Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|067710
Gene name
Locationscaffold_4:602962..604331
Strand-
Gene length (bp)1369
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 6.5E-22 39 159
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 8.4E-15 40 312
PF12146 Hydrolase_4 Serine aminopeptidase, S33 5.4E-07 38 146
PF03096 Ndr Ndr family 1.4E-06 86 139

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 3 325 2.0E-50
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 3 325 4.0E-47
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 6 324 2.0E-45
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 6 325 3.0E-43
sp|G5EDL5|CEEH2_CAEEL Epoxide hydrolase 2 OS=Caenorhabditis elegans GN=ceeh-2 PE=1 SV=1 2 332 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 3 325 2.0E-50
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 3 325 4.0E-47
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 6 324 2.0E-45
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 6 325 3.0E-43
sp|G5EDL5|CEEH2_CAEEL Epoxide hydrolase 2 OS=Caenorhabditis elegans GN=ceeh-2 PE=1 SV=1 2 332 1.0E-26
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 40 325 3.0E-25
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 40 325 2.0E-24
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 37 325 2.0E-24
sp|G5EBI4|CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans GN=ceeh-1 PE=1 SV=1 3 324 7.0E-24
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 40 325 9.0E-23
sp|Q9H6B9|EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1 2 327 3.0E-22
sp|Q3V1F8|EPHX3_MOUSE Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 SV=2 17 327 4.0E-21
sp|P59336|DHAA_RHOSD Haloalkane dehalogenase OS=Rhodococcus sp. (strain TDTM0003) GN=dhaA PE=1 SV=1 19 328 8.0E-15
sp|Q9ZER0|DHAA_MYCSX Haloalkane dehalogenase OS=Mycobacterium sp. (strain GP1) GN=dhaAF PE=2 SV=1 19 327 7.0E-14
sp|P0A3G3|DHAA_RHOSO Haloalkane dehalogenase OS=Rhodococcus sp. GN=dhaA PE=1 SV=1 19 327 9.0E-14
sp|P0A3G2|DHAA_RHORH Haloalkane dehalogenase OS=Rhodococcus rhodochrous GN=dhaA PE=1 SV=1 19 327 9.0E-14
sp|P0A3G4|DHAA_PSEPV Haloalkane dehalogenase OS=Pseudomonas pavonaceae GN=dhaA PE=1 SV=1 19 327 9.0E-14
sp|Q1JU72|DEHA_BURSP Fluoroacetate dehalogenase OS=Burkholderia sp. GN=fac-dex PE=1 SV=1 39 170 1.0E-12
sp|P23974|MENH_BACSU Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase OS=Bacillus subtilis (strain 168) GN=menH PE=3 SV=2 16 138 2.0E-12
sp|O52866|HYES_CORS2 Soluble epoxide hydrolase OS=Corynebacterium sp. (strain C12) PE=1 SV=3 40 154 3.0E-12
sp|Q6NAM1|DEHA_RHOPA Fluoroacetate dehalogenase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA1163 PE=1 SV=1 40 312 8.0E-12
sp|Q55921|PRXC_SYNY3 Putative non-heme chloroperoxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0314 PE=3 SV=1 32 144 6.0E-11
sp|Q9A919|DHMA_CAUCR Haloalkane dehalogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dhmA PE=3 SV=1 18 136 1.0E-10
sp|B8H3S9|DHMA_CAUCN Haloalkane dehalogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=dhmA PE=3 SV=1 18 136 1.0E-10
sp|P29715|BPOA2_STRAU Non-haem bromoperoxidase BPO-A2 OS=Streptomyces aureofaciens GN=bpoA2 PE=1 SV=3 33 138 2.0E-10
sp|O31168|PRXC_STRAU Non-heme chloroperoxidase OS=Streptomyces aureofaciens GN=cpo PE=1 SV=1 33 138 3.0E-10
sp|Q73Y99|DHMA_MYCPA Haloalkane dehalogenase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dhmA PE=3 SV=1 23 161 3.0E-10
sp|Q93K00|DHMA_MYCAV Haloalkane dehalogenase OS=Mycobacterium avium GN=dhmA PE=1 SV=1 23 161 3.0E-10
sp|P9WMS3|DHMA1_MYCTU Haloalkane dehalogenase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dhmA1 PE=1 SV=1 23 202 5.0E-10
sp|P9WMS2|DHMA1_MYCTO Haloalkane dehalogenase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dhmA1 PE=3 SV=1 23 202 5.0E-10
sp|P64302|DHMA1_MYCBO Haloalkane dehalogenase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dhmA1 PE=3 SV=1 23 202 5.0E-10
sp|Q01398|DEH1_MORSB Haloacetate dehalogenase H-1 OS=Moraxella sp. (strain B) GN=dehH1 PE=1 SV=1 40 139 2.0E-09
sp|Q6Q3H0|DHLA_XANFL Haloalkane dehalogenase OS=Xanthobacter flavus GN=dhlA PE=3 SV=1 19 139 2.0E-09
sp|P23133|TODF_PSEP1 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todF PE=3 SV=2 32 138 2.0E-09
sp|P22643|DHLA_XANAU Haloalkane dehalogenase OS=Xanthobacter autotrophicus GN=dhlA PE=1 SV=2 19 139 2.0E-09
sp|P49323|PRXC_STRLI Non-heme chloroperoxidase OS=Streptomyces lividans GN=cpo PE=1 SV=2 40 152 3.0E-09
sp|P53750|YN93_YEAST Uncharacterized hydrolase YNR064C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR064C PE=3 SV=1 37 135 6.0E-09
sp|B0SY51|DHMA_CAUSK Haloalkane dehalogenase OS=Caulobacter sp. (strain K31) GN=dhmA PE=3 SV=1 23 136 1.0E-08
sp|Q1QBB9|DHMA_PSYCK Haloalkane dehalogenase OS=Psychrobacter cryohalolentis (strain K5) GN=dhmA PE=3 SV=1 23 135 1.0E-08
sp|B4RF90|DHMA_PHEZH Haloalkane dehalogenase OS=Phenylobacterium zucineum (strain HLK1) GN=dhmA PE=3 SV=1 23 136 1.0E-08
sp|B2HJU9|DHMA_MYCMM Haloalkane dehalogenase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=dhmA PE=3 SV=1 23 124 1.0E-08
sp|Q96I13|ABHD8_HUMAN Abhydrolase domain-containing protein 8 OS=Homo sapiens GN=ABHD8 PE=2 SV=1 43 138 2.0E-08
sp|Q17QP1|ABHD8_BOVIN Abhydrolase domain-containing protein 8 OS=Bos taurus GN=ABHD8 PE=2 SV=1 43 138 2.0E-08
sp|Q4R584|ABHD8_MACFA Abhydrolase domain-containing protein 8 OS=Macaca fascicularis GN=ABHD8 PE=2 SV=1 43 138 2.0E-08
sp|Q8R0P8|ABHD8_MOUSE Abhydrolase domain-containing protein 8 OS=Mus musculus GN=Abhd8 PE=2 SV=1 43 138 2.0E-08
sp|Q52036|BPHD_PSEPU 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas putida GN=bphD PE=3 SV=1 50 154 3.0E-08
sp|Q2VLB9|BPHD_BURCE 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia cepacia GN=bphD PE=3 SV=1 32 131 3.0E-08
sp|Q8KZP5|MHPC_COMTE 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Comamonas testosteroni GN=mhpC PE=1 SV=1 32 137 5.0E-08
sp|P17548|BPHD_PSES1 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas sp. (strain KKS102) GN=bphD PE=1 SV=2 50 137 8.0E-08
sp|A4JPX5|MHPC_BURVG 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mhpC PE=3 SV=1 31 154 1.0E-07
sp|Q52011|BPHD_PSEPS 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas pseudoalcaligenes GN=bphD PE=2 SV=1 50 167 2.0E-07
sp|Q59324|BPHD_COMTE 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Comamonas testosteroni GN=bphD PE=3 SV=1 15 147 3.0E-07
sp|Q6AX59|ABHD8_XENLA Abhydrolase domain-containing protein 8 OS=Xenopus laevis GN=abhd8 PE=2 SV=1 27 138 4.0E-07
sp|P47229|BPHD_BURXL 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia xenovorans (strain LB400) GN=bphD PE=1 SV=1 50 167 5.0E-07
sp|P19076|DMPD_PSEUF 2-hydroxymuconate semialdehyde hydrolase OS=Pseudomonas sp. (strain CF600) GN=dmpD PE=3 SV=1 32 137 7.0E-07
sp|Q47HL4|MHPC1_DECAR 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 1 OS=Dechloromonas aromatica (strain RCB) GN=mhpC1 PE=3 SV=1 27 193 1.0E-06
sp|B2JQW2|MHPC_BURP8 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=mhpC PE=3 SV=1 38 154 2.0E-06
sp|Q47GC1|MHPC2_DECAR 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 2 OS=Dechloromonas aromatica (strain RCB) GN=mhpC2 PE=3 SV=2 27 193 2.0E-06
sp|A1VUV0|BPHD_POLNA 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Polaromonas naphthalenivorans (strain CJ2) GN=bphD PE=3 SV=1 50 167 2.0E-06
sp|Q400K3|MHPC2_PSEPU 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 2 OS=Pseudomonas putida GN=mhpC2 PE=3 SV=1 7 192 3.0E-06
sp|Q49KF8|MHPC1_PSEPU 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase 1 OS=Pseudomonas putida GN=mhpC1 PE=3 SV=2 38 191 3.0E-06
sp|P27747|ACOC_CUPNH Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acoC PE=1 SV=3 38 138 5.0E-06
sp|P07383|TPES_PSEPU Tropinesterase OS=Pseudomonas putida PE=1 SV=1 40 139 7.0E-06
sp|O31158|PRXC_PSEFL Non-heme chloroperoxidase OS=Pseudomonas fluorescens GN=cpo PE=1 SV=3 33 152 7.0E-06
sp|P22862|ESTE_PSEFL Arylesterase OS=Pseudomonas fluorescens PE=1 SV=4 53 161 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|067710
MDPTRPESFNHRFEKLSTGRTYHFVDQLPSNHDTSLNQAIVCIHGFPDCWYGWRYQIGPWVRQGYRVIVPDTLGY
GDTDKPSSAEEYSMKSLCADIAALLDKAGLEKAIIVGHDWGSHMVGRFALYYPNRVLALAMLSVPYIPPSPVYLP
LEEVARKSPNLGYQLFFGSQQSTKIIEVNLRGFMDVIFQQTDSKGVAADFTRKGAMDALLNNSHVRSSGSVLDPR
EFEYYHQVLSKGMNEPLNYYRTSKFRHDEEKADGLPSNLRADLPVLFLWGTKDRTATPALIRKSSKFITRLQDIA
IENKGHWIMAEAKYEVTAHIAEWLKGLGYQNIRGKL*
Coding >AgabiH97|067710
ATGGATCCTACCCGGCCAGAAAGCTTTAATCATCGGTTCGAGAAACTCTCGACTGGCCGCACATATCACTTTGTT
GACCAACTTCCAAGCAATCATGACACTAGCCTAAATCAGGCCATCGTCTGCATTCATGGCTTTCCTGATTGCTGG
TACGGTTGGCGTTACCAGATTGGGCCCTGGGTTCGACAGGGCTATCGCGTCATTGTGCCAGATACACTTGGCTAT
GGCGATACAGACAAGCCCTCGTCTGCAGAAGAATACTCAATGAAGAGCCTTTGCGCCGATATAGCCGCTTTACTG
GACAAGGCTGGTCTGGAAAAAGCCATTATAGTTGGACATGACTGGGGCTCTCATATGGTCGGAAGATTCGCCCTT
TACTATCCAAATCGTGTGTTGGCTCTCGCTATGTTGAGTGTACCTTATATCCCGCCTTCACCCGTCTATTTGCCC
CTCGAGGAGGTTGCAAGAAAGAGCCCGAATTTAGGATATCAACTCTTTTTCGGTAGCCAGCAATCAACGAAGATA
ATCGAAGTTAATCTCCGTGGTTTCATGGACGTCATCTTCCAGCAAACCGACTCAAAAGGTGTTGCTGCTGATTTT
ACGAGGAAAGGAGCCATGGATGCACTACTTAATAATTCACATGTCAGATCCTCCGGTTCCGTTCTAGACCCGAGG
GAGTTTGAGTACTACCACCAAGTCTTGAGTAAAGGGATGAATGAGCCTTTGAACTATTATCGAACTTCGAAATTC
AGGCATGATGAAGAAAAAGCTGACGGCCTTCCCTCCAATTTGCGTGCAGATCTACCTGTACTGTTTCTATGGGGC
ACTAAAGACCGTACTGCTACACCCGCATTGATCAGAAAGTCCTCGAAGTTTATTACTCGGCTACAGGATATTGCT
ATAGAGAACAAAGGGCATTGGATTATGGCGGAAGCCAAATATGAAGTAACTGCTCATATTGCTGAATGGCTAAAG
GGCCTGGGTTACCAGAACATTCGAGGAAAACTCTAG
Transcript >AgabiH97|067710
ATGGATCCTACCCGGCCAGAAAGCTTTAATCATCGGTTCGAGAAACTCTCGACTGGCCGCACATATCACTTTGTT
GACCAACTTCCAAGCAATCATGACACTAGCCTAAATCAGGCCATCGTCTGCATTCATGGCTTTCCTGATTGCTGG
TACGGTTGGCGTTACCAGATTGGGCCCTGGGTTCGACAGGGCTATCGCGTCATTGTGCCAGATACACTTGGCTAT
GGCGATACAGACAAGCCCTCGTCTGCAGAAGAATACTCAATGAAGAGCCTTTGCGCCGATATAGCCGCTTTACTG
GACAAGGCTGGTCTGGAAAAAGCCATTATAGTTGGACATGACTGGGGCTCTCATATGGTCGGAAGATTCGCCCTT
TACTATCCAAATCGTGTGTTGGCTCTCGCTATGTTGAGTGTACCTTATATCCCGCCTTCACCCGTCTATTTGCCC
CTCGAGGAGGTTGCAAGAAAGAGCCCGAATTTAGGATATCAACTCTTTTTCGGTAGCCAGCAATCAACGAAGATA
ATCGAAGTTAATCTCCGTGGTTTCATGGACGTCATCTTCCAGCAAACCGACTCAAAAGGTGTTGCTGCTGATTTT
ACGAGGAAAGGAGCCATGGATGCACTACTTAATAATTCACATGTCAGATCCTCCGGTTCCGTTCTAGACCCGAGG
GAGTTTGAGTACTACCACCAAGTCTTGAGTAAAGGGATGAATGAGCCTTTGAACTATTATCGAACTTCGAAATTC
AGGCATGATGAAGAAAAAGCTGACGGCCTTCCCTCCAATTTGCGTGCAGATCTACCTGTACTGTTTCTATGGGGC
ACTAAAGACCGTACTGCTACACCCGCATTGATCAGAAAGTCCTCGAAGTTTATTACTCGGCTACAGGATATTGCT
ATAGAGAACAAAGGGCATTGGATTATGGCGGAAGCCAAATATGAAGTAACTGCTCATATTGCTGAATGGCTAAAG
GGCCTGGGTTACCAGAACATTCGAGGAAAACTCTAG
Gene >AgabiH97|067710
ATGGATCCTACCCGGCCAGAAAGCTTTAATCATCGGTTCGAGAAACTCTCGACTGGCCGCACATATCACTTTGTG
CTCATCTCAGCCTTTGTGTACTGCATCGAATCTGACCACCTCTCAGGTTGACCAACTTCCAAGCAATCATGACAC
TAGCCTAAATCAGGCCATCGTCTGCATTCATGGCTTTCCTGATTGCTGGTAAGAATAAAAGTGTGGTAGTATTAT
CCGTATTAATTGTGTAGGTACGGTTGGCGTTACCAGATTGGGCCCTGGGTTCGACAGGGCTATCGCGTCATTGTG
CCAGATACACTTGGCTATGGCGATACAGACAAGCCCTCGTCTGCAGAAGAATACTCAATGAAGAGCCTTTGCGCC
GATATAGCCGCTTTACTGGACAAGGCTGGTCTGGAAAAAGCCGTTCGTCTCTGGCCACCTCTCTTTCACCTTACA
CTGACAACAGGCCGAAAGATTATAGTTGGACATGACTGGGGCTCTCATATGGTCGGAAGATTCGCCCTTTACTAT
CCAAATCGTGTGTTGGCTCTCGCTATGTCAGTAAATTAACTTGAGGTTGTCATGTCTTTCACTCATATCTCTTGA
TTAGGTTGAGTGTACCTTATATCCCGCCTTCACCCGTCTATTTGCCCCTCGAGGAGGTTGCAAGAAAGAGCCCGA
ATTTAGGATATCAACTCTTTTTCGGTAGCCAGCAATCAACGAAGATAATCGAAGTTAATGTAAATTTGTACACTT
GTCTTCCCCGTCGTATTTAAACTAACAATCTTTCGCTAGCTCCGTGGTTTCATGGACGTCATCTTCCAGCAAACC
GACTCAAAAGGTGTTGCTGCTGATTTTACGAGGAAAGGAGCCATGGATGCACTACTTAATAATTCACATGTCAGA
TCCTCCGGTTCCGTTCTAGACCCGAGGGTGCGTCCGGCAACTTCTATAGTTGTATAATGCCTGACACCAACTAAC
TAGGAGTTTGAGTACTACCACCAAGTCTTGAGTAAAGGGATGAATGAGCCTTTGAACTATTATCGAACTTCGAAA
TTCAGGCATGATGAAGAAAAAGGTGCAAACATCAAACTTCTCTACCACCTTACCAAATTACTAATATTTAATATT
AGCTGACGGCCTTCCCTCCAATTTGCGTGCAGATCTACCTGTACTGTTTCTATGGGGCACTAAAGACCGTACTGC
TACACCCGCATTGATCAGAAAGTCCTCGAAGTTTATTACTCGGCTACAGGATATTGCTATAGAGAACAAAGGGCA
TTGGATTATGGCGGAAGCCAAATATGAAGTAACTGCTCATATTGCTGAATGGCTAAAGGGCCTGGGTTACCAGAA
CATTCGAGGAAAACTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail