Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|067730
Gene name
Locationscaffold_4:608551..611026
Strand-
Gene length (bp)2475
Transcript length (bp)1827
Coding sequence length (bp)1827
Protein length (aa) 609

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09286 Pro-kuma_activ Pro-kumamolisin, activation domain 2.4E-34 40 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 38 604 3.0E-137
sp|C5FRX4|SED4_ARTOC Tripeptidyl-peptidase SED4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED4 PE=3 SV=1 1 605 2.0E-135
sp|D4ANG0|SED2_ARTBC Probable tripeptidyl-peptidase SED2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED2 PE=1 SV=1 1 606 2.0E-132
sp|D4DBH6|SED2_TRIVH Probable tripeptidyl-peptidase SED2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED2 PE=3 SV=1 1 606 2.0E-132
sp|D4AIK6|SED4_ARTBC Probable tripeptidyl-peptidase SED4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED4 PE=1 SV=1 1 605 3.0E-132
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 38 604 3.0E-137
sp|C5FRX4|SED4_ARTOC Tripeptidyl-peptidase SED4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED4 PE=3 SV=1 1 605 2.0E-135
sp|D4ANG0|SED2_ARTBC Probable tripeptidyl-peptidase SED2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED2 PE=1 SV=1 1 606 2.0E-132
sp|D4DBH6|SED2_TRIVH Probable tripeptidyl-peptidase SED2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED2 PE=3 SV=1 1 606 2.0E-132
sp|D4AIK6|SED4_ARTBC Probable tripeptidyl-peptidase SED4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED4 PE=1 SV=1 1 605 3.0E-132
sp|Q70J59|SED2_ASPFU Tripeptidyl-peptidase sed2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed2 PE=1 SV=1 6 604 9.0E-132
sp|D4D9U2|SED4_TRIVH Probable tripeptidyl-peptidase SED4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED4 PE=3 SV=2 1 605 1.0E-131
sp|C5FBW2|SED2_ARTOC Tripeptidyl-peptidase SED2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED2 PE=3 SV=1 1 606 2.0E-130
sp|C5FTQ5|SED3_ARTOC Tripeptidyl-peptidase SED3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED3 PE=3 SV=1 31 605 1.0E-126
sp|D4D7N6|SED3_TRIVH Probable tripeptidyl-peptidase SED3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED3 PE=3 SV=2 17 605 3.0E-125
sp|D4AK75|SED3_ARTBC Probable tripeptidyl-peptidase SED3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED3 PE=3 SV=2 17 605 3.0E-125
sp|Q4WQU0|SED4_ASPFU Tripeptidyl-peptidase sed4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed4 PE=1 SV=1 38 605 7.0E-116
sp|Q70DX9|SED1_ASPFU Tripeptidyl-peptidase sed1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed1 PE=1 SV=1 4 605 4.0E-92
sp|Q8NK92|AORSN_ASPOR Aorsin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aorO PE=1 SV=2 42 604 1.0E-73
sp|Q60HH1|TPP1_MACFA Tripeptidyl-peptidase 1 OS=Macaca fascicularis GN=TPP1 PE=2 SV=2 4 605 2.0E-70
sp|Q9EQV6|TPP1_RAT Tripeptidyl-peptidase 1 OS=Rattus norvegicus GN=Tpp1 PE=1 SV=1 8 605 2.0E-69
sp|O89023|TPP1_MOUSE Tripeptidyl-peptidase 1 OS=Mus musculus GN=Tpp1 PE=1 SV=2 8 605 2.0E-67
sp|O14773|TPP1_HUMAN Tripeptidyl-peptidase 1 OS=Homo sapiens GN=TPP1 PE=1 SV=2 4 605 9.0E-67
sp|Q9XSB8|TPP1_CANLF Tripeptidyl-peptidase 1 OS=Canis lupus familiaris GN=TPP1 PE=3 SV=1 8 605 1.0E-66
sp|Q5IS74|TPP1_PANTR Tripeptidyl-peptidase 1 OS=Pan troglodytes GN=TPP1 PE=2 SV=1 4 605 5.0E-66
sp|Q0V8B6|TPP1_BOVIN Tripeptidyl-peptidase 1 OS=Bos taurus GN=TPP1 PE=2 SV=1 38 605 8.0E-66
sp|Q5RFL1|TPP1_PONAB Tripeptidyl-peptidase 1 OS=Pongo abelii GN=TPP1 PE=2 SV=1 4 605 9.0E-66
sp|C5FHK0|SED1_ARTOC Tripeptidyl-peptidase SED1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED1 PE=3 SV=1 26 605 5.0E-65
sp|Q55CT0|TPP1_DICDI Tripeptidyl-peptidase 1 OS=Dictyostelium discoideum GN=tpp1 PE=3 SV=1 53 603 1.0E-64
sp|Q8MZS4|PHYSA_PHYPO Physarolisin OS=Physarum polycephalum PE=1 SV=1 41 607 6.0E-44
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0017171 serine hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|067730
MKFFTSCLLAVTLASRSIALPRTDGAYNFQLKESITPPRGWQRLSAAPADHIIHLRIGLPQSRFDELEKHLYEVS
DPFHHRYGQHLSKAEVDALVAPKKQSLDLVDEWLASFGLGEQDFYRSSAKDWVTIRVPISVAEKMLNTKYHVWKY
GETDDHLIRTTDYSLPDHLNEHVELIQPTTIFARWSKMKATFHLDKDIFEEIPIAKFVSSTSQDLGLADGVTAVD
PSCNATVTIRCLQQLYKTGKYKPRASEKNSIGISSYLEEFVNEQDLKTFYLEQRPDAVNSTFTFISVNDGLNNQT
LDEAGMEANLDAQFAFGLSFPTPAIAYSTAGRPPFNPDILTPLNTNEPYADWLDYVLSHENPPLTISTSYGESEQ
TVPEDYARRVCAGIAQLGARGVSVLFSSGDFGVGDGIEDPDSHTCFTNDDRNITRFMPTFPASCPFATAVGGTND
IPEVAVFFSGGGFSDYFQRPRYQAHAVENYLDNLPYGIYEGKFNKSGRAFPDVAALGRRFRIWWRGKPMSIGGTS
ASAPTFAAVVALLNDVLLSQNKKPLGFLNPWLYATGFPGLNDITIGNNPGCGTPGFNATVGWDPITGLGTPDFEK
MRKLLPTN*
Coding >AgabiH97|067730
ATGAAGTTCTTCACTTCCTGTCTTTTAGCCGTCACACTGGCTTCTCGCTCCATCGCTCTCCCTCGTACGGACGGC
GCTTATAATTTTCAACTCAAGGAAAGTATTACTCCTCCTCGTGGTTGGCAGCGACTCTCTGCTGCTCCTGCGGAC
CATATCATCCACTTGCGCATTGGCCTCCCCCAGTCCAGGTTTGACGAGTTAGAGAAACATCTTTATGAAGTATCC
GACCCCTTTCACCATCGCTACGGTCAGCATCTTTCTAAGGCAGAGGTAGACGCCCTGGTCGCGCCCAAGAAACAA
AGTCTTGACCTCGTGGACGAGTGGCTGGCATCCTTTGGTTTGGGAGAGCAGGATTTCTATCGTTCCTCAGCCAAG
GACTGGGTTACCATCAGAGTTCCGATCAGTGTCGCTGAGAAGATGCTCAACACGAAATACCACGTCTGGAAATAT
GGGGAGACGGATGATCATCTCATCCGGACTACTGATTACAGCCTCCCAGATCATTTGAATGAACATGTTGAGCTT
ATCCAACCCACCACCATCTTCGCTCGTTGGAGTAAAATGAAGGCTACTTTTCACCTTGACAAGGATATTTTTGAG
GAAATCCCGATAGCCAAGTTCGTCTCAAGCACCTCTCAAGACCTTGGGTTGGCTGACGGTGTTACGGCGGTTGAC
CCATCCTGCAATGCAACTGTTACCATACGCTGCTTACAACAGCTATACAAAACCGGGAAATACAAGCCTCGAGCA
TCTGAGAAGAATTCTATTGGCATATCGTCTTACCTCGAGGAGTTTGTAAACGAGCAAGACCTGAAGACTTTCTAT
CTCGAACAGAGACCAGATGCTGTCAACTCCACCTTCACCTTTATCTCCGTTAACGATGGCCTAAACAACCAAACT
CTTGATGAAGCCGGTATGGAAGCGAATCTCGATGCCCAGTTTGCTTTCGGTCTGTCATTTCCCACTCCGGCAATC
GCGTATTCAACTGCTGGCCGCCCGCCTTTCAATCCTGACATACTCACTCCGCTCAATACCAACGAACCGTATGCC
GACTGGCTTGACTACGTACTATCCCACGAAAATCCACCGCTGACAATCTCGACCAGCTATGGTGAATCTGAGCAA
ACTGTTCCTGAAGATTATGCTCGCCGCGTTTGCGCCGGCATCGCTCAGCTCGGTGCCCGCGGTGTATCCGTTTTG
TTTTCTTCGGGAGATTTTGGCGTTGGTGATGGAATAGAAGATCCCGACAGCCACACTTGCTTTACGAATGATGAC
CGTAACATCACTCGATTCATGCCTACTTTCCCCGCAAGTTGCCCTTTTGCTACCGCCGTTGGAGGAACCAATGAC
ATTCCAGAAGTAGCCGTTTTCTTCTCCGGTGGAGGTTTCAGTGACTATTTCCAACGTCCTCGTTATCAAGCTCAT
GCAGTTGAAAATTACCTTGATAATCTTCCTTATGGTATCTACGAGGGAAAGTTCAATAAATCAGGCAGGGCATTC
CCTGACGTTGCAGCGCTCGGAAGGCGATTCCGCATTTGGTGGAGGGGCAAGCCTATGTCGATCGGAGGAACTTCT
GCATCTGCTCCTACATTCGCTGCGGTTGTTGCCTTGCTGAATGATGTCCTTCTCAGTCAGAACAAAAAGCCTCTT
GGATTTTTGAATCCCTGGCTTTATGCCACTGGTTTTCCTGGTCTCAACGACATCACGATCGGAAACAACCCTGGA
TGTGGTACTCCAGGTTTTAACGCTACTGTTGGATGGGATCCTATCACTGGACTGGGAACTCCCGATTTTGAAAAG
ATGCGGAAGTTGTTGCCTACAAACTGA
Transcript >AgabiH97|067730
ATGAAGTTCTTCACTTCCTGTCTTTTAGCCGTCACACTGGCTTCTCGCTCCATCGCTCTCCCTCGTACGGACGGC
GCTTATAATTTTCAACTCAAGGAAAGTATTACTCCTCCTCGTGGTTGGCAGCGACTCTCTGCTGCTCCTGCGGAC
CATATCATCCACTTGCGCATTGGCCTCCCCCAGTCCAGGTTTGACGAGTTAGAGAAACATCTTTATGAAGTATCC
GACCCCTTTCACCATCGCTACGGTCAGCATCTTTCTAAGGCAGAGGTAGACGCCCTGGTCGCGCCCAAGAAACAA
AGTCTTGACCTCGTGGACGAGTGGCTGGCATCCTTTGGTTTGGGAGAGCAGGATTTCTATCGTTCCTCAGCCAAG
GACTGGGTTACCATCAGAGTTCCGATCAGTGTCGCTGAGAAGATGCTCAACACGAAATACCACGTCTGGAAATAT
GGGGAGACGGATGATCATCTCATCCGGACTACTGATTACAGCCTCCCAGATCATTTGAATGAACATGTTGAGCTT
ATCCAACCCACCACCATCTTCGCTCGTTGGAGTAAAATGAAGGCTACTTTTCACCTTGACAAGGATATTTTTGAG
GAAATCCCGATAGCCAAGTTCGTCTCAAGCACCTCTCAAGACCTTGGGTTGGCTGACGGTGTTACGGCGGTTGAC
CCATCCTGCAATGCAACTGTTACCATACGCTGCTTACAACAGCTATACAAAACCGGGAAATACAAGCCTCGAGCA
TCTGAGAAGAATTCTATTGGCATATCGTCTTACCTCGAGGAGTTTGTAAACGAGCAAGACCTGAAGACTTTCTAT
CTCGAACAGAGACCAGATGCTGTCAACTCCACCTTCACCTTTATCTCCGTTAACGATGGCCTAAACAACCAAACT
CTTGATGAAGCCGGTATGGAAGCGAATCTCGATGCCCAGTTTGCTTTCGGTCTGTCATTTCCCACTCCGGCAATC
GCGTATTCAACTGCTGGCCGCCCGCCTTTCAATCCTGACATACTCACTCCGCTCAATACCAACGAACCGTATGCC
GACTGGCTTGACTACGTACTATCCCACGAAAATCCACCGCTGACAATCTCGACCAGCTATGGTGAATCTGAGCAA
ACTGTTCCTGAAGATTATGCTCGCCGCGTTTGCGCCGGCATCGCTCAGCTCGGTGCCCGCGGTGTATCCGTTTTG
TTTTCTTCGGGAGATTTTGGCGTTGGTGATGGAATAGAAGATCCCGACAGCCACACTTGCTTTACGAATGATGAC
CGTAACATCACTCGATTCATGCCTACTTTCCCCGCAAGTTGCCCTTTTGCTACCGCCGTTGGAGGAACCAATGAC
ATTCCAGAAGTAGCCGTTTTCTTCTCCGGTGGAGGTTTCAGTGACTATTTCCAACGTCCTCGTTATCAAGCTCAT
GCAGTTGAAAATTACCTTGATAATCTTCCTTATGGTATCTACGAGGGAAAGTTCAATAAATCAGGCAGGGCATTC
CCTGACGTTGCAGCGCTCGGAAGGCGATTCCGCATTTGGTGGAGGGGCAAGCCTATGTCGATCGGAGGAACTTCT
GCATCTGCTCCTACATTCGCTGCGGTTGTTGCCTTGCTGAATGATGTCCTTCTCAGTCAGAACAAAAAGCCTCTT
GGATTTTTGAATCCCTGGCTTTATGCCACTGGTTTTCCTGGTCTCAACGACATCACGATCGGAAACAACCCTGGA
TGTGGTACTCCAGGTTTTAACGCTACTGTTGGATGGGATCCTATCACTGGACTGGGAACTCCCGATTTTGAAAAG
ATGCGGAAGTTGTTGCCTACAAACTGA
Gene >AgabiH97|067730
ATGAAGTTCTTCACTTCCTGTCTTTTAGCCGTCACACTGGCTTCTCGCTCCATCGCTCTCCCTCGTACGGACGGC
GCTTATAATTTTCAACTCAAGGAAAGTATTACTCCTCCTCGTGGTTGGCAGCGACTCTCTGCTGCTCCTGCGGAC
CATATCATCCACTTGCGCATTGGCCTCCCCCAGTCCAGGTTTGACGAGTTAGAGAAACATCTTTATGAAGTATCC
GACCCCTTTCACCATCGCTACGGTCAGCATCTTTCTAAGGCAGAGGTAGACGCCCTGGTCGCGCCCAAGAAACAA
AGTCTTGACCTCGTGGACGAGTGGCTGGCATCCTTTGGTTTGGGAGAGCAGGATTTCTATCGTTCCTCAGCCAAG
GACTGGGTTACCATCAGAGTTCCGATCAGTGTCGCTGAGAAGATGCTCAACACGGTAAGCTATTTCTTTTTATAG
ATTGTCTTCGAGTAATGAAGCTTGATTCTCAAAATCAGAAATACCACGTCTGGAAATATGGGGAGACGGATGATC
ATCTCATCCGGACTACTGATTACAGCCTCCCAGATCATTTGAATGAACATGTTGAGCTTATCCAACCCACCACCA
TCTTCGCTCGTTGGAGTAAAATGAAGGCTACTTTTCACCTTGACAAGGATATTTTTGAGGAAATCCCGATAGCCA
AGTTCGTCTCAAGCACCTCTCAAGACCTTGGGTTGGCTGACGGTGTTACGGCGGTTGACCCATCCTGCAATGCAA
CTGTTACCATACGCTGCTTACAACAGCTATACAAAACCGGGAAATACAAGCCTCGAGCATCTGAGAAGAATTCTA
TTGGCATATCGTCTTACCTCGAGGAGTTTGTAAACGAGCAAGACCTGAAGACTTTCTATCTCGAACAGAGACCAG
ATGCTGTCAACTCCACCTTCACCTTTATCTCCGTTAACGGTGAGGAGCATCTCAAGTATCGGGATACGAATCTGA
AAAGCCTAGATGGCCTAAACAACCAAACTCTTGATGAAGCCGGTATGGAAGCGAATCTCGATGCCCAGTTTGCTT
TCGGTCTGTCATTTCCCACTCCGGCAATCGCGTATTCAACTGCTGGCCGCCCGCCTTTCAATCCTGACATACTCA
CTCCGCTCAATACCAACGGTGAGTTGCTACGGTTCTTTTTCTTTTTGAAGGGTCAATCCTGATCCGCGTCTACAG
AACCGTATGCCGACGTAAGCCAACGCAATCAGGCTAATGAGTTTCATTTACTGAAAGTTGGTTTTAGTGGCTTGA
CTACGTACTATCCCACGAAAATCCACCGCTGACAATCTCGACCAGCTATGGTGAATCTGAGCAAACTGGTACGCC
ACATATTCCCGTCTCAGGTTAAGTTGCTCGATATTTATCAAAGTTTAAGTTCCTGAAGATTATGCTCGCCGCGTT
TGCGCCGGCATCGCTCAGCTCGGTGAACATTAGTTTGTTGAGCCAAGCGTGAGCTTGAATACTCAGTGGTATTTT
AGGTGCCCGCGGTGTATCCGTTTTGTTTTCTTCGGGAGATTTTGGCGTTGGTGATGGAATAGAAGATCCCGACAG
CCACACTTGCTTTACGAATGATGACCGTAACATCACTCGATTCATGCCTACTTTCCCCGCAAGGTATGTTTAAAC
TTTACTGCATTCTAACTCGAACTTAATTATATCTAGTTGCCCTTTGTGAGTTAGGAGTTTTCATGATCATGCGAC
TAACTCGAACAATGATCAGTGCTACCGCCGTTGGAGGAACCAATGACATTCCAGAAGTAGCCGTTTTCTTCTCCG
GTGGAGGTTTCAGTGACTATGTCCGTCTTTTTCCTGTCTTCGTATCCTTCCTTGAGTAAACCTCATACCTTTGCT
CTTTTGGCAGTTCCAACGTCCTCGTTATCAAGCTCATGCAGTTGAAAATTACCTTGATAATCTTCCTTATGGTAT
CTACGAGGGAAAGTTCAATAAGTATGGTCTTTTCAATAAACCTTTATCCACAATCTATTCATAAAATTCTATTTT
GCAGATCAGGCAGGGTAACTATTCCGTTCACAAAGCTATTTTGATATCATCTAAGTGTATTTACAGGCATTCCCT
GACGTTGCAGCGCTCGGAAGGCGATTCCGCATTTGGTGGAGGGGCAAGCCTATGTCGATCGGAGGAACTTCTGCA
TCTGCTCCTACATTCGCTGCGGTTGTTGCCTTGCTGAATGATGTCCTTCTCAGTCAGAACAAAAAGCCTCTTGGA
TTTTTGAATCCCTGGCTTTATGCCACTGGTTTTCCTGGTCTCAACGACATCACGATCGGAAACAACCCTGGATGT
GGTACTCCAGGTTTTAACGTGAGCGTCTGAATTTCATCCGGAATATAATTGTCCTGACCCTTTTCGAAGGCTACT
GTTGGATGGGATCCTATCACTGGACTGGGAACTCCCGATTTTGAAAAGATGCGGAAGTTGTTGCCTACAAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail