATGAGGGATCAGCGGTGGGCCGGAC
CACCATCATCTCTTTGTTTGTCATTTGTACGACGATTTTCATGGTCGTACCCTGGCAGGTCGCTTTTCTGGGCTG
TTGGATGCAGCAACTCTTGACTTGTGCGACACTCACGCCTCATACGAGTCACTCAGCTCGTGCCACTGTCGAAAG
TTATGACCTACTTAACCGTTCCAACCCTGACGAAGGAAACGGTAATCCTCAGTTTCGGGCGGGCGGGCCAAATGC
GAATGGCCGCTCTATCAGCCAGGATAACCACCACCTCAATTGCCATATCTTATTGTTCATGACCTGGCTATTGCC
TCTAGTCGCTTCGGTTCTGGCAGTTTGGGTGAGGACACTAATCACGGCCGGATTAACTACACCATTCGACGGAGA
CCATTTCTTCTTGAATGTGTTACCATTTTTAATCATGGTAGACTATTCTTCCTGGACGTCGGGCCCGATATTTAC
CAAGCAGAGGTATGTTGTTGTAGTCATTTATACTTGAAACTGGATTTGTCCACTGATATAACAAGTTTTGAGGAC
CGCATACTATCCACCCGATGGGCACTTCCTTTGGTGGCGGTTGTCTCCTTTTTGGTCGGAGGAACACAGCCACAT
AGAATTTTCGACGCGGGAAAAATAGCTATTGGACTCCTAGTAGTAGTAAGAATCGGGCGGCGGTATTGGGGGGGT
CACCCCTGGGGTAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail