Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|067730
Gene name
Locationscaffold_4:608551..611026
Strand-
Gene length (bp)2475
Transcript length (bp)1827
Coding sequence length (bp)1827
Protein length (aa) 609

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09286 Pro-kuma_activ Pro-kumamolisin, activation domain 2.4E-34 40 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 38 604 3.0E-137
sp|C5FRX4|SED4_ARTOC Tripeptidyl-peptidase SED4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED4 PE=3 SV=1 1 605 2.0E-135
sp|D4ANG0|SED2_ARTBC Probable tripeptidyl-peptidase SED2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED2 PE=1 SV=1 1 606 2.0E-132
sp|D4DBH6|SED2_TRIVH Probable tripeptidyl-peptidase SED2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED2 PE=3 SV=1 1 606 2.0E-132
sp|D4AIK6|SED4_ARTBC Probable tripeptidyl-peptidase SED4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED4 PE=1 SV=1 1 605 3.0E-132
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 38 604 3.0E-137
sp|C5FRX4|SED4_ARTOC Tripeptidyl-peptidase SED4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED4 PE=3 SV=1 1 605 2.0E-135
sp|D4ANG0|SED2_ARTBC Probable tripeptidyl-peptidase SED2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED2 PE=1 SV=1 1 606 2.0E-132
sp|D4DBH6|SED2_TRIVH Probable tripeptidyl-peptidase SED2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED2 PE=3 SV=1 1 606 2.0E-132
sp|D4AIK6|SED4_ARTBC Probable tripeptidyl-peptidase SED4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED4 PE=1 SV=1 1 605 3.0E-132
sp|Q70J59|SED2_ASPFU Tripeptidyl-peptidase sed2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed2 PE=1 SV=1 6 604 9.0E-132
sp|D4D9U2|SED4_TRIVH Probable tripeptidyl-peptidase SED4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED4 PE=3 SV=2 1 605 1.0E-131
sp|C5FBW2|SED2_ARTOC Tripeptidyl-peptidase SED2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED2 PE=3 SV=1 1 606 2.0E-130
sp|C5FTQ5|SED3_ARTOC Tripeptidyl-peptidase SED3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED3 PE=3 SV=1 31 605 1.0E-126
sp|D4D7N6|SED3_TRIVH Probable tripeptidyl-peptidase SED3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED3 PE=3 SV=2 17 605 3.0E-125
sp|D4AK75|SED3_ARTBC Probable tripeptidyl-peptidase SED3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED3 PE=3 SV=2 17 605 3.0E-125
sp|Q4WQU0|SED4_ASPFU Tripeptidyl-peptidase sed4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed4 PE=1 SV=1 38 605 7.0E-116
sp|Q70DX9|SED1_ASPFU Tripeptidyl-peptidase sed1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed1 PE=1 SV=1 4 605 4.0E-92
sp|Q8NK92|AORSN_ASPOR Aorsin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aorO PE=1 SV=2 42 604 1.0E-73
sp|Q60HH1|TPP1_MACFA Tripeptidyl-peptidase 1 OS=Macaca fascicularis GN=TPP1 PE=2 SV=2 4 605 2.0E-70
sp|Q9EQV6|TPP1_RAT Tripeptidyl-peptidase 1 OS=Rattus norvegicus GN=Tpp1 PE=1 SV=1 8 605 2.0E-69
sp|O89023|TPP1_MOUSE Tripeptidyl-peptidase 1 OS=Mus musculus GN=Tpp1 PE=1 SV=2 8 605 2.0E-67
sp|O14773|TPP1_HUMAN Tripeptidyl-peptidase 1 OS=Homo sapiens GN=TPP1 PE=1 SV=2 4 605 9.0E-67
sp|Q9XSB8|TPP1_CANLF Tripeptidyl-peptidase 1 OS=Canis lupus familiaris GN=TPP1 PE=3 SV=1 8 605 1.0E-66
sp|Q5IS74|TPP1_PANTR Tripeptidyl-peptidase 1 OS=Pan troglodytes GN=TPP1 PE=2 SV=1 4 605 5.0E-66
sp|Q0V8B6|TPP1_BOVIN Tripeptidyl-peptidase 1 OS=Bos taurus GN=TPP1 PE=2 SV=1 38 605 8.0E-66
sp|Q5RFL1|TPP1_PONAB Tripeptidyl-peptidase 1 OS=Pongo abelii GN=TPP1 PE=2 SV=1 4 605 9.0E-66
sp|C5FHK0|SED1_ARTOC Tripeptidyl-peptidase SED1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED1 PE=3 SV=1 26 605 5.0E-65
sp|Q55CT0|TPP1_DICDI Tripeptidyl-peptidase 1 OS=Dictyostelium discoideum GN=tpp1 PE=3 SV=1 53 603 1.0E-64
sp|Q8MZS4|PHYSA_PHYPO Physarolisin OS=Physarum polycephalum PE=1 SV=1 41 607 6.0E-44
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0017171 serine hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 220.45 122.07 318.83
Initials Initials knots 226.70 124.48 328.91
Pileal_Stipeal_center Stage I stipe center 429.40 214.80 643.98
Pileal_Stipeal_shell Stage I stipe shell 288.36 154.93 421.78
DIF_stipe_center Stage II stipe center 416.92 209.63 624.21
DIF_stipe_shell Stage II stipe shell 417.39 210.14 624.65
DIF_stipe_skin Stage II stipe skin 351.23 182.73 519.73
DIF_cap_skin Stage II cap skin 277.85 149.71 405.99
DIF_cap_tissue Stage II cap tissue 337.45 172.12 502.78
DIF_gill_tissue Stage II gill tissue 374.13 189.01 559.25
YFB_stipe_center Young fruiting body stipe center 258.33 135.02 381.64
YFB_stipe_shell Young fruiting body stipe shell 233.89 129.50 338.27
YFB_stipe_skin Young fruiting body stipe skin 320.93 167.65 474.21
YFB_cap_skin Young fruiting body cap skin 296.97 158.78 435.16
YFB_cap_tissue Young fruiting body cap tissue 316.48 166.25 466.70
YFB_gill_tissue Young fruiting body gill tissue 330.00 172.95 487.04
YFB_veil Young fruiting body veil 299.88 160.09 439.67

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.105702 no
Casing YFB_stipe_center 0.742389 no
Casing YFB_stipe_shell 0.916034 no
Casing YFB_stipe_skin 0.288288 no
Casing YFB_cap_skin 0.425392 no
Casing YFB_cap_tissue 0.309364 no
Casing YFB_gill_tissue 0.241697 no
Casing YFB_veil 0.404135 no
Casing Initials 0.962892 no
Casing Pileal_Stipeal_center 0.031088 yes
Casing Pileal_Stipeal_shell 0.492776 no
Casing DIF_stipe_center 0.034837 yes
Casing DIF_stipe_shell 0.035309 yes
Casing DIF_stipe_skin 0.153146 no
Casing DIF_cap_skin 0.569368 no
Casing DIF_cap_tissue 0.220445 no
DIF_gill_tissue YFB_stipe_center 0.334352 no
DIF_gill_tissue YFB_stipe_shell 0.154787 no
DIF_gill_tissue YFB_stipe_skin 0.768402 no
DIF_gill_tissue YFB_cap_skin 0.605236 no
DIF_gill_tissue YFB_cap_tissue 0.739734 no
DIF_gill_tissue YFB_gill_tissue 0.819112 no
DIF_gill_tissue YFB_veil 0.619611 no
YFB_stipe_center YFB_stipe_shell 0.853176 no
YFB_stipe_center YFB_stipe_skin 0.637286 no
YFB_stipe_center YFB_cap_skin 0.791383 no
YFB_stipe_center YFB_cap_tissue 0.661253 no
YFB_stipe_center YFB_gill_tissue 0.577213 no
YFB_stipe_center YFB_veil 0.767520 no
YFB_stipe_shell YFB_stipe_skin 0.402033 no
YFB_stipe_shell YFB_cap_skin 0.557994 no
YFB_stipe_shell YFB_cap_tissue 0.422885 no
YFB_stipe_shell YFB_gill_tissue 0.342295 no
YFB_stipe_shell YFB_veil 0.527297 no
YFB_stipe_skin YFB_cap_skin 0.896626 no
YFB_stipe_skin YFB_cap_tissue 0.983176 no
YFB_stipe_skin YFB_gill_tissue 0.964708 no
YFB_stipe_skin YFB_veil 0.910377 no
YFB_cap_skin YFB_cap_tissue 0.916575 no
YFB_cap_skin YFB_gill_tissue 0.848054 no
YFB_cap_skin YFB_veil 0.987140 no
YFB_cap_tissue YFB_gill_tissue 0.949040 no
YFB_cap_tissue YFB_veil 0.931434 no
YFB_gill_tissue YFB_veil 0.864881 no
Initials DIF_gill_tissue 0.139267 no
Initials YFB_stipe_center 0.804361 no
Initials YFB_stipe_shell 0.958682 no
Initials YFB_stipe_skin 0.357539 no
Initials YFB_cap_skin 0.506011 no
Initials YFB_cap_tissue 0.377754 no
Initials YFB_gill_tissue 0.303082 no
Initials YFB_veil 0.479802 no
Initials Pileal_Stipeal_center 0.045273 yes
Initials Pileal_Stipeal_shell 0.570335 no
Initials DIF_stipe_center 0.052745 no
Initials DIF_stipe_shell 0.052135 no
Initials DIF_stipe_skin 0.199869 no
Initials DIF_cap_skin 0.645490 no
Initials DIF_cap_tissue 0.274453 no
Pileal_Stipeal_center DIF_gill_tissue 0.798950 no
Pileal_Stipeal_center YFB_stipe_center 0.131406 no
Pileal_Stipeal_center YFB_stipe_shell 0.047373 yes
Pileal_Stipeal_center YFB_stipe_skin 0.483886 no
Pileal_Stipeal_center YFB_cap_skin 0.317599 no
Pileal_Stipeal_center YFB_cap_tissue 0.449640 no
Pileal_Stipeal_center YFB_gill_tissue 0.542392 no
Pileal_Stipeal_center YFB_veil 0.333433 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.264830 no
Pileal_Stipeal_center DIF_stipe_center 0.962785 no
Pileal_Stipeal_center DIF_stipe_shell 0.966089 no
Pileal_Stipeal_center DIF_stipe_skin 0.666654 no
Pileal_Stipeal_center DIF_cap_skin 0.204111 no
Pileal_Stipeal_center DIF_cap_tissue 0.592355 no
Pileal_Stipeal_shell DIF_gill_tissue 0.540915 no
Pileal_Stipeal_shell YFB_stipe_center 0.843285 no
Pileal_Stipeal_shell YFB_stipe_shell 0.623374 no
Pileal_Stipeal_shell YFB_stipe_skin 0.847978 no
Pileal_Stipeal_shell YFB_cap_skin 0.962482 no
Pileal_Stipeal_shell YFB_cap_tissue 0.871597 no
Pileal_Stipeal_shell YFB_gill_tissue 0.796467 no
Pileal_Stipeal_shell YFB_veil 0.950430 no
Pileal_Stipeal_shell DIF_stipe_center 0.319976 no
Pileal_Stipeal_shell DIF_stipe_shell 0.316421 no
Pileal_Stipeal_shell DIF_stipe_skin 0.669546 no
Pileal_Stipeal_shell DIF_cap_skin 0.952636 no
Pileal_Stipeal_shell DIF_cap_tissue 0.755707 no
DIF_stipe_center DIF_gill_tissue 0.851056 no
DIF_stipe_center YFB_stipe_center 0.169576 no
DIF_stipe_center YFB_stipe_shell 0.063570 no
DIF_stipe_center YFB_stipe_skin 0.541251 no
DIF_stipe_center YFB_cap_skin 0.376539 no
DIF_stipe_center YFB_cap_tissue 0.509653 no
DIF_stipe_center YFB_gill_tissue 0.601750 no
DIF_stipe_center YFB_veil 0.391794 no
DIF_stipe_center DIF_stipe_shell 0.998138 no
DIF_stipe_center DIF_stipe_skin 0.727419 no
DIF_stipe_center DIF_cap_skin 0.255913 no
DIF_stipe_center DIF_cap_tissue 0.653022 no
DIF_stipe_shell DIF_gill_tissue 0.850002 no
DIF_stipe_shell YFB_stipe_center 0.164759 no
DIF_stipe_shell YFB_stipe_shell 0.065833 no
DIF_stipe_shell YFB_stipe_skin 0.541363 no
DIF_stipe_shell YFB_cap_skin 0.373669 no
DIF_stipe_shell YFB_cap_tissue 0.509474 no
DIF_stipe_shell YFB_gill_tissue 0.599848 no
DIF_stipe_shell YFB_veil 0.389235 no
DIF_stipe_shell DIF_stipe_skin 0.726706 no
DIF_stipe_shell DIF_cap_skin 0.250586 no
DIF_stipe_shell DIF_cap_tissue 0.651760 no
DIF_stipe_skin DIF_gill_tissue 0.920963 no
DIF_stipe_skin YFB_stipe_center 0.443232 no
DIF_stipe_skin YFB_stipe_shell 0.227150 no
DIF_stipe_skin YFB_stipe_skin 0.875444 no
DIF_stipe_skin YFB_cap_skin 0.733529 no
DIF_stipe_skin YFB_cap_tissue 0.853129 no
DIF_stipe_skin YFB_gill_tissue 0.919301 no
DIF_stipe_skin YFB_veil 0.747798 no
DIF_stipe_skin DIF_cap_skin 0.584223 no
DIF_stipe_skin DIF_cap_tissue 0.950445 no
DIF_cap_skin DIF_gill_tissue 0.468341 no
DIF_cap_skin YFB_stipe_center 0.904776 no
DIF_cap_skin YFB_stipe_shell 0.706008 no
DIF_cap_skin YFB_stipe_skin 0.782444 no
DIF_cap_skin YFB_cap_skin 0.911562 no
DIF_cap_skin YFB_cap_tissue 0.807243 no
DIF_cap_skin YFB_gill_tissue 0.724203 no
DIF_cap_skin YFB_veil 0.896391 no
DIF_cap_skin DIF_cap_tissue 0.683627 no
DIF_cap_tissue DIF_gill_tissue 0.862597 no
DIF_cap_tissue YFB_stipe_center 0.535148 no
DIF_cap_tissue YFB_stipe_shell 0.315961 no
DIF_cap_tissue YFB_stipe_skin 0.937328 no
DIF_cap_tissue YFB_cap_skin 0.817043 no
DIF_cap_tissue YFB_cap_tissue 0.919839 no
DIF_cap_tissue YFB_gill_tissue 0.972310 no
DIF_cap_tissue YFB_veil 0.830158 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|067730
MKFFTSCLLAVTLASRSIALPRTDGAYNFQLKESITPPRGWQRLSAAPADHIIHLRIGLPQSRFDELEKHLYEVS
DPFHHRYGQHLSKAEVDALVAPKKQSLDLVDEWLASFGLGEQDFYRSSAKDWVTIRVPISVAEKMLNTKYHVWKY
GETDDHLIRTTDYSLPDHLNEHVELIQPTTIFARWSKMKATFHLDKDIFEEIPIAKFVSSTSQDLGLADGVTAVD
PSCNATVTIRCLQQLYKTGKYKPRASEKNSIGISSYLEEFVNEQDLKTFYLEQRPDAVNSTFTFISVNDGLNNQT
LDEAGMEANLDAQFAFGLSFPTPAIAYSTAGRPPFNPDILTPLNTNEPYADWLDYVLSHENPPLTISTSYGESEQ
TVPEDYARRVCAGIAQLGARGVSVLFSSGDFGVGDGIEDPDSHTCFTNDDRNITRFMPTFPASCPFATAVGGTND
IPEVAVFFSGGGFSDYFQRPRYQAHAVENYLDNLPYGIYEGKFNKSGRAFPDVAALGRRFRIWWRGKPMSIGGTS
ASAPTFAAVVALLNDVLLSQNKKPLGFLNPWLYATGFPGLNDITIGNNPGCGTPGFNATVGWDPITGLGTPDFEK
MRKLLPTN*
Coding >AgabiH97|067730
ATGAAGTTCTTCACTTCCTGTCTTTTAGCCGTCACACTGGCTTCTCGCTCCATCGCTCTCCCTCGTACGGACGGC
GCTTATAATTTTCAACTCAAGGAAAGTATTACTCCTCCTCGTGGTTGGCAGCGACTCTCTGCTGCTCCTGCGGAC
CATATCATCCACTTGCGCATTGGCCTCCCCCAGTCCAGGTTTGACGAGTTAGAGAAACATCTTTATGAAGTATCC
GACCCCTTTCACCATCGCTACGGTCAGCATCTTTCTAAGGCAGAGGTAGACGCCCTGGTCGCGCCCAAGAAACAA
AGTCTTGACCTCGTGGACGAGTGGCTGGCATCCTTTGGTTTGGGAGAGCAGGATTTCTATCGTTCCTCAGCCAAG
GACTGGGTTACCATCAGAGTTCCGATCAGTGTCGCTGAGAAGATGCTCAACACGAAATACCACGTCTGGAAATAT
GGGGAGACGGATGATCATCTCATCCGGACTACTGATTACAGCCTCCCAGATCATTTGAATGAACATGTTGAGCTT
ATCCAACCCACCACCATCTTCGCTCGTTGGAGTAAAATGAAGGCTACTTTTCACCTTGACAAGGATATTTTTGAG
GAAATCCCGATAGCCAAGTTCGTCTCAAGCACCTCTCAAGACCTTGGGTTGGCTGACGGTGTTACGGCGGTTGAC
CCATCCTGCAATGCAACTGTTACCATACGCTGCTTACAACAGCTATACAAAACCGGGAAATACAAGCCTCGAGCA
TCTGAGAAGAATTCTATTGGCATATCGTCTTACCTCGAGGAGTTTGTAAACGAGCAAGACCTGAAGACTTTCTAT
CTCGAACAGAGACCAGATGCTGTCAACTCCACCTTCACCTTTATCTCCGTTAACGATGGCCTAAACAACCAAACT
CTTGATGAAGCCGGTATGGAAGCGAATCTCGATGCCCAGTTTGCTTTCGGTCTGTCATTTCCCACTCCGGCAATC
GCGTATTCAACTGCTGGCCGCCCGCCTTTCAATCCTGACATACTCACTCCGCTCAATACCAACGAACCGTATGCC
GACTGGCTTGACTACGTACTATCCCACGAAAATCCACCGCTGACAATCTCGACCAGCTATGGTGAATCTGAGCAA
ACTGTTCCTGAAGATTATGCTCGCCGCGTTTGCGCCGGCATCGCTCAGCTCGGTGCCCGCGGTGTATCCGTTTTG
TTTTCTTCGGGAGATTTTGGCGTTGGTGATGGAATAGAAGATCCCGACAGCCACACTTGCTTTACGAATGATGAC
CGTAACATCACTCGATTCATGCCTACTTTCCCCGCAAGTTGCCCTTTTGCTACCGCCGTTGGAGGAACCAATGAC
ATTCCAGAAGTAGCCGTTTTCTTCTCCGGTGGAGGTTTCAGTGACTATTTCCAACGTCCTCGTTATCAAGCTCAT
GCAGTTGAAAATTACCTTGATAATCTTCCTTATGGTATCTACGAGGGAAAGTTCAATAAATCAGGCAGGGCATTC
CCTGACGTTGCAGCGCTCGGAAGGCGATTCCGCATTTGGTGGAGGGGCAAGCCTATGTCGATCGGAGGAACTTCT
GCATCTGCTCCTACATTCGCTGCGGTTGTTGCCTTGCTGAATGATGTCCTTCTCAGTCAGAACAAAAAGCCTCTT
GGATTTTTGAATCCCTGGCTTTATGCCACTGGTTTTCCTGGTCTCAACGACATCACGATCGGAAACAACCCTGGA
TGTGGTACTCCAGGTTTTAACGCTACTGTTGGATGGGATCCTATCACTGGACTGGGAACTCCCGATTTTGAAAAG
ATGCGGAAGTTGTTGCCTACAAACTGA
Transcript >AgabiH97|067730
ATGAAGTTCTTCACTTCCTGTCTTTTAGCCGTCACACTGGCTTCTCGCTCCATCGCTCTCCCTCGTACGGACGGC
GCTTATAATTTTCAACTCAAGGAAAGTATTACTCCTCCTCGTGGTTGGCAGCGACTCTCTGCTGCTCCTGCGGAC
CATATCATCCACTTGCGCATTGGCCTCCCCCAGTCCAGGTTTGACGAGTTAGAGAAACATCTTTATGAAGTATCC
GACCCCTTTCACCATCGCTACGGTCAGCATCTTTCTAAGGCAGAGGTAGACGCCCTGGTCGCGCCCAAGAAACAA
AGTCTTGACCTCGTGGACGAGTGGCTGGCATCCTTTGGTTTGGGAGAGCAGGATTTCTATCGTTCCTCAGCCAAG
GACTGGGTTACCATCAGAGTTCCGATCAGTGTCGCTGAGAAGATGCTCAACACGAAATACCACGTCTGGAAATAT
GGGGAGACGGATGATCATCTCATCCGGACTACTGATTACAGCCTCCCAGATCATTTGAATGAACATGTTGAGCTT
ATCCAACCCACCACCATCTTCGCTCGTTGGAGTAAAATGAAGGCTACTTTTCACCTTGACAAGGATATTTTTGAG
GAAATCCCGATAGCCAAGTTCGTCTCAAGCACCTCTCAAGACCTTGGGTTGGCTGACGGTGTTACGGCGGTTGAC
CCATCCTGCAATGCAACTGTTACCATACGCTGCTTACAACAGCTATACAAAACCGGGAAATACAAGCCTCGAGCA
TCTGAGAAGAATTCTATTGGCATATCGTCTTACCTCGAGGAGTTTGTAAACGAGCAAGACCTGAAGACTTTCTAT
CTCGAACAGAGACCAGATGCTGTCAACTCCACCTTCACCTTTATCTCCGTTAACGATGGCCTAAACAACCAAACT
CTTGATGAAGCCGGTATGGAAGCGAATCTCGATGCCCAGTTTGCTTTCGGTCTGTCATTTCCCACTCCGGCAATC
GCGTATTCAACTGCTGGCCGCCCGCCTTTCAATCCTGACATACTCACTCCGCTCAATACCAACGAACCGTATGCC
GACTGGCTTGACTACGTACTATCCCACGAAAATCCACCGCTGACAATCTCGACCAGCTATGGTGAATCTGAGCAA
ACTGTTCCTGAAGATTATGCTCGCCGCGTTTGCGCCGGCATCGCTCAGCTCGGTGCCCGCGGTGTATCCGTTTTG
TTTTCTTCGGGAGATTTTGGCGTTGGTGATGGAATAGAAGATCCCGACAGCCACACTTGCTTTACGAATGATGAC
CGTAACATCACTCGATTCATGCCTACTTTCCCCGCAAGTTGCCCTTTTGCTACCGCCGTTGGAGGAACCAATGAC
ATTCCAGAAGTAGCCGTTTTCTTCTCCGGTGGAGGTTTCAGTGACTATTTCCAACGTCCTCGTTATCAAGCTCAT
GCAGTTGAAAATTACCTTGATAATCTTCCTTATGGTATCTACGAGGGAAAGTTCAATAAATCAGGCAGGGCATTC
CCTGACGTTGCAGCGCTCGGAAGGCGATTCCGCATTTGGTGGAGGGGCAAGCCTATGTCGATCGGAGGAACTTCT
GCATCTGCTCCTACATTCGCTGCGGTTGTTGCCTTGCTGAATGATGTCCTTCTCAGTCAGAACAAAAAGCCTCTT
GGATTTTTGAATCCCTGGCTTTATGCCACTGGTTTTCCTGGTCTCAACGACATCACGATCGGAAACAACCCTGGA
TGTGGTACTCCAGGTTTTAACGCTACTGTTGGATGGGATCCTATCACTGGACTGGGAACTCCCGATTTTGAAAAG
ATGCGGAAGTTGTTGCCTACAAACTGA
Gene >AgabiH97|067730
ATGAAGTTCTTCACTTCCTGTCTTTTAGCCGTCACACTGGCTTCTCGCTCCATCGCTCTCCCTCGTACGGACGGC
GCTTATAATTTTCAACTCAAGGAAAGTATTACTCCTCCTCGTGGTTGGCAGCGACTCTCTGCTGCTCCTGCGGAC
CATATCATCCACTTGCGCATTGGCCTCCCCCAGTCCAGGTTTGACGAGTTAGAGAAACATCTTTATGAAGTATCC
GACCCCTTTCACCATCGCTACGGTCAGCATCTTTCTAAGGCAGAGGTAGACGCCCTGGTCGCGCCCAAGAAACAA
AGTCTTGACCTCGTGGACGAGTGGCTGGCATCCTTTGGTTTGGGAGAGCAGGATTTCTATCGTTCCTCAGCCAAG
GACTGGGTTACCATCAGAGTTCCGATCAGTGTCGCTGAGAAGATGCTCAACACGGTAAGCTATTTCTTTTTATAG
ATTGTCTTCGAGTAATGAAGCTTGATTCTCAAAATCAGAAATACCACGTCTGGAAATATGGGGAGACGGATGATC
ATCTCATCCGGACTACTGATTACAGCCTCCCAGATCATTTGAATGAACATGTTGAGCTTATCCAACCCACCACCA
TCTTCGCTCGTTGGAGTAAAATGAAGGCTACTTTTCACCTTGACAAGGATATTTTTGAGGAAATCCCGATAGCCA
AGTTCGTCTCAAGCACCTCTCAAGACCTTGGGTTGGCTGACGGTGTTACGGCGGTTGACCCATCCTGCAATGCAA
CTGTTACCATACGCTGCTTACAACAGCTATACAAAACCGGGAAATACAAGCCTCGAGCATCTGAGAAGAATTCTA
TTGGCATATCGTCTTACCTCGAGGAGTTTGTAAACGAGCAAGACCTGAAGACTTTCTATCTCGAACAGAGACCAG
ATGCTGTCAACTCCACCTTCACCTTTATCTCCGTTAACGGTGAGGAGCATCTCAAGTATCGGGATACGAATCTGA
AAAGCCTAGATGGCCTAAACAACCAAACTCTTGATGAAGCCGGTATGGAAGCGAATCTCGATGCCCAGTTTGCTT
TCGGTCTGTCATTTCCCACTCCGGCAATCGCGTATTCAACTGCTGGCCGCCCGCCTTTCAATCCTGACATACTCA
CTCCGCTCAATACCAACGGTGAGTTGCTACGGTTCTTTTTCTTTTTGAAGGGTCAATCCTGATCCGCGTCTACAG
AACCGTATGCCGACGTAAGCCAACGCAATCAGGCTAATGAGTTTCATTTACTGAAAGTTGGTTTTAGTGGCTTGA
CTACGTACTATCCCACGAAAATCCACCGCTGACAATCTCGACCAGCTATGGTGAATCTGAGCAAACTGGTACGCC
ACATATTCCCGTCTCAGGTTAAGTTGCTCGATATTTATCAAAGTTTAAGTTCCTGAAGATTATGCTCGCCGCGTT
TGCGCCGGCATCGCTCAGCTCGGTGAACATTAGTTTGTTGAGCCAAGCGTGAGCTTGAATACTCAGTGGTATTTT
AGGTGCCCGCGGTGTATCCGTTTTGTTTTCTTCGGGAGATTTTGGCGTTGGTGATGGAATAGAAGATCCCGACAG
CCACACTTGCTTTACGAATGATGACCGTAACATCACTCGATTCATGCCTACTTTCCCCGCAAGGTATGTTTAAAC
TTTACTGCATTCTAACTCGAACTTAATTATATCTAGTTGCCCTTTGTGAGTTAGGAGTTTTCATGATCATGCGAC
TAACTCGAACAATGATCAGTGCTACCGCCGTTGGAGGAACCAATGACATTCCAGAAGTAGCCGTTTTCTTCTCCG
GTGGAGGTTTCAGTGACTATGTCCGTCTTTTTCCTGTCTTCGTATCCTTCCTTGAGTAAACCTCATACCTTTGCT
CTTTTGGCAGTTCCAACGTCCTCGTTATCAAGCTCATGCAGTTGAAAATTACCTTGATAATCTTCCTTATGGTAT
CTACGAGGGAAAGTTCAATAAGTATGGTCTTTTCAATAAACCTTTATCCACAATCTATTCATAAAATTCTATTTT
GCAGATCAGGCAGGGTAACTATTCCGTTCACAAAGCTATTTTGATATCATCTAAGTGTATTTACAGGCATTCCCT
GACGTTGCAGCGCTCGGAAGGCGATTCCGCATTTGGTGGAGGGGCAAGCCTATGTCGATCGGAGGAACTTCTGCA
TCTGCTCCTACATTCGCTGCGGTTGTTGCCTTGCTGAATGATGTCCTTCTCAGTCAGAACAAAAAGCCTCTTGGA
TTTTTGAATCCCTGGCTTTATGCCACTGGTTTTCCTGGTCTCAACGACATCACGATCGGAAACAACCCTGGATGT
GGTACTCCAGGTTTTAACGTGAGCGTCTGAATTTCATCCGGAATATAATTGTCCTGACCCTTTTCGAAGGCTACT
GTTGGATGGGATCCTATCACTGGACTGGGAACTCCCGATTTTGAAAAGATGCGGAAGTTGTTGCCTACAAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail